data_1RDL # _entry.id 1RDL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1RDL WWPDB D_1000176037 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RDL _pdbx_database_status.recvd_initial_deposition_date 1995-09-05 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ng, K.K.-S.' 1 'Drickamer, K.' 2 'Weis, W.I.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structural analysis of monosaccharide recognition by rat liver mannose-binding protein.' J.Biol.Chem. 271 663 674 1996 JBCHA3 US 0021-9258 0071 ? 8557671 10.1074/jbc.271.2.663 1 'Structure of a C-Type Mannose-Binding Protein Complexed with an Oligosaccharide' Nature 360 127 ? 1992 NATUAS UK 0028-0836 0006 ? ? ? 2 'Structure of the Calcium-Dependent Lectin Domain from a Rat Mannose-Binding Protein Determined by MAD Phasing' Science 254 1608 ? 1991 SCIEAS US 0036-8075 0038 ? ? ? 3 'Physical Characterization and Crystallization of the Carbohydrate-Recognition Domain of a Mannose-Binding Protein from Rat' J.Biol.Chem. 266 20678 ? 1991 JBCHA3 US 0021-9258 0071 ? ? ? 4 ;Differential Recognition of Core and Terminal Portions of Oligosaccharide Ligands by Carbohydrate-Recognition Domains of Two Mannose-Binding Proteins ; J.Biol.Chem. 265 20770 ? 1990 JBCHA3 US 0021-9258 0071 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ng, K.K.' 1 ? primary 'Drickamer, K.' 2 ? primary 'Weis, W.I.' 3 ? 1 'Weis, W.I.' 4 ? 1 'Drickamer, K.' 5 ? 1 'Hendrickson, W.A.' 6 ? 2 'Weis, W.I.' 7 ? 2 'Kahn, R.' 8 ? 2 'Fourme, R.' 9 ? 2 'Drickamer, K.' 10 ? 2 'Hendrickson, W.A.' 11 ? 3 'Weis, W.I.' 12 ? 3 'Crichlow, G.V.' 13 ? 3 'Murthy, H.M.K.' 14 ? 3 'Hendrickson, W.A.' 15 ? 3 'Drickamer, K.' 16 ? 4 'Childs, R.A.' 17 ? 4 'Feizi, T.' 18 ? 4 'Yuen, C.-T.' 19 ? 4 'Drickamer, K.' 20 ? 4 'Quesenberry, M.S.' 21 ? # _cell.entry_id 1RDL _cell.length_a 60.600 _cell.length_b 75.400 _cell.length_c 57.500 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1RDL _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'MANNOSE-BINDING PROTEIN-C' 12675.127 2 ? ? 'SUBTILISIN FRAGMENT (RESIDUES 114 - 226)' ? 2 non-polymer man 'methyl alpha-D-mannopyranoside' 194.182 2 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 4 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 water nat water 18.015 297 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name SUB-MBP-C # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KKYFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVAFLGITDQRTENVFEDLTGNRVRYTNWNEGEPNN VGSGENCVVLLTNGKWNDVPCSDSFLVVCEFSD ; _entity_poly.pdbx_seq_one_letter_code_can ;KKYFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVAFLGITDQRTENVFEDLTGNRVRYTNWNEGEPNN VGSGENCVVLLTNGKWNDVPCSDSFLVVCEFSD ; _entity_poly.pdbx_strand_id 1,2 _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 LYS n 1 3 TYR n 1 4 PHE n 1 5 MET n 1 6 SER n 1 7 SER n 1 8 VAL n 1 9 ARG n 1 10 ARG n 1 11 MET n 1 12 PRO n 1 13 LEU n 1 14 ASN n 1 15 ARG n 1 16 ALA n 1 17 LYS n 1 18 ALA n 1 19 LEU n 1 20 CYS n 1 21 SER n 1 22 GLU n 1 23 LEU n 1 24 GLN n 1 25 GLY n 1 26 THR n 1 27 VAL n 1 28 ALA n 1 29 THR n 1 30 PRO n 1 31 ARG n 1 32 ASN n 1 33 ALA n 1 34 GLU n 1 35 GLU n 1 36 ASN n 1 37 ARG n 1 38 ALA n 1 39 ILE n 1 40 GLN n 1 41 ASN n 1 42 VAL n 1 43 ALA n 1 44 LYS n 1 45 ASP n 1 46 VAL n 1 47 ALA n 1 48 PHE n 1 49 LEU n 1 50 GLY n 1 51 ILE n 1 52 THR n 1 53 ASP n 1 54 GLN n 1 55 ARG n 1 56 THR n 1 57 GLU n 1 58 ASN n 1 59 VAL n 1 60 PHE n 1 61 GLU n 1 62 ASP n 1 63 LEU n 1 64 THR n 1 65 GLY n 1 66 ASN n 1 67 ARG n 1 68 VAL n 1 69 ARG n 1 70 TYR n 1 71 THR n 1 72 ASN n 1 73 TRP n 1 74 ASN n 1 75 GLU n 1 76 GLY n 1 77 GLU n 1 78 PRO n 1 79 ASN n 1 80 ASN n 1 81 VAL n 1 82 GLY n 1 83 SER n 1 84 GLY n 1 85 GLU n 1 86 ASN n 1 87 CYS n 1 88 VAL n 1 89 VAL n 1 90 LEU n 1 91 LEU n 1 92 THR n 1 93 ASN n 1 94 GLY n 1 95 LYS n 1 96 TRP n 1 97 ASN n 1 98 ASP n 1 99 VAL n 1 100 PRO n 1 101 CYS n 1 102 SER n 1 103 ASP n 1 104 SER n 1 105 PHE n 1 106 LEU n 1 107 VAL n 1 108 VAL n 1 109 CYS n 1 110 GLU n 1 111 PHE n 1 112 SER n 1 113 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'black rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus rattus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10117 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ LIVER _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PINIIIOMPA2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'THE BACTERIALLY EXPRESSED MATERIAL IS DIGESTED WITH SUBTILISIN TO PRODUCE THE PROTEIN USED IN THE CRYSTAL STRUCTURE ANALYSIS' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MBL2_RAT _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P08661 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MSLFTSFLLLCVLTAVYAETLTEGAQSSCPVIACSSPGLNGFPGKDGHDGAKGEKGEPGQGLRGLQGPPGKVGPAGPPGN PGSKGATGPKGDRGESVEFDTTNIDLEIAALRSELRAMRKWVLLSMSENVGKKYFMSSVRRMPLNRAKALCSELQGTVAT PRNAEENRAIQNVAKDVAFLGITDQRTENVFEDLTGNRVRYTNWNEGEPNNVGSGENCVVLLTNGKWNDVPCSDSFLVVC EFSD ; _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1RDL 1 1 ? 113 ? P08661 132 ? 244 ? 114 226 2 1 1RDL 2 1 ? 113 ? P08661 132 ? 244 ? 114 226 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MMA D-saccharide n 'methyl alpha-D-mannopyranoside' ? 'C7 H14 O6' 194.182 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1RDL _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.59 _exptl_crystal.density_percent_sol 52.51 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 7.4' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type RIGAKU _diffrn_detector.pdbx_collection_date 1994-06-04 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator GRAPHITE _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source ? _diffrn_source.type ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 1RDL _reflns.observed_criterion_sigma_I 0. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 10.0 _reflns.d_resolution_high 1.7 _reflns.number_obs 28080 _reflns.number_all ? _reflns.percent_possible_obs 94.5 _reflns.pdbx_Rmerge_I_obs 0.045 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.2 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 1RDL _refine.ls_number_reflns_obs 22126 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10. _refine.ls_d_res_high 1.7 _refine.ls_percent_reflns_obs 94.5 _refine.ls_R_factor_obs 0.203 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.203 _refine.ls_R_factor_R_free 0.23 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.0 _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 21.4 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1762 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.number_atoms_solvent 297 _refine_hist.number_atoms_total 2089 _refine_hist.d_res_high 1.7 _refine_hist.d_res_low 10. