data_1RCL
# 
_entry.id   1RCL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1RCL         pdb_00001rcl 10.2210/pdb1rcl/pdb 
WWPDB D_1000176019 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-11-30 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
5 'Structure model' 2 0 2019-12-25 
6 'Structure model' 2 1 2024-11-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Version format compliance' 
3  4 'Structure model' 'Derived calculations'      
4  4 'Structure model' Other                       
5  5 'Structure model' 'Database references'       
6  5 'Structure model' 'Derived calculations'      
7  5 'Structure model' 'Polymer sequence'          
8  6 'Structure model' 'Data collection'           
9  6 'Structure model' 'Database references'       
10 6 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' pdbx_database_status      
2  4 'Structure model' pdbx_struct_assembly      
3  4 'Structure model' pdbx_struct_oper_list     
4  4 'Structure model' struct_conf               
5  4 'Structure model' struct_conf_type          
6  5 'Structure model' entity_poly               
7  5 'Structure model' pdbx_struct_mod_residue   
8  5 'Structure model' struct_conn               
9  5 'Structure model' struct_ref_seq_dif        
10 6 'Structure model' chem_comp_atom            
11 6 'Structure model' chem_comp_bond            
12 6 'Structure model' database_2                
13 6 'Structure model' pdbx_entry_details        
14 6 'Structure model' pdbx_modification_feature 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_pdbx_database_status.process_site'        
2 5 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 
3 5 'Structure model' '_pdbx_struct_mod_residue.parent_comp_id'   
4 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'       
5 5 'Structure model' '_struct_ref_seq_dif.details'               
6 6 'Structure model' '_database_2.pdbx_DOI'                      
7 6 'Structure model' '_database_2.pdbx_database_accession'       
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RCL 
_pdbx_database_status.recvd_initial_deposition_date   1994-08-08 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1RCK 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   ensemble 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nakai, T.'     1 
'Yoshikawa, W.' 2 
'Nakamura, H.'  3 
'Yoshida, H.'   4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;The three-dimensional structure of guanine-specific ribonuclease F1 in solution determined by NMR spectroscopy and distance geometry.
;
Eur.J.Biochem.    208 41  51 1992 EJBCAI IX 0014-2956 0262 ? 1511688 10.1111/j.1432-1033.1992.tb17157.x 
1       
;Accurate Determination of Protein Conformations by Nuclear Magnetic Resonance Spectroscopy and Distance Geometry and Analysis of Their Structural Features
;
'To be Published' ?   ?   ?  ?    ?      ?  ?         0353 ? ?       ?                                  
2       
;Crystal Structures of Ribonuclease F1 of Fusarium Moniliforme in its Free Form and in Complex with 2'Gmp
;
J.Mol.Biol.       230 979 ?  1993 JMOBAK UK 0022-2836 0070 ? ?       ?                                  
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Nakai, T.'            1  ? 
primary 'Yoshikawa, W.'        2  ? 
primary 'Nakamura, H.'         3  ? 
primary 'Yoshida, H.'          4  ? 
1       'Nakai, T.'            5  ? 
2       'Vassylyev, D.G.'      6  ? 
2       'Katayanagi, K.'       7  ? 
2       'Ishikawa, K.'         8  ? 
2       'Tsujimoto-Hirano, M.' 9  ? 
2       'Danno, M.'            10 ? 
2       'Pahler, A.'           11 ? 
2       'Matsumoto, O.'        12 ? 
2       'Matsushima, M.'       13 ? 
2       'Yoshida, H.'          14 ? 
