data_1RIM # _entry.id 1RIM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1RIM pdb_00001rim 10.2210/pdb1rim/pdb RCSB RCSB020775 ? ? WWPDB D_1000020775 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-08-03 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RIM _pdbx_database_status.recvd_initial_deposition_date 2003-11-17 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1RIJ . unspecified PDB 1RIK . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, Y.' 1 'Liu, Z.' 2 'Androphy, E.' 3 'Chen, J.' 4 'Baleja, J.D.' 5 # _citation.id primary _citation.title 'Design and characterization of helical peptides that inhibit the E6 protein of papillomavirus.' _citation.journal_abbrev Biochemistry _citation.journal_volume 43 _citation.page_first 7421 _citation.page_last 7431 _citation.year 2004 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15182185 _citation.pdbx_database_id_DOI 10.1021/bi049552a # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, Y.' 1 ? primary 'Liu, Z.' 2 ? primary 'Androphy, E.' 3 ? primary 'Chen, J.' 4 ? primary 'Baleja, J.D.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'E6apc2 peptide' _entity.formula_weight 4038.724 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code YKFACPECPKRFMRSDHLSKHITLHELLGEERR _entity_poly.pdbx_seq_one_letter_code_can YKFACPECPKRFMRSDHLSKHITLHELLGEERR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TYR n 1 2 LYS n 1 3 PHE n 1 4 ALA n 1 5 CYS n 1 6 PRO n 1 7 GLU n 1 8 CYS n 1 9 PRO n 1 10 LYS n 1 11 ARG n 1 12 PHE n 1 13 MET n 1 14 ARG n 1 15 SER n 1 16 ASP n 1 17 HIS n 1 18 LEU n 1 19 SER n 1 20 LYS n 1 21 HIS n 1 22 ILE n 1 23 THR n 1 24 LEU n 1 25 HIS n 1 26 GLU n 1 27 LEU n 1 28 LEU n 1 29 GLY n 1 30 GLU n 1 31 GLU n 1 32 ARG n 1 33 ARG n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'The peptide was chemically synthesized' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TYR 1 1 1 TYR TYR A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ARG 33 33 33 ARG ARG A . n # _cell.entry_id 1RIM _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1RIM _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1RIM _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1RIM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1RIM _struct.title 'E6-binding zinc finger (E6apc2)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1RIM _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' _struct_keywords.text 'E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name PDB _struct_ref.db_code 1RIM _struct_ref.pdbx_db_accession 1RIM _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1RIM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 33 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 1RIM _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 33 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 33 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 14 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 26 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 14 _struct_conf.end_auth_comp_id GLU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 26 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 18 ? ? H A ILE 22 ? ? 