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 19.8 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.4 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it 1.0 1.5 ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it 1.2 2.0 ? ? 'X-RAY DIFFRACTION' ? x_scbond_it 2.0 2.0 ? ? 'X-RAY DIFFRACTION' ? x_scangle_it 2.4 2.5 ? ? 'X-RAY DIFFRACTION' ? # _struct_ncs_oper.id 1 _struct_ncs_oper.code given _struct_ncs_oper.details ? _struct_ncs_oper.matrix[1][1] 0.999843 _struct_ncs_oper.matrix[1][2] 0.016055 _struct_ncs_oper.matrix[1][3] 0.007514 _struct_ncs_oper.matrix[2][1] 0.016142 _struct_ncs_oper.matrix[2][2] -0.999803 _struct_ncs_oper.matrix[2][3] -0.011573 _struct_ncs_oper.matrix[3][1] 0.007327 _struct_ncs_oper.matrix[3][2] 0.011692 _struct_ncs_oper.matrix[3][3] -0.999905 _struct_ncs_oper.vector[1] -0.35760 _struct_ncs_oper.vector[2] 37.53490 _struct_ncs_oper.vector[3] 6.68280 # _struct.entry_id 1RDL _struct.title 'MANNOSE-BINDING PROTEIN, SUBTILISIN DIGEST FRAGMENT COMPLEX WITH ALPHA-METHYL-D-MANNOPYRANOSIDE (0.2 M)' _struct.pdbx_descriptor 'MANNOSE-BINDING PROTEIN-C' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1RDL _struct_keywords.pdbx_keywords LECTIN _struct_keywords.text 'C-TYPE LECTIN, CALCIUM-BINDING PROTEIN, LECTIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 2 ? H N N 3 ? I N N 3 ? J N N 5 ? K N N 5 ? # _struct_biol.id 1 _struct_biol.details ;MTRIX THE TRANSFORMATIONS PRESENTED ON MTRIX RECORDS BELOW DESCRIBE NON-CRYSTALLOGRAPHIC RELATIONSHIPS AMONG THE VARIOUS DOMAINS IN THIS ENTRY. APPLYING THE APPROPRIATE MTRIX TRANSFORMATION TO THE RESIDUES LISTED FIRST WILL YIELD APPROXIMATE COORDINATES FOR THE RESIDUES LISTED SECOND. APPLIED TO TRANSFORMED TO MTRIX RESIDUES RESIDUES RMSD M1 1 115 .. 1 225 2 115 .. 2 225 0.307 ; _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 13 ? LEU A 23 ? LEU 1 126 LEU 1 136 1 ? 11 HELX_P HELX_P2 2 ALA A 33 ? VAL A 42 ? ALA 1 146 VAL 1 155 1 ? 10 HELX_P HELX_P3 3 LEU B 13 ? LEU B 23 ? LEU 2 126 LEU 2 136 1 ? 11 HELX_P HELX_P4 4 ALA B 33 ? VAL B 42 ? ALA 2 146 VAL 2 155 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 109 SG ? ? 1 CYS 133 1 CYS 222 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf2 disulf ? ? A CYS 87 SG ? ? ? 1_555 A CYS 101 SG ? ? 1 CYS 200 1 CYS 214 1_555 ? ? ? ? ? ? ? 2.025 ? ? disulf3 disulf ? ? B CYS 20 SG ? ? ? 1_555 B CYS 109 SG ? ? 2 CYS 133 2 CYS 222 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf4 disulf ? ? B CYS 87 SG ? ? ? 1_555 B CYS 101 SG ? ? 2 CYS 200 2 CYS 214 1_555 ? ? ? ? ? ? ? 2.032 ? ? metalc1 metalc ? ? C MMA . O3 ? ? ? 1_555 E CA . CA ? ? 1 MMA 1 1 CA 2 1_555 ? ? ? ? ? ? ? 2.547 ? ? metalc2 metalc ? ? C MMA . O4 ? ? ? 1_555 E CA . CA ? ? 1 MMA 1 1 CA 2 1_555 ? ? ? ? ? ? ? 2.570 ? ? metalc3 metalc ? ? E CA . CA ? ? ? 1_555 A GLU 77 OE1 ? ? 1 CA 2 1 GLU 190 1_555 ? ? ? ? ? ? ? 2.558 ? ? metalc4 metalc ? ? E CA . CA ? ? ? 1_555 A ASN 79 OD1 ? ? 1 CA 2 1 ASN 192 1_555 ? ? ? ? ? ? ? 2.440 ? ? metalc5 metalc ? ? E CA . CA ? ? ? 1_555 A GLU 85 OE1 ? ? 1 CA 2 1 GLU 198 1_555 ? ? ? ? ? ? ? 2.388 ? ? metalc6 metalc ? ? E CA . CA ? ? ? 1_555 A ASN 97 OD1 ? ? 1 CA 2 1 ASN 210 1_555 ? ? ? ? ? ? ? 2.452 ? ? metalc7 metalc ? ? E CA . CA ? ? ? 1_555 A ASP 98 O ? ? 1 CA 2 1 ASP 211 1_555 ? ? ? ? ? ? ? 2.579 ? ? metalc8 metalc ? ? E CA . CA ? ? ? 1_555 A ASP 98 OD1 ? ? 1 CA 2 1 ASP 211 1_555 ? ? ? ? ? ? ? 2.359 ? ? metalc9 metalc ? ? A ASP 53 OD1 ? ? ? 1_555 D CA . CA ? ? 1 ASP 166 1 CA 227 1_555 ? ? ? ? ? ? ? 2.697 ? ? metalc10 metalc ? ? A ASP 53 OD2 ? ? ? 1_555 D CA . CA ? ? 1 ASP 166 1 CA 227 1_555 ? ? ? ? ? ? ? 2.460 ? ? metalc11 metalc ? ? A GLU 57 OE2 ? ? ? 1_555 D CA . CA ? ? 1 GLU 170 1 CA 227 1_555 ? ? ? ? ? ? ? 2.694 ? ? metalc12 metalc ? ? A GLU 57 OE1 ? ? ? 1_555 D CA . CA ? ? 1 GLU 170 1 CA 227 1_555 ? ? ? ? ? ? ? 2.497 ? ? metalc13 metalc ? ? A ASN 80 OD1 ? ? ? 1_555 D CA . CA ? ? 1 ASN 193 1 CA 227 1_555 ? ? ? ? ? ? ? 2.512 ? ? metalc14 metalc ? ? A GLU 85 O ? ? ? 1_555 D CA . CA ? ? 1 GLU 198 1 CA 227 1_555 ? ? ? ? ? ? ? 2.433 ? ? metalc15 metalc ? ? A ASN 86 OD1 ? ? ? 1_555 D CA . CA ? ? 1 ASN 199 1 CA 227 1_555 ? ? ? ? ? ? ? 2.408 ? ? metalc16 metalc ? ? D CA . CA ? ? ? 1_555 J HOH . O ? ? 1 CA 227 1 HOH 274 1_555 ? ? ? ? ? ? ? 2.383 ? ? metalc17 metalc ? ? G MMA . O4 ? ? ? 1_555 I CA . CA ? ? 2 MMA 1 2 CA 2 1_555 ? ? ? ? ? ? ? 2.593 ? ? metalc18 metalc ? ? G MMA . O3 ? ? ? 1_555 I CA . CA ? ? 2 MMA 1 2 CA 2 1_555 ? ? ? ? ? ? ? 2.596 ? ? metalc19 metalc ? ? I CA . CA ? ? ? 1_555 B GLU 77 OE1 ? ? 2 CA 2 2 GLU 190 1_555 ? ? ? ? ? ? ? 2.621 ? ? metalc20 metalc ? ? I CA . CA ? ? ? 1_555 B ASN 79 OD1 ? ? 2 CA 2 2 ASN 192 1_555 ? ? ? ? ? ? ? 2.398 ? ? metalc21 metalc ? ? I CA . CA ? ? ? 1_555 B GLU 85 OE1 ? ? 2 CA 2 2 GLU 198 1_555 ? ? ? ? ? ? ? 2.434 ? ? metalc22 metalc ? ? I CA . CA ? ? ? 1_555 B ASN 97 OD1 ? ? 2 CA 2 2 ASN 210 1_555 ? ? ? ? ? ? ? 2.431 ? ? metalc23 metalc ? ? I CA . CA ? ? ? 1_555 B ASP 98 OD1 ? ? 2 CA 2 2 ASP 211 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc24 metalc ? ? I CA . CA ? ? ? 1_555 B ASP 98 O ? ? 2 CA 2 2 ASP 211 1_555 ? ? ? ? ? ? ? 2.551 ? ? metalc25 metalc ? ? B ASP 53 OD2 ? ? ? 1_555 H CA . CA ? ? 2 ASP 166 2 CA 227 1_555 ? ? ? ? ? ? ? 2.443 ? ? metalc26 metalc ? ? B ASP 53 OD1 ? ? ? 1_555 H CA . CA ? ? 2 ASP 166 2 CA 227 1_555 ? ? ? ? ? ? ? 2.677 ? ? metalc27 metalc ? ? B GLU 57 OE2 ? ? ? 1_555 H CA . CA ? ? 2 GLU 170 2 CA 227 1_555 ? ? ? ? ? ? ? 2.541 ? ? metalc28 metalc ? ? B GLU 57 OE1 ? ? ? 1_555 H CA . CA ? ? 2 GLU 170 2 CA 227 1_555 ? ? ? ? ? ? ? 2.478 ? ? metalc29 metalc ? ? B ASN 80 OD1 ? ? ? 1_555 H CA . CA ? ? 2 ASN 193 2 CA 227 1_555 ? ? ? ? ? ? ? 2.490 ? ? metalc30 metalc ? ? B GLU 85 O ? ? ? 1_555 H CA . CA ? ? 2 GLU 198 2 CA 227 1_555 ? ? ? ? ? ? ? 2.450 ? ? metalc31 metalc ? ? B ASN 86 OD1 ? ? ? 1_555 H CA . CA ? ? 2 ASN 199 2 CA 227 1_555 ? ? ? ? ? ? ? 