2       'Morikawa, K.'         15 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'RIBONUCLEASE F1' 
_entity.formula_weight             10989.544 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    3.1.27.3 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(PCA)SATTCGSTNYSASQVRAAANAACQYYQNDDTAGSSTYPHTYNNYEGFDFPVDGPYQEFPIKSGGVYTGGSPGADR
VVINTNCEYAGAITHTGASGNNFVGCSGTN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;QSATTCGSTNYSASQVRAAANAACQYYQNDDTAGSSTYPHTYNNYEGFDFPVDGPYQEFPIKSGGVYTGGSPGADRVVIN
TNCEYAGAITHTGASGNNFVGCSGTN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PCA n 
1 2   SER n 
1 3   ALA n 
1 4   THR n 
1 5   THR n 
1 6   CYS n 
1 7   GLY n 
1 8   SER n 
1 9   THR n 
1 10  ASN n 
1 11  TYR n 
1 12  SER n 
1 13  ALA n 
1 14  SER n 
1 15  GLN n 
1 16  VAL n 
1 17  ARG n 
1 18  ALA n 
1 19  ALA n 
1 20  ALA n 
1 21  ASN n 
1 22  ALA n 
1 23  ALA n 
1 24  CYS n 
1 25  GLN n 
1 26  TYR n 
1 27  TYR n 
1 28  GLN n 
1 29  ASN n 
1 30  ASP n 
1 31  ASP n 
1 32  THR n 
1 33  ALA n 
1 34  GLY n 
1 35  SER n 
1 36  SER n 
1 37  THR n 
1 38  TYR n 
1 39  PRO n 
1 40  HIS n 
1 41  THR n 
1 42  TYR n 
1 43  ASN n 
1 44  ASN n 
1 45  TYR n 
1 46  GLU n 
1 47  GLY n 
1 48  PHE n 
1 49  ASP n 
1 50  PHE n 
1 51  PRO n 
1 52  VAL n 
1 53  ASP n 
1 54  GLY n 
1 55  PRO n 
1 56  TYR n 
1 57  GLN n 
1 58  GLU n 
1 59  PHE n 
1 60  PRO n 
1 61  ILE n 
1 62  LYS n 
1 63  SER n 
1 64  GLY n 
1 65  GLY n 
1 66  VAL n 
1 67  TYR n 
1 68  THR n 
1 69  GLY n 
1 70  GLY n 
1 71  SER n 
1 72  PRO n 
1 73  GLY n 
1 74  ALA n 
1 75  ASP n 
1 76  ARG n 
1 77  VAL n 
1 78  VAL n 
1 79  ILE n 
1 80  ASN n 
1 81  THR n 
1 82  ASN n 
1 83  CYS n 
1 84  GLU n 
1 85  TYR n 
1 86  ALA n 
1 87  GLY n 
1 88  ALA n 
1 89  ILE n 
1 90  THR n 
1 91  HIS n 
1 92  THR n 
1 93  GLY n 
1 94  ALA n 
1 95  SER n 
1 96  GLY n 
1 97  ASN n 
1 98  ASN n 
1 99  PHE n 
1 100 VAL n 
1 101 GLY n 
1 102 CYS n 
1 103 SER n 
1 104 GLY n 
1 105 THR n 
1 106 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Gibberella 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Gibberella fujikuroi' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     5127 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE             ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE          ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'     ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE            ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE             ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE           ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE              ? 'C6 H15 N2 O2 1' 147.195 
PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID' ? 'C5 H7 N O3'     129.114 
PHE 'L-peptide linking' y PHENYLALANINE       ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE              ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE           ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE              ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PCA 1   1   1   PCA PCA A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   ALA 3   3   3   ALA ALA A . n 
A 1 4   THR 4   4   4   THR THR A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   CYS 6   6   6   CYS CYS A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   SER 8   8   8   SER SER A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  ASN 10  10  10  ASN ASN A . n 
A 1 11  TYR 11  11  11  TYR TYR A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  SER 14  14  14  SER SER A . n 
A 1 15  GLN 15  15  15  GLN GLN A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  ALA 18  18  18  ALA ALA A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  ASN 21  21  21  ASN ASN A . n 
A 1 22  ALA 22  22  22  ALA ALA A . n 
A 1 23  ALA 23  23  23  ALA ALA A . n 
A 1 24  CYS 24  24  24  CYS CYS A . n 
A 1 25  GLN 25  25  25  GLN GLN A . n 
A 1 26  TYR 26  26  26  TYR TYR A . n 
A 1 27  TYR 27  27  27  TYR TYR A . n 
A 1 28  GLN 28  28  28  GLN GLN A . n 
A 1 29  ASN 29  29  29  ASN ASN A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  ASP 31  31  31  ASP ASP A . n 
A 1 32  THR 32  32  32  THR THR A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  TYR 38  38  38  TYR TYR A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  HIS 40  40  40  HIS HIS A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  TYR 42  42  42  TYR TYR A . n 