2.359 ? ? metalc32 metalc ? ? H CA . CA ? ? ? 1_555 K HOH . O ? ? 2 CA 227 2 HOH 232 1_555 ? ? ? ? ? ? ? 2.373 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 77 A . ? GLU 190 1 PRO 78 A ? PRO 191 1 1 -0.68 2 GLU 77 B . ? GLU 190 2 PRO 78 B ? PRO 191 2 1 0.49 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 2 ? D ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 3 ? SER A 6 ? TYR 1 116 SER 1 119 A 2 VAL A 108 ? PHE A 111 ? VAL 1 221 PHE 1 224 B 1 CYS A 87 ? LEU A 90 ? CYS 1 200 LEU 1 203 B 2 TRP A 96 ? VAL A 99 ? TRP 1 209 VAL 1 212 C 1 TYR B 3 ? SER B 6 ? TYR 2 116 SER 2 119 C 2 VAL B 108 ? PHE B 111 ? VAL 2 221 PHE 2 224 D 1 TRP B 96 ? VAL B 99 ? TRP 2 209 VAL 2 212 D 2 CYS B 87 ? LEU B 90 ? CYS 2 200 LEU 2 203 D 3 ALA B 47 ? THR B 52 ? ALA 2 160 THR 2 165 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 3 ? O TYR 1 116 N PHE A 111 ? N PHE 1 224 B 1 2 O CYS A 87 ? O CYS 1 200 N VAL A 99 ? N VAL 1 212 C 1 2 O TYR B 3 ? O TYR 2 116 N PHE B 111 ? N PHE 2 224 D 1 2 O ASN B 97 ? O ASN 2 210 N VAL B 89 ? N VAL 2 202 D 2 3 O VAL B 88 ? O VAL 2 201 N ILE B 51 ? N ILE 2 164 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details CA1 Author ? ? ? ? 7 'CALCIUM BINDING SITES' CA2 Author ? ? ? ? 7 'CALCIUM BINDING SITES' CA3 Author ? ? ? ? 7 'CALCIUM BINDING SITES' CA4 Author ? ? ? ? 7 'CALCIUM BINDING SITES' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 CA1 7 CA D . ? CA 1 227 . ? 1_555 ? 2 CA1 7 ASP A 53 ? ASP 1 166 . ? 1_555 ? 3 CA1 7 GLU A 57 ? GLU 1 170 . ? 1_555 ? 4 CA1 7 ASN A 80 ? ASN 1 193 . ? 1_555 ? 5 CA1 7 GLU A 85 ? GLU 1 198 . ? 1_555 ? 6 CA1 7 ASN A 86 ? ASN 1 199 . ? 1_555 ? 7 CA1 7 HOH J . ? HOH 1 274 . ? 1_555 ? 8 CA2 7 CA H . ? CA 2 227 . ? 1_555 ? 9 CA2 7 ASP B 53 ? ASP 2 166 . ? 1_555 ? 10 CA2 7 GLU B 57 ? GLU 2 170 . ? 1_555 ? 11 CA2 7 ASN B 80 ? ASN 2 193 . ? 1_555 ? 12 CA2 7 GLU B 85 ? GLU 2 198 . ? 1_555 ? 13 CA2 7 ASN B 86 ? ASN 2 199 . ? 1_555 ? 14 CA2 7 HOH K . ? HOH 2 232 . ? 1_555 ? 15 CA3 7 CA E . ? CA 1 2 . ? 1_555 ? 16 CA3 7 GLU A 77 ? GLU 1 190 . ? 1_555 ? 17 CA3 7 ASN A 79 ? ASN 1 192 . ? 1_555 ? 18 CA3 7 GLU A 85 ? GLU 1 198 . ? 1_555 ? 19 CA3 7 ASN A 97 ? ASN 1 210 . ? 1_555 ? 20 CA3 7 ASP A 98 ? ASP 1 211 . ? 1_555 ? 21 CA3 7 MMA C . ? MMA 1 1 . ? 1_555 ? 22 CA4 7 CA I . ? CA 2 2 . ? 1_555 ? 23 CA4 7 GLU B 77 ? GLU 2 190 . ? 1_555 ? 24 CA4 7 ASN B 79 ? ASN 2 192 . ? 1_555 ? 25 CA4 7 GLU B 85 ? GLU 2 198 . ? 1_555 ? 26 CA4 7 ASN B 97 ? ASN 2 210 . ? 1_555 ? 27 CA4 7 ASP B 98 ? ASP 2 211 . ? 1_555 ? 28 CA4 7 MMA G . ? MMA 2 1 . ? 1_555 ? # _database_PDB_matrix.entry_id 1RDL _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1RDL _atom_sites.fract_transf_matrix[1][1] 0.016502 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013263 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017391 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_sites_footnote.id _atom_sites_footnote.text 1 'CIS PROLINE - PRO 1 191' 2 'CIS PROLINE - PRO 2 191' # loop_ _atom_type.symbol C CA CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 114 ? ? ? 1 . n A 1 2 LYS 2 115 115 LYS LYS 1 . n A 1 3 TYR 3 116 116 TYR TYR 1 . n A 1 4 PHE 4 117 117 PHE PHE 1 . n A 1 5 MET 5 118 118 MET MET 1 . n A 1 6 SER 6 119 119 SER SER 1 . n A 1 7 SER 7 120 120 SER SER 1 . n A 1 8 VAL 8 121 121 VAL VAL 1 . n A 1 9 ARG 9 122 122 ARG ARG 1 . n A 1 10 ARG 10 123 123 ARG ARG 1 . n A 1 11 MET 11 124 124 MET MET 1 . n A 1 12 PRO 12 125 125 PRO PRO 1 . n A 1 13 LEU 13 126 126 LEU LEU 1 . n A 1 14 ASN 14 127 127 ASN ASN 1 . n A 1 15 ARG 15 128 128 ARG ARG 1 . n A 1 16 ALA 16 129 129 ALA ALA 1 . n A 1 17 LYS 17 130 130 LYS LYS 1 . n A 1 18 ALA 18 131 131 ALA ALA 1 . n A 1 19 LEU 19 132 132 LEU LEU 1 . n A 1 20 CYS 20 133 133 CYS CYS 1 . n A 1 21 SER 21 134 134 SER SER 1 . n A 1 22 GLU 22 135 135 GLU GLU 1 . n A 1 23 LEU 23 136 136 LEU LEU 1 . n A 1 24 GLN 24 137 137 GLN GLN 1 . n A 1 25 GLY 25 138 138 GLY GLY 1 . n A 1 26 THR 26 139 139 THR THR 1 . n A 1 27 VAL 27 140 140 VAL VAL 1 . n A 1 28 ALA 28 141 141 ALA ALA 1 . n A 1 29 THR 29 142 142 THR THR 1 . n A 1 30 PRO 30 143 143 PRO PRO 1 . n A 1 31 ARG 31 144 144 ARG ARG 1 . n A 1 32 ASN 32 145 145 ASN ASN 1 . n A 1 33 ALA 33 146 146 ALA ALA 1 . n A 1 34 GLU 34 147 147 GLU GLU 1 . n A 1 35 GLU 35 148 148 GLU GLU 1 . n A 1 36 ASN 36 149 149 ASN ASN 1 . n A 1 37 ARG 37 150 150 ARG ARG 1 . n A 1 38 ALA 38 151 151 ALA ALA 1 . n A 1 39 ILE 39 152 152 ILE ILE 1 . n A 1 40 GLN 40 153 153 GLN GLN 1 . n A 1 41 ASN 41 154 154 ASN ASN 1 . n A 1 42 VAL 42 155 155 VAL VAL 1 . n A 1 43 ALA 43 156 156 ALA ALA 1 . n A 1 44 LYS 44 157 157 LYS LYS 1 . n A 1 45 ASP 45 158 158 ASP ASP 1 . n A 1 46 VAL 46 159 159 VAL VAL 1 . n A 1 47 ALA 47 160 160 ALA ALA 1 . n A 1 48 PHE 48 161 161 PHE PHE 1 . n A 1 49 LEU 49 162 162 LEU LEU 1 . n A 1 50 GLY 50 163 163 GLY GLY 1 . n A 1 51 ILE 51 164 164 ILE ILE 1 . n A 1 52 THR 52 165 165 THR THR 1 . n A 1 53 ASP 53 166 166 ASP ASP 1 . n A 1 54 GLN 54 167 167 GLN GLN 1 . n A 1 55 ARG 55 168 168 ARG ARG 1 . n A 1 56 THR 56 169 169 THR THR 1 . n A 1 57 GLU 57 170 170 GLU GLU 1 . n A 1 58 ASN 58 171 171 ASN ASN 1 . n A 1 59 VAL 59 172 172 VAL VAL 1 . n A 1 60 PHE 60 173 173 PHE PHE 1 . n A 1 61 GLU 61 174 174 GLU GLU 1 . n A 1 62 ASP 62 175 175 ASP ASP 1 . n A 1 63 LEU 63 176 176 LEU LEU 1 . n A 1 64 THR 64 177 177 THR THR 1 . n A 1 65 GLY 65 178 178 GLY GLY 1 . n A 1 66 ASN 66 179 179 ASN ASN 1 . n A 1 67 ARG 67 180 180 ARG ARG 1 . n A 1 68 VAL 68 181 181 VAL VAL 1 . n A 1 69 ARG 69 182 182 ARG ARG 1 . n A 1 70 TYR 70 183 183 TYR TYR 1 . n A 1 71 THR 71 184 184 THR THR 1 . n A 1 72 ASN 72 185 185 ASN ASN 1 . n A 1 73 TRP 73 186 186 TRP TRP 1 . n A 1 74 ASN 74 187 187 ASN ASN 1 . n A 1 75 GLU 75 188 188 GLU GLU 1 . n A 1 76 GLY 76 189 189 GLY GLY 1 . n A 1 77 GLU 77 190 190 GLU GLU 1 . n A 1 78 PRO 78 191 191 PRO PRO 1 . n A 1 79 ASN 79 192 192 ASN ASN 1 . n A 1 80 ASN 80 193 193 ASN ASN 1 . n A 1 81 VAL 81 194 194 VAL VAL 1 . n A 1 82 GLY 82 195 195 GLY GLY 1 . n A 1 83 SER 83 196 196 SER SER 1 . n A 1 84 GLY 84 197 197 GLY GLY 1 . n A 1 85 GLU 85 198 198 GLU GLU 1 . n A 1 86 ASN 86 199 199 ASN ASN 1 . n A 1 87 CYS 87 200 200 CYS CYS 1 . n A 1 88 VAL 88 201 201 VAL VAL 1 . n A 1 89 VAL 89 202 202 VAL VAL 1 . n A 1 90 LEU 90 203 203 LEU LEU 1 . n A 1 91 LEU 91 204 204 LEU LEU 1 . n A 1 92 THR 92 205 205 THR THR 1 . n A 1 93 ASN 93 206 206 ASN ASN 1 . n A 1 94 GLY 94 207 207 GLY GLY 1 . n A 1 95 LYS 95 208 208 LYS LYS 1 . n A 1 96 TRP 96 209 209 TRP TRP 1 . n A 1 97 ASN 97 210 210 ASN ASN 1 . n A 1 98 ASP 98 211 211 ASP ASP 1 . n A 1 99 VAL 99 212 212 VAL VAL 1 . n A 1 100 PRO 100 213 213 PRO PRO 1 . n A 1 101 CYS 101 214 214 CYS CYS 1 . n A 1 102 SER 102 215 215 SER SER 1 . n A 1 103 ASP 103 216 216 ASP ASP 1 . n A 1 104 SER 104 217 217 SER SER 1 . n A 1 105 PHE 105 218 218 PHE PHE 1 . n A 1 106 LEU 106 219 219 LEU LEU 1 . n A 1 107 VAL 107 220 220 VAL VAL 1 . n A 1 108 VAL 108 221 221 VAL VAL 1 . n A 1 109 CYS 109 222 222 CYS CYS 1 . n A 1 110 GLU 110 223 223 GLU GLU 1 . n A 1 111 PHE 111 224 224 PHE PHE 1 . n A 1 112 SER 112 225 225 SER SER 1 . n A 1 113 ASP 113 226 ? ? ? 