A 1 43  ASN 43  43  43  ASN ASN A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  TYR 45  45  45  TYR TYR A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  PHE 48  48  48  PHE PHE A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TYR 56  56  56  TYR TYR A . n 
A 1 57  GLN 57  57  57  GLN GLN A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  PHE 59  59  59  PHE PHE A . n 
A 1 60  PRO 60  60  60  PRO PRO A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  TYR 67  67  67  TYR TYR A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  PRO 72  72  72  PRO PRO A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  ALA 74  74  74  ALA ALA A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  VAL 77  77  77  VAL VAL A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  ILE 79  79  79  ILE ILE A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  THR 81  81  81  THR THR A . n 
A 1 82  ASN 82  82  82  ASN ASN A . n 
A 1 83  CYS 83  83  83  CYS CYS A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  TYR 85  85  85  TYR TYR A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  HIS 91  91  91  HIS HIS A . n 
A 1 92  THR 92  92  92  THR THR A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  PHE 99  99  99  PHE PHE A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 CYS 102 102 102 CYS CYS A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 THR 105 105 105 THR THR A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
# 
_cell.entry_id           1RCL 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RCL 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_exptl.entry_id          1RCL 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_database_PDB_matrix.entry_id          1RCL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1RCL 
_struct.title                     
;THE THREE DIMENSIONAL STRUCTURE OF GUANINE-SPECIFIC RIBONUCLEASE F1 IN SOLUTION DETERMINED BY NMR SPECTROSCOPY AND DISTANCE GEOMETRY
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RCL 
_struct_keywords.pdbx_keywords   'HYDROLASE(ENDORIBONUCLEASE)' 
_struct_keywords.text            'HYDROLASE(ENDORIBONUCLEASE)' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RNF1_GIBFU 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P10282 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;QSATTCGSTNYSASQVRAAANAACQYYQNDDSAGSTTYPHTYNNYEGFDFPVDGPYQEFPIKSGGVYTGGSPGADRVVIN
TNCEYAGAITHTGASGNNFVGCSGTN
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1RCL 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 106 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P10282 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  106 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       106 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1RCL THR A 32 ? UNP P10282 SER 32 conflict 32 1 
1 1RCL SER A 36 ? UNP P10282 THR 36 conflict 36 2 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       H1 
_struct_conf.beg_label_comp_id       ALA 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        13 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ASN 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        29 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ALA 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         13 
_struct_conf.end_auth_comp_id        ASN 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         29 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 6  SG ? ? ? 1_555 A CYS 102 SG ? ? A CYS 6  A CYS 102 1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf2 disulf ?    ? A CYS 24 SG ? ? ? 1_555 A CYS 83  SG ? ? A CYS 24 A CYS 83  1_555 ? ? ? ? ? ? ? 2.045 ? ? 
covale1 covale both ? A PCA 1  C  ? ? ? 1_555 A SER 2   N  ? ? A PCA 1  A SER 2   1_555 ? ? ? ? ? ? ? 1.341 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 PCA A 1  ? .   . .   . PCA A 1  ? 1_555 .   . .   . .     .  .  GLN 1 PCA 'Pyrrolidone carboxylic acid' 
'Named protein modification' 
2 CYS A 6  ? CYS A 102 ? CYS A 6  ? 1_555 CYS A 102 ? 1_555 SG SG .   . .   None                          'Disulfide bridge' 
3 CYS A 24 ? CYS A 83  ? CYS A 24 ? 1_555 CYS A 83  ? 1_555 SG SG .   . .   None                          'Disulfide bridge' 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 38 A . ? TYR 38 A PRO 39 A ? PRO 39 A 1 3.04  
2 GLY 54 A . ? GLY 54 A PRO 55 A ? PRO 55 A 1 -1.04 
3 SER 71 A . ? SER 71 A PRO 72 A ? PRO 72 A 1 -4.00 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
S1 ? 2 ? 
S2 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1 1 2 ? anti-parallel 
S2 1 2 ? anti-parallel 
S2 2 3 ? anti-parallel 
S2 3 4 ? anti-parallel 
S2 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1 1 THR A 4  ? CYS A 6   ? THR A 4  CYS A 6   
S1 2 THR A 9  ? TYR A 11  ? THR A 9  TYR A 11  
S2 1 PRO A 39 ? TYR A 42  ? PRO A 39 TYR A 42  
S2 2 TYR A 56 ? ILE A 61  ? TYR A 56 ILE A 61  
S2 3 ASP A 75 ? ASN A 80  ? ASP A 75 ASN A 80  
S2 4 GLU A 84 ? HIS A 91  ? GLU A 84 HIS A 91  
S2 5 PHE A 99 ? CYS A 102 ? PHE A 99 CYS A 102 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
S1 1 2 N THR A 4  ? N THR A 4  O TYR A 11  ? O TYR A 11  
S2 1 2 N TYR A 42 ? N TYR A 42 O TYR A 56  ? O TYR A 56  
S2 2 3 N GLN A 57 ? N GLN A 57 O ILE A 79  ? O ILE A 79  
S2 3 4 N ARG A 76 ? N ARG A 76 O ILE A 89  ? O ILE A 89  
S2 4 5 N ALA A 88 ? N ALA A 88 O CYS A 102 ? O CYS A 102 
# 
_struct_site.id                   CAT 
_struct_site.pdbx_evidence_code   Unknown 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              ? 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 CAT 4 HIS A 40 ? HIS A 40 . ? 1_555 ? 
2 CAT 4 GLU A 58 ? GLU A 58 . ? 1_555 ? 
3 CAT 4 ARG A 76 ? ARG A 76 . ? 1_555 ? 
4 CAT 4 HIS A 91 ? HIS A 91 . ? 1_555 ? 
# 
_pdbx_entry_details.entry_id                   1RCL 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 3  ? ? 57.66   84.71   
2  1 ASN A 29 ? ? -176.51 37.80   
3  1 ASP A 31 ? ? 89.63   157.00  
4  1 ALA A 33 ? ? -61.26  93.84   
5  1 SER A 35 ? ? 71.99   133.92  
6  1 THR A 37 ? ? -147.19 -32.04  
7  1 ASN A 44 ? ? 32.72   -156.62 
8  1 TYR A 45 ? ? 67.44   151.35  
9  1 VAL A 52 ? ? -146.58 -114.75 
10 1 ASP A 53 ? ? -157.89 -56.09  
11 1 PHE A 59 ? ? -160.21 102.57  
12 1 TYR A 67 ? ? -3.67   118.24  
13 1 THR A 68 ? ? -122.61 -51.19  
14 1 SER A 71 ? ? 81.80   135.34  
15 1 ASN A 82 ? ? -157.36 -86.45  
16 1 CYS A 83 ? ? -163.22 5.16    
17 1 ASN A 98 ? ? -66.41  -178.45 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    PCA 
_pdbx_struct_mod_residue.label_seq_id     1 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     PCA 
_pdbx_struct_mod_residue.auth_seq_id      1 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   GLN 
_pdbx_struct_mod_residue.details          'PYROGLUTAMIC ACID' 
# 
_pdbx_nmr_ensemble.entry_id                             1RCL 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    1 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement EMBOSS ? NAKAI,KIDERA,NAKAMURA                1 
refinement PRESTO ? MORIKAMI,NAKAI,KIDERA,SAITO,NAKAMURA 2 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