1 . n B 1 1 LYS 1 114 114 LYS LYS 2 . n B 1 2 LYS 2 115 115 LYS LYS 2 . n B 1 3 TYR 3 116 116 TYR TYR 2 . n B 1 4 PHE 4 117 117 PHE PHE 2 . n B 1 5 MET 5 118 118 MET MET 2 . n B 1 6 SER 6 119 119 SER SER 2 . n B 1 7 SER 7 120 120 SER SER 2 . n B 1 8 VAL 8 121 121 VAL VAL 2 . n B 1 9 ARG 9 122 122 ARG ARG 2 . n B 1 10 ARG 10 123 123 ARG ARG 2 . n B 1 11 MET 11 124 124 MET MET 2 . n B 1 12 PRO 12 125 125 PRO PRO 2 . n B 1 13 LEU 13 126 126 LEU LEU 2 . n B 1 14 ASN 14 127 127 ASN ASN 2 . n B 1 15 ARG 15 128 128 ARG ARG 2 . n B 1 16 ALA 16 129 129 ALA ALA 2 . n B 1 17 LYS 17 130 130 LYS LYS 2 . n B 1 18 ALA 18 131 131 ALA ALA 2 . n B 1 19 LEU 19 132 132 LEU LEU 2 . n B 1 20 CYS 20 133 133 CYS CYS 2 . n B 1 21 SER 21 134 134 SER SER 2 . n B 1 22 GLU 22 135 135 GLU GLU 2 . n B 1 23 LEU 23 136 136 LEU LEU 2 . n B 1 24 GLN 24 137 137 GLN GLN 2 . n B 1 25 GLY 25 138 138 GLY GLY 2 . n B 1 26 THR 26 139 139 THR THR 2 . n B 1 27 VAL 27 140 140 VAL VAL 2 . n B 1 28 ALA 28 141 141 ALA ALA 2 . n B 1 29 THR 29 142 142 THR THR 2 . n B 1 30 PRO 30 143 143 PRO PRO 2 . n B 1 31 ARG 31 144 144 ARG ARG 2 . n B 1 32 ASN 32 145 145 ASN ASN 2 . n B 1 33 ALA 33 146 146 ALA ALA 2 . n B 1 34 GLU 34 147 147 GLU GLU 2 . n B 1 35 GLU 35 148 148 GLU GLU 2 . n B 1 36 ASN 36 149 149 ASN ASN 2 . n B 1 37 ARG 37 150 150 ARG ARG 2 . n B 1 38 ALA 38 151 151 ALA ALA 2 . n B 1 39 ILE 39 152 152 ILE ILE 2 . n B 1 40 GLN 40 153 153 GLN GLN 2 . n B 1 41 ASN 41 154 154 ASN ASN 2 . n B 1 42 VAL 42 155 155 VAL VAL 2 . n B 1 43 ALA 43 156 156 ALA ALA 2 . n B 1 44 LYS 44 157 157 LYS LYS 2 . n B 1 45 ASP 45 158 158 ASP ASP 2 . n B 1 46 VAL 46 159 159 VAL VAL 2 . n B 1 47 ALA 47 160 160 ALA ALA 2 . n B 1 48 PHE 48 161 161 PHE PHE 2 . n B 1 49 LEU 49 162 162 LEU LEU 2 . n B 1 50 GLY 50 163 163 GLY GLY 2 . n B 1 51 ILE 51 164 164 ILE ILE 2 . n B 1 52 THR 52 165 165 THR THR 2 . n B 1 53 ASP 53 166 166 ASP ASP 2 . n B 1 54 GLN 54 167 167 GLN GLN 2 . n B 1 55 ARG 55 168 168 ARG ARG 2 . n B 1 56 THR 56 169 169 THR THR 2 . n B 1 57 GLU 57 170 170 GLU GLU 2 . n B 1 58 ASN 58 171 171 ASN ASN 2 . n B 1 59 VAL 59 172 172 VAL VAL 2 . n B 1 60 PHE 60 173 173 PHE PHE 2 . n B 1 61 GLU 61 174 174 GLU GLU 2 . n B 1 62 ASP 62 175 175 ASP ASP 2 . n B 1 63 LEU 63 176 176 LEU LEU 2 . n B 1 64 THR 64 177 177 THR THR 2 . n B 1 65 GLY 65 178 178 GLY GLY 2 . n B 1 66 ASN 66 179 179 ASN ASN 2 . n B 1 67 ARG 67 180 180 ARG ARG 2 . n B 1 68 VAL 68 181 181 VAL VAL 2 . n B 1 69 ARG 69 182 182 ARG ARG 2 . n B 1 70 TYR 70 183 183 TYR TYR 2 . n B 1 71 THR 71 184 184 THR THR 2 . n B 1 72 ASN 72 185 185 ASN ASN 2 . n B 1 73 TRP 73 186 186 TRP TRP 2 . n B 1 74 ASN 74 187 187 ASN ASN 2 . n B 1 75 GLU 75 188 188 GLU GLU 2 . n B 1 76 GLY 76 189 189 GLY GLY 2 . n B 1 77 GLU 77 190 190 GLU GLU 2 . n B 1 78 PRO 78 191 191 PRO PRO 2 . n B 1 79 ASN 79 192 192 ASN ASN 2 . n B 1 80 ASN 80 193 193 ASN ASN 2 . n B 1 81 VAL 81 194 194 VAL VAL 2 . n B 1 82 GLY 82 195 195 GLY GLY 2 . n B 1 83 SER 83 196 196 SER SER 2 . n B 1 84 GLY 84 197 197 GLY GLY 2 . n B 1 85 GLU 85 198 198 GLU GLU 2 . n B 1 86 ASN 86 199 199 ASN ASN 2 . n B 1 87 CYS 87 200 200 CYS CYS 2 . n B 1 88 VAL 88 201 201 VAL VAL 2 . n B 1 89 VAL 89 202 202 VAL VAL 2 . n B 1 90 LEU 90 203 203 LEU LEU 2 . n B 1 91 LEU 91 204 204 LEU LEU 2 . n B 1 92 THR 92 205 205 THR THR 2 . n B 1 93 ASN 93 206 206 ASN ASN 2 . n B 1 94 GLY 94 207 207 GLY GLY 2 . n B 1 95 LYS 95 208 208 LYS LYS 2 . n B 1 96 TRP 96 209 209 TRP TRP 2 . n B 1 97 ASN 97 210 210 ASN ASN 2 . n B 1 98 ASP 98 211 211 ASP ASP 2 . n B 1 99 VAL 99 212 212 VAL VAL 2 . n B 1 100 PRO 100 213 213 PRO PRO 2 . n B 1 101 CYS 101 214 214 CYS CYS 2 . n B 1 102 SER 102 215 215 SER SER 2 . n B 1 103 ASP 103 216 216 ASP ASP 2 . n B 1 104 SER 104 217 217 SER SER 2 . n B 1 105 PHE 105 218 218 PHE PHE 2 . n B 1 106 LEU 106 219 219 LEU LEU 2 . n B 1 107 VAL 107 220 220 VAL VAL 2 . n B 1 108 VAL 108 221 221 VAL VAL 2 . n B 1 109 CYS 109 222 222 CYS CYS 2 . n B 1 110 GLU 110 223 223 GLU GLU 2 . n B 1 111 PHE 111 224 224 PHE PHE 2 . n B 1 112 SER 112 225 225 SER SER 2 . n B 1 113 ASP 113 226 ? ? ? 2 . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 MMA 1 1 1 MMA MMA 1 . D 3 CA 1 227 1 CA CA 1 . E 3 CA 1 2 2 CA CA 1 . F 4 CL 1 3 3 CL CL 1 . G 2 MMA 1 1 1 MMA MMA 2 . H 3 CA 1 227 1 CA CA 2 . I 3 CA 1 2 2 CA CA 2 . J 5 HOH 1 228 67 HOH HOH 1 . J 5 HOH 2 229 68 HOH HOH 1 . J 5 HOH 3 230 69 HOH HOH 1 . J 5 HOH 4 231 81 HOH HOH 1 . J 5 HOH 5 232 82 HOH HOH 1 . J 5 HOH 6 233 83 HOH HOH 1 . J 5 HOH 7 234 84 HOH HOH 1 . J 5 HOH 8 235 85 HOH HOH 1 . J 5 HOH 9 236 86 HOH HOH 1 . J 5 HOH 10 237 87 HOH HOH 1 . J 5 HOH 11 238 88 HOH HOH 1 . J 5 HOH 12 239 89 HOH HOH 1 . J 5 HOH 13 240 90 HOH HOH 1 . J 5 HOH 14 241 91 HOH HOH 1 . J 5 HOH 15 242 92 HOH HOH 1 . J 5 HOH 16 243 94 HOH HOH 1 . J 5 HOH 17 244 95 HOH HOH 1 . J 5 HOH 18 245 96 HOH HOH 1 . J 5 HOH 19 246 97 HOH HOH 1 . J 5 HOH 20 247 98 HOH HOH 1 . J 5 HOH 21 248 99 HOH HOH 1 . J 5 HOH 22 249 102 HOH HOH 1 . J 5 HOH 23 250 104 HOH HOH 1 . J 5 HOH 24 251 106 HOH HOH 1 . J 5 HOH 25 252 107 HOH HOH 1 . J 5 HOH 26 253 108 HOH HOH 1 . J 5 HOH 27 254 109 HOH HOH 1 . J 5 HOH 28 255 110 HOH HOH 1 . J 5 HOH 29 256 111 HOH HOH 1 . J 5 HOH 30 257 112 HOH HOH 1 . J 5 HOH 31 258 113 HOH HOH 1 . J 5 HOH 32 259 114 HOH HOH 1 . J 5 HOH 33 260 117 HOH HOH 1 . J 5 HOH 34 261 119 HOH HOH 1 . J 5 HOH 35 262 120 HOH HOH 1 . J 5 HOH 36 263 121 HOH HOH 1 . J 5 HOH 37 264 122 HOH HOH 1 . J 5 HOH 38 265 123 HOH HOH 1 . J 5 HOH 39 266 124 HOH HOH 1 . J 5 HOH 40 267 125 HOH HOH 1 . J 5 HOH 41 268 126 HOH HOH 1 . J 5 HOH 42 269 127 HOH HOH 1 . J 5 HOH 43 270 128 HOH HOH 1 . J 5 HOH 44 271 129 HOH HOH 1 . J 5 HOH 45 272 130 HOH HOH 1 . J 5 HOH 46 273 131 HOH HOH 1 . J 5 HOH 47 274 132 HOH HOH 1 . J 5 HOH 48 275 133 HOH HOH 1 . J 5 HOH 49 276 134 HOH HOH 1 . J 5 HOH 50 277 135 HOH HOH 1 . J 5 HOH 51 278 136 HOH HOH 1 . J 5 HOH 52 279 137 HOH HOH 1 . J 5 HOH 53 280 138 HOH HOH 1 . J 5 HOH 54 281 139 HOH HOH 1 . J 5 HOH 55 282 140 HOH HOH 1 . J 5 HOH 56 283 141 HOH HOH 1 . J 5 HOH 57 284 147 HOH HOH 1 . J 5 HOH 58 285 148 HOH HOH 1 . J 5 HOH 59 286 149 HOH HOH 1 . J 5 HOH 60 287 150 HOH HOH 1 . J 5 HOH 61 288 151 HOH HOH 1 . J 5 HOH 62 289 152 HOH HOH 1 . J 5 HOH 63 290 153 HOH HOH 1 . J 5 HOH 64 291 154 HOH HOH 1 . J 5 HOH 65 292 155 HOH HOH 1 . J 5 HOH 66 293 156 HOH HOH 1 . J 5 HOH 67 294 157 HOH HOH 1 . J 5 HOH 68 295 158 HOH HOH 1 . J 5 HOH 69 296 159 HOH HOH 1 . J 5 HOH 70 297 198 HOH HOH 1 . J 5 HOH 71 298 199 HOH HOH 1 . J 5 HOH 72 299 200 HOH HOH 1 . J 5 HOH 73 300 201 HOH HOH 1 . J 5 HOH 74 301 202 HOH HOH 1 . J 5 HOH 75 302 203 HOH HOH 1 . J 5 HOH 76 303 204 HOH HOH 1 . J 5 HOH 77 304 205 HOH HOH 1 . J 5 HOH 78 305 206 HOH HOH 1 . J 5 HOH 79 306 207 HOH HOH 1 . J 5 HOH 80 307 208 HOH HOH 1 . J 5 HOH 81 308 209 HOH HOH 1 . J 5 HOH 82 309 210 HOH HOH 1 . J 5 HOH 83 310 211 HOH HOH 1 . J 5 HOH 84 311 212 HOH HOH 1 . J 5 HOH 85 312 213 HOH HOH 1 . J 5 HOH 86 313 214 HOH HOH 1 . J 5 HOH 87 314 218 HOH HOH 1 . J 5 HOH 88 315 219 HOH HOH 1 . J 5 HOH 89 316 220 HOH HOH 1 . J 5 HOH 90 317 221 HOH HOH 1 . J 5 HOH 91 318 222 HOH HOH 1 . J 5 HOH 92 319 223 HOH HOH 1 . J 5 HOH 93 320 224 HOH HOH 1 . J 5 HOH 94 321 225 HOH HOH 1 . J 5 HOH 95 322 226 HOH HOH 1 . J 5 HOH 96 323 227 HOH HOH 1 . J 5 HOH 97 324 228 HOH HOH 1 . J 5 HOH 98 325 229 HOH HOH 1 . J 5 HOH 99 326 230 HOH HOH 1 . J 5 HOH 100 327 231 HOH HOH 1 . J 5 HOH 101 328 232 HOH HOH 1 . J 5 HOH 102 329 248 HOH HOH 1 . J 5 HOH 103 330 249 HOH HOH 1 . J 5 HOH 104 331 250 HOH HOH 1 . J 5 HOH 105 332 251 HOH HOH 1 . J 5 HOH 106 333 252 HOH HOH 1 . J 5 HOH 107 334 4 HOH HOH 1 . J 5 HOH 108 335 6 HOH HOH 1 . J 5 HOH 109 336 7 HOH HOH 1 . J 5 HOH 110 337 46 HOH HOH 1 . J 5 HOH 111 338 49 HOH HOH 1 . J 5 HOH 112 339 50 HOH HOH 1 . J 5 HOH 113 340 51 HOH HOH 1 . J 5 HOH 114 341 52 HOH HOH 1 . J 5 HOH 115 342 53 HOH HOH 1 . J 5 HOH 116 343 58 HOH HOH 1 . J 5 HOH 117 344 59 HOH HOH 1 . J 5 HOH 118 345 60 HOH HOH 1 . J 5 HOH 119 346 62 HOH HOH 1 . J 5 HOH 120 347 66 HOH HOH 1 . J 5 HOH 121 348 69 HOH HOH 1 . J 5 HOH 122 349 71 HOH HOH 1 . J 5 HOH 123 350 72 HOH HOH 1 . J 5 HOH 124 351 73 HOH HOH 1 . J 5 HOH 125 352 74 HOH HOH 1 . J 5 HOH 126 353 75 HOH HOH 1 . J 5 HOH 127 354 81 HOH HOH 1 . J 5 HOH 128 355 82 HOH HOH 1 . J 5 HOH 129 356 85 HOH HOH 1 . J 5 HOH 130 357 86 HOH HOH 1 . J 5 HOH 131 358 87 HOH HOH 1 . J 5 HOH 132 359 89 HOH HOH 1 . J 5 HOH 133 360 1 HOH HOH 1 . J 5 HOH 134 361 2 HOH HOH 1 . J 5 HOH 135 362 3 HOH HOH 1 . J 5 HOH 136 363 7 HOH HOH 1 . K 5 HOH 1 228 1 HOH HOH 2 . K 5 HOH 2 229 2 HOH HOH 2 . K 5 HOH 3 230 3 HOH HOH 2 . K 5 HOH 4 231 4 HOH HOH 2 . K 5 HOH 5 232 5 HOH HOH 2 . K 5 HOH 6 233 6 HOH HOH 2 . K 5 HOH 7 234 7 HOH HOH 2 . K 5 HOH 8 235 8 HOH HOH 2 . K 5 HOH 9 236 9 HOH HOH 2 . K 5 HOH 10 237 10 HOH HOH 2 . K 5 HOH 11 238 11 HOH HOH 2 . K 5 HOH 12 239 12 HOH HOH 2 . K 5 HOH 13 240 13 HOH HOH 2 . K 5 HOH 14 241 14 HOH HOH 2 . K 5 HOH 15 242 15 HOH HOH 2 . K 5 HOH 16 243 16 HOH HOH 2 . K 5 HOH 17 244 17 HOH HOH 2 . K 5 HOH 18 245 18 HOH HOH 2 . K 5 HOH 19 246 19 HOH HOH 2 . K 5 HOH 20 247 20 HOH HOH 2 . K 5 HOH 21 248 21 HOH HOH 2 . K 5 HOH 22 249 22 HOH HOH 2 . K 5 HOH 23 250 23 HOH HOH 2 . K 5 HOH 24 251 24 HOH HOH 2 . K 5 HOH 25 252 25 HOH HOH 2 . K 5 HOH 26 253 26 HOH HOH 2 . K 5 HOH 27 254 27 HOH HOH 2 . K 5 HOH 28 255 28 HOH HOH 2 . K 5 HOH 29 256 29 HOH HOH 2 . K 5 HOH 30 257 32 HOH HOH 2 . K 5 HOH 31 258 33 HOH HOH 2 . K 5 HOH 32 259 37 HOH HOH 2 . K 5 HOH 33 260 38 HOH HOH 2 . K 5 HOH 34 261 39 HOH HOH 2 . K 5 HOH 35 262 40 HOH HOH 2 . K 5 HOH 36 263 41 HOH HOH 2 . K 5 HOH 37 264 42 HOH HOH 2 . K 5 HOH 38 265 43 HOH HOH 2 . K 5 HOH 39 266 44 HOH HOH 2 . K 5 HOH 40 267 45 HOH HOH 2 . K 5 HOH 41 268 46 HOH HOH 2 . K 5 HOH 42 269 47 HOH HOH 2 . K 5 HOH 43 270 48 HOH HOH 2 . K 5 HOH 44 271 49 HOH HOH 2 . K 5 HOH 45 272 50 HOH HOH 2 . K 5 HOH 46 273 51 HOH HOH 2 . K 5 HOH 47 274 52 HOH HOH 2 . K 5 HOH 48 275 53 HOH HOH 2 . K 5 HOH 49 276 54 HOH HOH 2 . K 5 HOH 50 277 55 HOH HOH 2 . K 5 HOH 51 278 56 HOH HOH 2 . K 5 HOH 52 279 57 HOH HOH 2 . K 5 HOH 53 280 58 HOH HOH 2 . K 5 HOH 54 281 59 HOH HOH 2 . K 5 HOH 55 282 60 HOH HOH 2 . K 5 HOH 56 283 62 HOH HOH 2 . K 5 HOH 57 284 63 HOH HOH 2 . K 5 HOH 58 285 64 HOH HOH 2 . K 5 HOH 59 286 65 HOH HOH 2 . K 5 HOH 60 287 66 HOH HOH 2 . K 5 HOH 61 288 70 HOH HOH 2 . K 5 HOH 62 289 71 HOH HOH 2 . K 5 HOH 63 290 72 HOH HOH 2 . K 5 HOH 64 291 73 HOH HOH 2 . K 5 HOH 65 292 74 HOH HOH 2 . K 5 HOH 66 293 75 HOH HOH 2 . K 5 HOH 67 294 76 HOH HOH 2 . K 5 HOH 68 295 77 HOH HOH 2 . K 5 HOH 69 296 79 HOH HOH 2 . K 5 HOH 70 297 80 HOH HOH 2 . K 5 HOH 71 298 142 HOH HOH 2 . K 5 HOH 72 299 143 HOH HOH 2 . K 5 HOH 73 300 144 HOH HOH 2 . K 5 HOH 74 301 145 HOH HOH 2 . K 5 HOH 75 302 146 HOH HOH 2 . K 5 HOH 76 303 160 HOH HOH 2 . K 5 HOH 77 304 161 HOH HOH 2 . K 5 HOH 78 305 162 HOH HOH 2 . K 5 HOH 79 306 163 HOH HOH 2 . K 5 HOH 80 307 164 HOH HOH 2 . K 5 HOH 81 308 165 HOH HOH 2 . K 5 HOH 82 309 166 HOH HOH 2 . K 5 HOH 83 310 167 HOH HOH 2 . K 5 HOH 84 311 168 HOH HOH 2 . K 5 HOH 85 312 169 HOH HOH 2 . K 5 HOH 86 313 170 HOH HOH 2 . K 5 HOH 87 314 171 HOH HOH 2 . K 5 HOH 88 315 172 HOH HOH 2 . K 5 HOH 89 316 173 HOH HOH 2 . K 5 HOH 90 317 174 HOH HOH 2 . K 5 HOH 91 318 175 HOH HOH 2 . K 5 HOH 92 319 176 HOH HOH 2 . K 5 HOH 93 320 177 HOH HOH 2 . K 5 HOH 94 321 178 HOH HOH 2 . K 5 HOH 95 322 179 HOH HOH 2 . K 5 HOH 96 323 180 HOH HOH 2 . K 5 HOH 97 324 181 HOH HOH 2 . K 5 HOH 98 325 182 HOH HOH 2 . K 5 HOH 99 326 183 HOH HOH 2 . K 5 HOH 100 327 185 HOH HOH 2 . K 5 HOH 101 328 186 HOH HOH 2 . K 5 HOH 102 329 187 HOH HOH 2 . K 5 HOH 103 330 188 HOH HOH 2 . K 5 HOH 104 331 189 HOH HOH 2 . K 5 HOH 105 332 190 HOH HOH 2 . K 5 HOH 106 333 191 HOH HOH 2 . K 5 HOH 107 334 192 HOH HOH 2 . K 5 HOH 108 335 193 HOH HOH 2 . K 5 HOH 109 336 194 HOH HOH 2 . K 5 HOH 110 337 195 HOH HOH 2 . K 5 HOH 111 338 196 HOH HOH 2 . K 5 HOH 112 339 233 HOH HOH 2 . K 5 HOH 113 340 234 HOH HOH 2 . K 5 HOH 114 341 235 HOH HOH 2 . K 5 HOH 115 342 236 HOH HOH 2 . K 5 HOH 116 343 237 HOH HOH 2 . K 5 HOH 117 344 238 HOH HOH 2 . K 5 HOH 118 345 239 HOH HOH 2 . K 5 HOH 119 346 240 HOH HOH 2 . K 5 HOH 120 347 241 HOH HOH 2 . K 5 HOH 121 348 242 HOH HOH 2 . K 5 HOH 122 349 243 HOH HOH 2 . K 5 HOH 123 350 244 HOH HOH 2 . K 5 HOH 124 351 245 HOH HOH 2 . K 5 HOH 125 352 246 HOH HOH 2 . K 5 HOH 126 353 247 HOH HOH 2 . K 5 HOH 127 354 1 HOH HOH 2 . K 5 HOH 128 355 2 HOH HOH 2 . K 5 HOH 129 356 8 HOH HOH 2 . K 5 HOH 130 357 13 HOH HOH 2 . K 5 HOH 131 358 14 HOH HOH 2 . K 5 HOH 132 359 16 HOH HOH 2 . K 5 HOH 133 360 18 HOH HOH 2 . K 5 HOH 134 361 20 HOH HOH 2 . K 5 HOH 135 362 27 HOH HOH 2 . K 5 HOH 136 363 28 HOH HOH 2 . K 5 HOH 137 364 29 HOH HOH 2 . K 5 HOH 138 365 30 HOH HOH 2 . K 5 HOH 139 366 31 HOH HOH 2 . K 5 HOH 140 367 32 HOH HOH 2 . K 5 HOH 141 368 34 HOH HOH 2 . K 5 HOH 142 369 36 HOH HOH 2 . K 5 HOH 143 370 38 HOH HOH 2 . K 5 HOH 144 371 40 HOH HOH 2 . K 5 HOH 145 372 41 HOH HOH 2 . K 5 HOH 146 373 47 HOH HOH 2 . K 5 HOH 147 374 48 HOH HOH 2 . K 5 HOH 148 375 65 HOH HOH 2 . K 5 HOH 149 376 67 HOH HOH 2 . K 5 HOH 150 377 68 HOH HOH 2 . K 5 HOH 151 378 70 HOH HOH 2 . K 5 HOH 152 379 76 HOH HOH 2 . K 5 HOH 153 380 77 HOH HOH 2 . K 5 HOH 154 381 79 HOH HOH 2 . K 5 HOH 155 382 80 HOH HOH 2 . K 5 HOH 156 383 83 HOH HOH 2 . K 5 HOH 157 384 84 HOH HOH 2 . K 5 HOH 158 385 88 HOH HOH 2 . K 5 HOH 159 386 4 HOH HOH 2 . K 5 HOH 160 387 5 HOH HOH 2 . K 5 HOH 161 388 6 HOH HOH 2 . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2310 ? 1 MORE -68 ? 1 'SSA (A^2)' 11370 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O3 ? C MMA . ? 1 MMA 1 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 O4 ? C MMA . ? 1 MMA 1 ? 1_555 66.6 ? 2 O3 ? C MMA . ? 1 MMA 1 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OE1 ? A GLU 77 ? 1 GLU 190 ? 1_555 132.1 ? 3 O4 ? C MMA . ? 1 MMA 1 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OE1 ? A GLU 77 ? 1 GLU 190 ? 1_555 74.3 ? 4 O3 ? C MMA . ? 1 MMA 1 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OD1 ? A ASN 79 ? 1 ASN 192 ? 1_555 119.6 ? 5 O4 ? C MMA . ? 1 MMA 1 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OD1 ? A ASN 79 ? 1 ASN 192 ? 1_555 77.0 ? 6 OE1 ? A GLU 77 ? 1 GLU 190 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OD1 ? A ASN 79 ? 1 ASN 192 ? 1_555 74.8 ? 7 O3 ? C MMA . ? 1 MMA 1 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OE1 ? A GLU 85 ? 1 GLU 198 ? 1_555 77.1 ? 8 O4 ? C MMA . ? 1 MMA 1 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OE1 ? A GLU 85 ? 1 GLU 198 ? 1_555 111.8 ? 9 OE1 ? A GLU 77 ? 1 GLU 190 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OE1 ? A GLU 85 ? 1 GLU 198 ? 1_555 145.5 ? 10 OD1 ? A ASN 79 ? 1 ASN 192 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OE1 ? A GLU 85 ? 1 GLU 198 ? 1_555 73.8 ? 11 O3 ? C MMA . ? 1 MMA 1 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OD1 ? A ASN 97 ? 1 ASN 210 ? 1_555 79.2 ? 12 O4 ? C MMA . ? 1 MMA 1 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OD1 ? A ASN 97 ? 1 ASN 210 ? 1_555 82.1 ? 13 OE1 ? A GLU 77 ? 1 GLU 190 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OD1 ? A ASN 97 ? 1 ASN 210 ? 1_555 68.8 ? 14 OD1 ? A ASN 79 ? 1 ASN 192 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OD1 ? A ASN 97 ? 1 ASN 210 ? 1_555 141.7 ? 15 OE1 ? A GLU 85 ? 1 GLU 198 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OD1 ? A ASN 97 ? 1 ASN 210 ? 1_555 144.3 ? 16 O3 ? C MMA . ? 1 MMA 1 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 O ? A ASP 98 ? 1 ASP 211 ? 1_555 71.1 ? 17 O4 ? C MMA . ? 1 MMA 1 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 O ? A ASP 98 ? 1 ASP 211 ? 1_555 134.8 ? 18 OE1 ? A GLU 77 ? 1 GLU 190 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 O ? A ASP 98 ? 1 ASP 211 ? 1_555 128.7 ? 19 OD1 ? A ASN 79 ? 1 ASN 192 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 O ? A ASP 98 ? 1 ASP 211 ? 1_555 140.7 ? 20 OE1 ? A GLU 85 ? 1 GLU 198 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 O ? A ASP 98 ? 1 ASP 211 ? 1_555 72.4 ? 21 OD1 ? A ASN 97 ? 1 ASN 210 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 O ? A ASP 98 ? 1 ASP 211 ? 1_555 74.9 ? 22 O3 ? C MMA . ? 1 MMA 1 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OD1 ? A ASP 98 ? 1 ASP 211 ? 1_555 146.2 ? 23 O4 ? C MMA . ? 1 MMA 1 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OD1 ? A ASP 98 ? 1 ASP 211 ? 1_555 145.6 ? 24 OE1 ? A GLU 77 ? 1 GLU 190 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OD1 ? A ASP 98 ? 1 ASP 211 ? 1_555 72.3 ? 25 OD1 ? A ASN 79 ? 1 ASN 192 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OD1 ? A ASP 98 ? 1 ASP 211 ? 1_555 86.4 ? 26 OE1 ? A GLU 85 ? 1 GLU 198 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OD1 ? A ASP 98 ? 1 ASP 211 ? 1_555 91.6 ? 27 OD1 ? A ASN 97 ? 1 ASN 210 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OD1 ? A ASP 98 ? 1 ASP 211 ? 1_555 93.5 ? 28 O ? A ASP 98 ? 1 ASP 211 ? 1_555 CA ? E CA . ? 1 CA 2 ? 1_555 OD1 ? A ASP 98 ? 1 ASP 211 ? 1_555 75.1 ? 29 OD1 ? A ASP 53 ? 1 ASP 166 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 OD2 ? A ASP 53 ? 1 ASP 166 ? 1_555 50.0 ? 30 OD1 ? A ASP 53 ? 1 ASP 166 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 OE2 ? A GLU 57 ? 1 GLU 170 ? 1_555 122.5 ? 31 OD2 ? A ASP 53 ? 1 ASP 166 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 OE2 ? A GLU 57 ? 1 GLU 170 ? 1_555 72.9 ? 32 OD1 ? A ASP 53 ? 1 ASP 166 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 OE1 ? A GLU 57 ? 1 GLU 170 ? 1_555 104.9 ? 33 OD2 ? A ASP 53 ? 1 ASP 166 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 OE1 ? A GLU 57 ? 1 GLU 170 ? 1_555 77.7 ? 34 OE2 ? A GLU 57 ? 1 GLU 170 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 OE1 ? A GLU 57 ? 1 GLU 170 ? 1_555 49.8 ? 35 OD1 ? A ASP 53 ? 1 ASP 166 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 OD1 ? A ASN 80 ? 1 ASN 193 ? 1_555 160.6 ? 36 OD2 ? A ASP 53 ? 1 ASP 166 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 OD1 ? A ASN 80 ? 