ILE N    N N N 158 
ILE CA   C N S 159 
ILE C    C N N 160 
ILE O    O N N 161 
ILE CB   C N S 162 
ILE CG1  C N N 163 
ILE CG2  C N N 164 
ILE CD1  C N N 165 
ILE OXT  O N N 166 
ILE H    H N N 167 
ILE H2   H N N 168 
ILE HA   H N N 169 
ILE HB   H N N 170 
ILE HG12 H N N 171 
ILE HG13 H N N 172 
ILE HG21 H N N 173 
ILE HG22 H N N 174 
ILE HG23 H N N 175 
ILE HD11 H N N 176 
ILE HD12 H N N 177 
ILE HD13 H N N 178 
ILE HXT  H N N 179 
LYS N    N N N 180 
LYS CA   C N S 181 
LYS C    C N N 182 
LYS O    O N N 183 
LYS CB   C N N 184 
LYS CG   C N N 185 
LYS CD   C N N 186 
LYS CE   C N N 187 
LYS NZ   N N N 188 
LYS OXT  O N N 189 
LYS H    H N N 190 
LYS H2   H N N 191 
LYS HA   H N N 192 
LYS HB2  H N N 193 
LYS HB3  H N N 194 
LYS HG2  H N N 195 
LYS HG3  H N N 196 
LYS HD2  H N N 197 
LYS HD3  H N N 198 
LYS HE2  H N N 199 
LYS HE3  H N N 200 
LYS HZ1  H N N 201 
LYS HZ2  H N N 202 
LYS HZ3  H N N 203 
LYS HXT  H N N 204 
PCA N    N N N 205 
PCA CA   C N S 206 
PCA CB   C N N 207 
PCA CG   C N N 208 
PCA CD   C N N 209 
PCA OE   O N N 210 
PCA C    C N N 211 
PCA O    O N N 212 
PCA OXT  O N N 213 
PCA H    H N N 214 
PCA HA   H N N 215 
PCA HB2  H N N 216 
PCA HB3  H N N 217 
PCA HG2  H N N 218 
PCA HG3  H N N 219 
PCA HXT  H N N 220 
PHE N    N N N 221 
PHE CA   C N S 222 
PHE C    C N N 223 
PHE O    O N N 224 
PHE CB   C N N 225 
PHE CG   C Y N 226 
PHE CD1  C Y N 227 
PHE CD2  C Y N 228 
PHE CE1  C Y N 229 
PHE CE2  C Y N 230 
PHE CZ   C Y N 231 
PHE OXT  O N N 232 
PHE H    H N N 233 
PHE H2   H N N 234 
PHE HA   H N N 235 
PHE HB2  H N N 236 
PHE HB3  H N N 237 
PHE HD1  H N N 238 
PHE HD2  H N N 239 
PHE HE1  H N N 240 
PHE HE2  H N N 241 
PHE HZ   H N N 242 
PHE HXT  H N N 243 
PRO N    N N N 244 
PRO CA   C N S 245 
PRO C    C N N 246 
PRO O    O N N 247 
PRO CB   C N N 248 
PRO CG   C N N 249 
PRO CD   C N N 250 
PRO OXT  O N N 251 
PRO H    H N N 252 
PRO HA   H N N 253 
PRO HB2  H N N 254 
PRO HB3  H N N 255 
PRO HG2  H N N 256 
PRO HG3  H N N 257 
PRO HD2  H N N 258 
PRO HD3  H N N 259 
PRO HXT  H N N 260 
SER N    N N N 261 
SER CA   C N S 262 
SER C    C N N 263 
SER O    O N N 264 
SER CB   C N N 265 
SER OG   O N N 266 
SER OXT  O N N 267 
SER H    H N N 268 
SER H2   H N N 269 
SER HA   H N N 270 
SER HB2  H N N 271 
SER HB3  H N N 272 
SER HG   H N N 273 
SER HXT  H N N 274 
THR N    N N N 275 
THR CA   C N S 276 
THR C    C N N 277 
THR O    O N N 278 
THR CB   C N R 279 
THR OG1  O N N 280 
THR CG2  C N N 281 
THR OXT  O N N 282 
THR H    H N N 283 
THR H2   H N N 284 
THR HA   H N N 285 
THR HB   H N N 286 
THR HG1  H N N 287 
THR HG21 H N N 288 
THR HG22 H N N 289 
THR HG23 H N N 290 
THR HXT  H N N 291 
TYR N    N N N 292 
TYR CA   C N S 293 
TYR C    C N N 294 
TYR O    O N N 295 
TYR CB   C N N 296 
TYR CG   C Y N 297 
TYR CD1  C Y N 298 
TYR CD2  C Y N 299 
TYR CE1  C Y N 300 
TYR CE2  C Y N 301 
TYR CZ   C Y N 302 
TYR OH   O N N 303 
TYR OXT  O N N 304 
TYR H    H N N 305 
TYR H2   H N N 306 
TYR HA   H N N 307 
TYR HB2  H N N 308 
TYR HB3  H N N 309 
TYR HD1  H N N 310 
TYR HD2  H N N 311 
TYR HE1  H N N 312 
TYR HE2  H N N 313 
TYR HH   H N N 314 
TYR HXT  H N N 315 
VAL N    N N N 316 
VAL CA   C N S 317 
VAL C    C N N 318 
VAL O    O N N 319 
VAL CB   C N N 320 
VAL CG1  C N N 321 
VAL CG2  C N N 322 
VAL OXT  O N N 323 
VAL H    H N N 324 
VAL H2   H N N 325 
VAL HA   H N N 326 
VAL HB   H N N 327 
VAL HG11 H N N 328 
VAL HG12 H N N 329 
VAL HG13 H N N 330 
VAL HG21 H N N 331 
VAL HG22 H N N 332 
VAL HG23 H N N 333 
VAL HXT  H N N 334 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LYS N   CA   sing N N 171 
LYS N   H    sing N N 172 
LYS N   H2   sing N N 173 
LYS CA  C    sing N N 174 
LYS CA  CB   sing N N 175 
LYS CA  HA   sing N N 176 
LYS C   O    doub N N 177 
LYS C   OXT  sing N N 178 
LYS CB  CG   sing N N 179 
LYS CB  HB2  sing N N 180 
LYS CB  HB3  sing N N 181 
LYS CG  CD   sing N N 182 
LYS CG  HG2  sing N N 183 
LYS CG  HG3  sing N N 184 
LYS CD  CE   sing N N 185 
LYS CD  HD2  sing N N 186 
LYS CD  HD3  sing N N 187 
LYS CE  NZ   sing N N 188 
LYS CE  HE2  sing N N 189 
LYS CE  HE3  sing N N 190 
LYS NZ  HZ1  sing N N 191 
LYS NZ  HZ2  sing N N 192 
LYS NZ  HZ3  sing N N 193 
LYS OXT HXT  sing N N 194 
PCA N   CA   sing N N 195 
PCA N   CD   sing N N 196 
PCA N   H    sing N N 197 
PCA CA  CB   sing N N 198 
PCA CA  C    sing N N 199 
PCA CA  HA   sing N N 200 
PCA CB  CG   sing N N 201 
PCA CB  HB2  sing N N 202 
PCA CB  HB3  sing N N 203 
PCA CG  CD   sing N N 204 
PCA CG  HG2  sing N N 205 
PCA CG  HG3  sing N N 206 
PCA CD  OE   doub N N 207 
PCA C   O    doub N N 208 
PCA C   OXT  sing N N 209 
PCA OXT HXT  sing N N 210 
PHE N   CA   sing N N 211 
PHE N   H    sing N N 212 
PHE N   H2   sing N N 213 
PHE CA  C    sing N N 214 
PHE CA  CB   sing N N 215 
PHE CA  HA   sing N N 216 
PHE C   O    doub N N 217 
PHE C   OXT  sing N N 218 
PHE CB  CG   sing N N 219 
PHE CB  HB2  sing N N 220 
PHE CB  HB3  sing N N 221 
PHE CG  CD1  doub Y N 222 
PHE CG  CD2  sing Y N 223 
PHE CD1 CE1  sing Y N 224 
PHE CD1 HD1  sing N N 225 
PHE CD2 CE2  doub Y N 226 
PHE CD2 HD2  sing N N 227 
PHE CE1 CZ   doub Y N 228 
PHE CE1 HE1  sing N N 229 
PHE CE2 CZ   sing Y N 230 
PHE CE2 HE2  sing N N 231 
PHE CZ  HZ   sing N N 232 