1 ASN 193 ? 1_555 149.0 ? 37 OE2 ? A GLU 57 ? 1 GLU 170 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 OD1 ? A ASN 80 ? 1 ASN 193 ? 1_555 76.2 ? 38 OE1 ? A GLU 57 ? 1 GLU 170 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 OD1 ? A ASN 80 ? 1 ASN 193 ? 1_555 82.8 ? 39 OD1 ? A ASP 53 ? 1 ASP 166 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 O ? A GLU 85 ? 1 GLU 198 ? 1_555 90.5 ? 40 OD2 ? A ASP 53 ? 1 ASP 166 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 O ? A GLU 85 ? 1 GLU 198 ? 1_555 128.5 ? 41 OE2 ? A GLU 57 ? 1 GLU 170 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 O ? A GLU 85 ? 1 GLU 198 ? 1_555 137.3 ? 42 OE1 ? A GLU 57 ? 1 GLU 170 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 O ? A GLU 85 ? 1 GLU 198 ? 1_555 152.6 ? 43 OD1 ? A ASN 80 ? 1 ASN 193 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 O ? A GLU 85 ? 1 GLU 198 ? 1_555 76.1 ? 44 OD1 ? A ASP 53 ? 1 ASP 166 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 OD1 ? A ASN 86 ? 1 ASN 199 ? 1_555 78.1 ? 45 OD2 ? A ASP 53 ? 1 ASP 166 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 OD1 ? A ASN 86 ? 1 ASN 199 ? 1_555 113.5 ? 46 OE2 ? A GLU 57 ? 1 GLU 170 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 OD1 ? A ASN 86 ? 1 ASN 199 ? 1_555 127.7 ? 47 OE1 ? A GLU 57 ? 1 GLU 170 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 OD1 ? A ASN 86 ? 1 ASN 199 ? 1_555 79.7 ? 48 OD1 ? A ASN 80 ? 1 ASN 193 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 OD1 ? A ASN 86 ? 1 ASN 199 ? 1_555 86.0 ? 49 O ? A GLU 85 ? 1 GLU 198 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 OD1 ? A ASN 86 ? 1 ASN 199 ? 1_555 81.6 ? 50 OD1 ? A ASP 53 ? 1 ASP 166 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 O ? J HOH . ? 1 HOH 274 ? 1_555 99.0 ? 51 OD2 ? A ASP 53 ? 1 ASP 166 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 O ? J HOH . ? 1 HOH 274 ? 1_555 81.0 ? 52 OE2 ? A GLU 57 ? 1 GLU 170 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 O ? J HOH . ? 1 HOH 274 ? 1_555 75.0 ? 53 OE1 ? A GLU 57 ? 1 GLU 170 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 O ? J HOH . ? 1 HOH 274 ? 1_555 124.5 ? 54 OD1 ? A ASN 80 ? 1 ASN 193 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 O ? J HOH . ? 1 HOH 274 ? 1_555 90.7 ? 55 O ? A GLU 85 ? 1 GLU 198 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 O ? J HOH . ? 1 HOH 274 ? 1_555 73.5 ? 56 OD1 ? A ASN 86 ? 1 ASN 199 ? 1_555 CA ? D CA . ? 1 CA 227 ? 1_555 O ? J HOH . ? 1 HOH 274 ? 1_555 155.0 ? 57 O4 ? G MMA . ? 2 MMA 1 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 O3 ? G MMA . ? 2 MMA 1 ? 1_555 66.6 ? 58 O4 ? G MMA . ? 2 MMA 1 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OE1 ? B GLU 77 ? 2 GLU 190 ? 1_555 74.3 ? 59 O3 ? G MMA . ? 2 MMA 1 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OE1 ? B GLU 77 ? 2 GLU 190 ? 1_555 132.7 ? 60 O4 ? G MMA . ? 2 MMA 1 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OD1 ? B ASN 79 ? 2 ASN 192 ? 1_555 78.7 ? 61 O3 ? G MMA . ? 2 MMA 1 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OD1 ? B ASN 79 ? 2 ASN 192 ? 1_555 122.5 ? 62 OE1 ? B GLU 77 ? 2 GLU 190 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OD1 ? B ASN 79 ? 2 ASN 192 ? 1_555 72.0 ? 63 O4 ? G MMA . ? 2 MMA 1 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OE1 ? B GLU 85 ? 2 GLU 198 ? 1_555 110.1 ? 64 O3 ? G MMA . ? 2 MMA 1 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OE1 ? B GLU 85 ? 2 GLU 198 ? 1_555 76.6 ? 65 OE1 ? B GLU 77 ? 2 GLU 190 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OE1 ? B GLU 85 ? 2 GLU 198 ? 1_555 144.2 ? 66 OD1 ? B ASN 79 ? 2 ASN 192 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OE1 ? B GLU 85 ? 2 GLU 198 ? 1_555 74.2 ? 67 O4 ? G MMA . ? 2 MMA 1 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OD1 ? B ASN 97 ? 2 ASN 210 ? 1_555 82.6 ? 68 O3 ? G MMA . ? 2 MMA 1 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OD1 ? B ASN 97 ? 2 ASN 210 ? 1_555 79.8 ? 69 OE1 ? B GLU 77 ? 2 GLU 190 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OD1 ? B ASN 97 ? 2 ASN 210 ? 1_555 69.4 ? 70 OD1 ? B ASN 79 ? 2 ASN 192 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OD1 ? B ASN 97 ? 2 ASN 210 ? 1_555 140.4 ? 71 OE1 ? B GLU 85 ? 2 GLU 198 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OD1 ? B ASN 97 ? 2 ASN 210 ? 1_555 145.4 ? 72 O4 ? G MMA . ? 2 MMA 1 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OD1 ? B ASP 98 ? 2 ASP 211 ? 1_555 146.8 ? 73 O3 ? G MMA . ? 2 MMA 1 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OD1 ? B ASP 98 ? 2 ASP 211 ? 1_555 145.2 ? 74 OE1 ? B GLU 77 ? 2 GLU 190 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OD1 ? B ASP 98 ? 2 ASP 211 ? 1_555 73.4 ? 75 OD1 ? B ASN 79 ? 2 ASN 192 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OD1 ? B ASP 98 ? 2 ASP 211 ? 1_555 84.2 ? 76 OE1 ? B GLU 85 ? 2 GLU 198 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OD1 ? B ASP 98 ? 2 ASP 211 ? 1_555 92.0 ? 77 OD1 ? B ASN 97 ? 2 ASN 210 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 OD1 ? B ASP 98 ? 2 ASP 211 ? 1_555 93.1 ? 78 O4 ? G MMA . ? 2 MMA 1 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 O ? B ASP 98 ? 2 ASP 211 ? 1_555 135.3 ? 79 O3 ? G MMA . ? 2 MMA 1 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 O ? B ASP 98 ? 2 ASP 211 ? 1_555 71.9 ? 80 OE1 ? B GLU 77 ? 2 GLU 190 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 O ? B ASP 98 ? 2 ASP 211 ? 1_555 128.5 ? 81 OD1 ? B ASN 79 ? 2 ASN 192 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 O ? B ASP 98 ? 2 ASP 211 ? 1_555 140.4 ? 82 OE1 ? B GLU 85 ? 2 GLU 198 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 O ? B ASP 98 ? 2 ASP 211 ? 1_555 74.5 ? 83 OD1 ? B ASN 97 ? 2 ASN 210 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 O ? B ASP 98 ? 2 ASP 211 ? 1_555 74.3 ? 84 OD1 ? B ASP 98 ? 2 ASP 211 ? 1_555 CA ? I CA . ? 2 CA 2 ? 1_555 O ? B ASP 98 ? 2 ASP 211 ? 1_555 73.4 ? 85 OD2 ? B ASP 53 ? 2 ASP 166 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 OD1 ? B ASP 53 ? 2 ASP 166 ? 1_555 50.2 ? 86 OD2 ? B ASP 53 ? 2 ASP 166 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 OE2 ? B GLU 57 ? 2 GLU 170 ? 1_555 73.4 ? 87 OD1 ? B ASP 53 ? 2 ASP 166 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 OE2 ? B GLU 57 ? 2 GLU 170 ? 1_555 123.2 ? 88 OD2 ? B ASP 53 ? 2 ASP 166 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 OE1 ? B GLU 57 ? 2 GLU 170 ? 1_555 79.4 ? 89 OD1 ? B ASP 53 ? 2 ASP 166 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 OE1 ? B GLU 57 ? 2 GLU 170 ? 1_555 105.1 ? 90 OE2 ? B GLU 57 ? 2 GLU 170 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 OE1 ? B GLU 57 ? 2 GLU 170 ? 1_555 52.1 ? 91 OD2 ? B ASP 53 ? 2 ASP 166 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 OD1 ? B ASN 80 ? 2 ASN 193 ? 1_555 150.5 ? 92 OD1 ? B ASP 53 ? 2 ASP 166 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 OD1 ? B ASN 80 ? 2 ASN 193 ? 1_555 158.3 ? 93 OE2 ? B GLU 57 ? 2 GLU 170 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 OD1 ? B ASN 80 ? 2 ASN 193 ? 1_555 77.2 ? 94 OE1 ? B GLU 57 ? 2 GLU 170 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 OD1 ? B ASN 80 ? 2 ASN 193 ? 1_555 80.9 ? 95 OD2 ? B ASP 53 ? 2 ASP 166 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 O ? B GLU 85 ? 2 GLU 198 ? 1_555 130.8 ? 96 OD1 ? B ASP 53 ? 2 ASP 166 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 O ? B GLU 85 ? 2 GLU 198 ? 1_555 91.7 ? 97 OE2 ? B GLU 57 ? 2 GLU 170 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 O ? B GLU 85 ? 2 GLU 198 ? 1_555 137.0 ? 98 OE1 ? B GLU 57 ? 2 GLU 170 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 O ? B GLU 85 ? 2 GLU 198 ? 1_555 147.9 ? 99 OD1 ? B ASN 80 ? 2 ASN 193 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 O ? B GLU 85 ? 2 GLU 198 ? 1_555 74.3 ? 100 OD2 ? B ASP 53 ? 2 ASP 166 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 OD1 ? B ASN 86 ? 2 ASN 199 ? 1_555 111.8 ? 101 OD1 ? B ASP 53 ? 2 ASP 166 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 OD1 ? B ASN 86 ? 2 ASN 199 ? 1_555 76.2 ? 102 OE2 ? B GLU 57 ? 2 GLU 170 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 OD1 ? B ASN 86 ? 2 ASN 199 ? 1_555 128.3 ? 103 OE1 ? B GLU 57 ? 2 GLU 170 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 OD1 ? B ASN 86 ? 2 ASN 199 ? 1_555 77.6 ? 104 OD1 ? B ASN 80 ? 2 ASN 193 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 OD1 ? B ASN 86 ? 2 ASN 199 ? 1_555 85.0 ? 105 O ? B GLU 85 ? 2 GLU 198 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 OD1 ? B ASN 86 ? 2 ASN 199 ? 1_555 80.3 ? 106 OD2 ? B ASP 53 ? 2 ASP 166 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 O ? K HOH . ? 2 HOH 232 ? 1_555 80.6 ? 107 OD1 ? B ASP 53 ? 2 ASP 166 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 O ? K HOH . ? 2 HOH 232 ? 1_555 97.5 ? 108 OE2 ? B GLU 57 ? 2 GLU 170 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 O ? K HOH . ? 2 HOH 232 ? 1_555 76.5 ? 109 OE1 ? B GLU 57 ? 2 GLU 170 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 O ? K HOH . ? 2 HOH 232 ? 1_555 128.2 ? 110 OD1 ? B ASN 80 ? 2 ASN 193 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 O ? K HOH . ? 2 HOH 232 ? 1_555 94.7 ? 111 O ? B GLU 85 ? 2 GLU 198 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 O ? K HOH . ? 2 HOH 232 ? 1_555 74.6 ? 112 OD1 ? B ASN 86 ? 2 ASN 199 ? 1_555 CA ? H CA . ? 2 CA 227 ? 1_555 O ? K HOH . ? 2 HOH 232 ? 1_555 153.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-03-08 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp 2 4 'Structure model' entity 3 4 'Structure model' pdbx_chem_comp_identifier 4 4 'Structure model' pdbx_entity_nonpoly 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site 8 4 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_chem_comp.mon_nstd_flag' 2 4 'Structure model' '_chem_comp.name' 3 4 'Structure model' '_chem_comp.type' 4 4 'Structure model' '_entity.pdbx_description' 5 4 'Structure model' '_pdbx_entity_nonpoly.name' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.value' 19 4 'Structure model' '_struct_conn.pdbx_dist_value' 20 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 25 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 26 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 30 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 31 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 X-PLOR 'model building' 3.1 ? 3 X-PLOR refinement 3.1 ? 4 X-PLOR phasing 3.1 ? 5 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CG _pdbx_validate_rmsd_angle.auth_asym_id_1 2 _pdbx_validate_rmsd_angle.auth_comp_id_1 MET _pdbx_validate_rmsd_angle.auth_seq_id_1 118 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 A _pdbx_validate_rmsd_angle.auth_atom_id_2 SD _pdbx_validate_rmsd_angle.auth_asym_id_2 2 _pdbx_validate_rmsd_angle.auth_comp_id_2 MET _pdbx_validate_rmsd_angle.auth_seq_id_2 118 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 A _pdbx_validate_rmsd_angle.auth_atom_id_3 CE _pdbx_validate_rmsd_angle.auth_asym_id_3 2 _pdbx_validate_rmsd_angle.auth_comp_id_3 MET _pdbx_validate_rmsd_angle.auth_seq_id_3 118 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 A _pdbx_validate_rmsd_angle.angle_value 109.87 _pdbx_validate_rmsd_angle.angle_target_value 100.20 _pdbx_validate_rmsd_angle.angle_deviation 9.67 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.60 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG 1 182 ? ? -99.04 -62.16 2 1 ASN 1 185 ? ? -141.40 52.21 3 1 ARG 2 182 ? ? -104.80 -65.89 4 1 ASN 2 185 ? ? -144.30 52.16 # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag N _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id 1 _pdbx_unobs_or_zero_occ_atoms.auth_comp_id MMA _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id C7 _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id C _pdbx_unobs_or_zero_occ_atoms.label_comp_id MMA _pdbx_unobs_or_zero_occ_atoms.label_seq_id 1 _pdbx_unobs_or_zero_occ_atoms.label_atom_id C7 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 1 LYS 114 ? A LYS 1 2 1 Y 1 1 ASP 226 ? A ASP 113 3 1 Y 1 2 ASP 226 ? B ASP 113 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier MMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 'DManp[1Me]a' MMA 'COMMON NAME' GMML 1.0 1-methyl-a-D-mannopyranose MMA 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 o1-methyl-mannose # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'methyl alpha-D-mannopyranoside' MMA 3 'CALCIUM ION' CA 4 'CHLORIDE ION' CL 5 water HOH #