PHE OXT HXT  sing N N 233 
PRO N   CA   sing N N 234 
PRO N   CD   sing N N 235 
PRO N   H    sing N N 236 
PRO CA  C    sing N N 237 
PRO CA  CB   sing N N 238 
PRO CA  HA   sing N N 239 
PRO C   O    doub N N 240 
PRO C   OXT  sing N N 241 
PRO CB  CG   sing N N 242 
PRO CB  HB2  sing N N 243 
PRO CB  HB3  sing N N 244 
PRO CG  CD   sing N N 245 
PRO CG  HG2  sing N N 246 
PRO CG  HG3  sing N N 247 
PRO CD  HD2  sing N N 248 
PRO CD  HD3  sing N N 249 
PRO OXT HXT  sing N N 250 
SER N   CA   sing N N 251 
SER N   H    sing N N 252 
SER N   H2   sing N N 253 
SER CA  C    sing N N 254 
SER CA  CB   sing N N 255 
SER CA  HA   sing N N 256 
SER C   O    doub N N 257 
SER C   OXT  sing N N 258 
SER CB  OG   sing N N 259 
SER CB  HB2  sing N N 260 
SER CB  HB3  sing N N 261 
SER OG  HG   sing N N 262 
SER OXT HXT  sing N N 263 
THR N   CA   sing N N 264 
THR N   H    sing N N 265 
THR N   H2   sing N N 266 
THR CA  C    sing N N 267 
THR CA  CB   sing N N 268 
THR CA  HA   sing N N 269 
THR C   O    doub N N 270 
THR C   OXT  sing N N 271 
THR CB  OG1  sing N N 272 
THR CB  CG2  sing N N 273 
THR CB  HB   sing N N 274 
THR OG1 HG1  sing N N 275 
THR CG2 HG21 sing N N 276 
THR CG2 HG22 sing N N 277 
THR CG2 HG23 sing N N 278 
THR OXT HXT  sing N N 279 
TYR N   CA   sing N N 280 
TYR N   H    sing N N 281 
TYR N   H2   sing N N 282 
TYR CA  C    sing N N 283 
TYR CA  CB   sing N N 284 
TYR CA  HA   sing N N 285 
TYR C   O    doub N N 286 
TYR C   OXT  sing N N 287 
TYR CB  CG   sing N N 288 
TYR CB  HB2  sing N N 289 
TYR CB  HB3  sing N N 290 
TYR CG  CD1  doub Y N 291 
TYR CG  CD2  sing Y N 292 
TYR CD1 CE1  sing Y N 293 
TYR CD1 HD1  sing N N 294 
TYR CD2 CE2  doub Y N 295 
TYR CD2 HD2  sing N N 296 
TYR CE1 CZ   doub Y N 297 
TYR CE1 HE1  sing N N 298 
TYR CE2 CZ   sing Y N 299 
TYR CE2 HE2  sing N N 300 
TYR CZ  OH   sing N N 301 
TYR OH  HH   sing N N 302 
TYR OXT HXT  sing N N 303 
VAL N   CA   sing N N 304 
VAL N   H    sing N N 305 
VAL N   H2   sing N N 306 
VAL CA  C    sing N N 307 
VAL CA  CB   sing N N 308 
VAL CA  HA   sing N N 309 
VAL C   O    doub N N 310 
VAL C   OXT  sing N N 311 
VAL CB  CG1  sing N N 312 
VAL CB  CG2  sing N N 313 
VAL CB  HB   sing N N 314 
VAL CG1 HG11 sing N N 315 
VAL CG1 HG12 sing N N 316 
VAL CG1 HG13 sing N N 317 
VAL CG2 HG21 sing N N 318 
VAL CG2 HG22 sing N N 319 
VAL CG2 HG23 sing N N 320 
VAL OXT HXT  sing N N 321 
# 
_atom_sites.entry_id                    1RCL 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'CIS PROLINE - PRO      39' 
2 'CIS PROLINE - PRO      55' 
3 'CIS PROLINE - PRO      72' 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_