1.48 2 2 O A LEU 18 ? ? H A ILE 22 ? ? 1.51 3 2 O A ILE 22 ? ? H A GLU 26 ? ? 1.60 4 3 O A LEU 18 ? ? H A ILE 22 ? ? 1.49 5 5 O A LEU 18 ? ? H A ILE 22 ? ? 1.47 6 5 O A ILE 22 ? ? H A GLU 26 ? ? 1.55 7 6 O A LEU 18 ? ? H A ILE 22 ? ? 1.54 8 7 O A LEU 18 ? ? H A ILE 22 ? ? 1.49 9 8 O A LEU 18 ? ? H A ILE 22 ? ? 1.59 10 9 O A LEU 18 ? ? H A ILE 22 ? ? 1.48 11 10 O A LEU 18 ? ? H A ILE 22 ? ? 1.49 12 11 O A LEU 18 ? ? H A ILE 22 ? ? 1.52 13 12 O A LEU 18 ? ? H A ILE 22 ? ? 1.56 14 13 O A LEU 18 ? ? H A ILE 22 ? ? 1.49 15 14 O A LEU 18 ? ? H A ILE 22 ? ? 1.48 16 14 O A ILE 22 ? ? H A GLU 26 ? ? 1.59 17 15 O A LEU 18 ? ? H A ILE 22 ? ? 1.55 18 16 O A LEU 18 ? ? H A ILE 22 ? ? 1.51 19 17 O A LEU 18 ? ? H A ILE 22 ? ? 1.51 20 18 O A LEU 18 ? ? H A ILE 22 ? ? 1.56 21 18 O A ILE 22 ? ? H A GLU 26 ? ? 1.59 22 19 O A LEU 18 ? ? H A ILE 22 ? ? 1.52 23 20 O A LEU 18 ? ? H A ILE 22 ? ? 1.50 24 21 O A LEU 18 ? ? H A ILE 22 ? ? 1.49 25 22 O A LEU 18 ? ? H A ILE 22 ? ? 1.50 26 23 O A LEU 18 ? ? H A ILE 22 ? ? 1.51 27 24 O A LEU 18 ? ? H A ILE 22 ? ? 1.51 28 25 O A LEU 18 ? ? H A ILE 22 ? ? 1.51 29 25 O A ILE 22 ? ? H A GLU 26 ? ? 1.58 30 26 O A LEU 18 ? ? H A ILE 22 ? ? 1.52 31 27 O A LEU 18 ? ? H A ILE 22 ? ? 1.49 32 28 O A LEU 18 ? ? H A ILE 22 ? ? 1.51 33 29 O A LEU 18 ? ? H A ILE 22 ? ? 1.50 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 2 ? ? -176.29 -43.73 2 1 ALA A 4 ? ? -167.19 119.09 3 3 LYS A 2 ? ? -150.18 46.62 4 3 PHE A 3 ? ? -163.13 117.73 5 3 GLU A 31 ? ? -105.11 58.67 6 4 LYS A 2 ? ? -148.13 46.75 7 5 LYS A 2 ? ? -173.31 50.89 8 5 PHE A 3 ? ? -161.42 107.71 9 5 LEU A 27 ? ? -105.06 -86.70 10 5 LEU A 28 ? ? -105.33 64.00 11 6 PHE A 12 ? ? -94.76 -100.17 12 6 MET A 13 ? ? -160.46 -49.60 13 6 LEU A 27 ? ? -100.18 -72.22 14 7 LYS A 2 ? ? -162.31 47.53 15 7 LEU A 27 ? ? -106.48 -76.78 16 8 LYS A 2 ? ? -154.32 34.81 17 8 PHE A 12 ? ? -90.93 -92.08 18 8 MET A 13 ? ? -161.05 -52.68 19 8 LEU A 27 ? ? -98.14 -62.11 20 8 GLU A 30 ? ? -165.89 99.97 21 8 GLU A 31 ? ? -105.46 -60.06 22 10 LYS A 2 ? ? -154.95 37.93 23 10 PHE A 3 ? ? -166.86 112.58 24 10 LEU A 27 ? ? -85.93 -76.94 25 10 GLU A 30 ? ? -119.90 72.74 26 11 LYS A 2 ? ? -150.51 54.55 27 11 SER A 19 ? ? -39.00 -39.86 28 11 LEU A 27 ? ? -100.00 -72.64 29 12 LYS A 2 ? ? -153.94 36.98 30 12 PHE A 12 ? ? -90.93 -101.61 31 12 MET A 13 ? ? -160.50 -50.01 32 12 LEU A 27 ? ? -97.49 -63.58 33 12 LEU A 28 ? ? -105.17 -64.43 34 13 LYS A 2 ? ? -148.85 47.74 35 13 LEU A 27 ? ? -90.19 -77.75 36 14 LEU A 28 ? ? -102.77 -60.01 37 15 LYS A 2 ? ? -155.50 36.63 38 15 PHE A 12 ? ? -97.75 -99.50 39 15 MET A 13 ? ? -160.85 -50.47 40 15 LEU A 27 ? ? -95.11 -76.04 41 15 GLU A 30 ? ? -162.90 100.49 42 16 LYS A 2 ? ? -155.03 47.26 43 16 PHE A 12 ? ? -101.43 -166.94 44 17 LEU A 27 ? ? -90.42 -62.20 45 18 LYS A 2 ? ? -143.22 48.28 46 18 PHE A 12 ? ? -92.45 -104.03 47 18 MET A 13 ? ? -153.75 -50.39 48 18 LEU A 27 ? ? -107.65 -68.26 49 19 LYS A 2 ? ? -152.31 53.18 50 19 SER A 19 ? ? -38.53 -39.48 51 19 LEU A 27 ? ? -106.63 -92.88 52 20 GLU A 30 ? ? -106.71 49.97 53 20 GLU A 31 ? ? -104.78 70.10 54 21 LYS A 2 ? ? -164.02 53.11 55 21 SER A 19 ? ? -39.66 -39.27 56 21 GLU A 30 ? ? -102.50 43.88 57 22 LYS A 2 ? ? -152.59 55.02 58 22 LEU A 27 ? ? -90.44 -60.79 59 23 LYS A 2 ? ? -152.79 47.13 60 23 SER A 19 ? ? -37.92 -39.81 61 24 LYS A 2 ? ? -161.48 51.22 62 24 SER A 19 ? ? -39.39 -38.13 63 24 ARG A 32 ? ? -104.99 60.19 64 25 LYS A 2 ? ? -154.90 46.01 65 25 LEU A 27 ? ? -97.90 -71.99 66 25 LEU A 28 ? ? -105.13 -63.50 67 26 LYS A 2 ? ? -144.56 50.81 68 26 LEU A 27 ? ? -101.78 -63.59 69 26 LEU A 28 ? ? -97.34 -61.11 70 27 LYS A 2 ? ? -151.40 53.35 71 27 LEU A 27 ? ? -99.01 -68.59 72 28 LEU A 27 ? ? -97.40 -66.20 73 29 SER A 19 ? ? -38.58 -39.47 74 29 LEU A 27 ? ? -104.18 -83.24 # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;SEQUENCE The peptide was N-terminally acetylated and C-terminally amidated, the coordinates do not reflect these modifications ; # _pdbx_nmr_ensemble.entry_id 1RIM _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 29 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1RIM _pdbx_nmr_representative.conformer_id 11 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '~ 2.0mM peptide, 10mM deuterated imidazole, 4mM ZnSO4, 1mM deuterated DTT, at pH 6.0, 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '~ 2.0mM peptide, 10mM deuterated imidazole, 4mM ZnSO4, 1mM deuterated DTT, at pH 6.0, 99.96% D2O' '99.96% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '10mM deuterated imidazole, 4mM ZnSO4, 1mM deuterated DTT' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 2 '2D TOCSY' 2 1 2 '2D NOESY' 3 1 1 DQF-COSY # _pdbx_nmr_details.entry_id 1RIM _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques' # _pdbx_nmr_refine.entry_id 1RIM _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 3.5 collection 'Bruker BioSpin GmbH' 1 XwinNMR 3.5 processing 'Bruker BioSpin GmbH' 2 CNS 1.1 'structure solution' 'Brunger, et al.' 3 CNS 1.1 processing 'Brunger, et al.' 4 CNS 1.1 refinement 'Brunger, et al.' 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLU N N N N 71 GLU CA C N S 72 GLU C C N N 73 GLU O O N N 74 GLU CB C N N 75 GLU CG C N N 76 GLU CD C N N 77 GLU OE1 O N N 78 GLU OE2 O N N 79 GLU OXT O N N 80 GLU H H N N 81 GLU H2 H N N 82 GLU HA H N N 83 GLU HB2 H N N 84 GLU HB3 H N N 85 GLU HG2 H N N 86 GLU HG3 H N N 87 GLU HE2 H N N 88 GLU HXT H N N 89 GLY N N N N 90 GLY CA C N N 91 GLY C C N N 92 GLY O O N N 93 GLY OXT O N N 94 GLY H H N N 95 GLY H2 H N N 96 GLY HA2 H N N 97 GLY HA3 H N N 98 GLY HXT H N N 99 HIS N N N N 100 HIS CA C N S 101 HIS C C N N 102 HIS O O N N 103 HIS CB C N N 104 HIS CG C Y N 105 HIS ND1 N Y N 106 HIS CD2 C Y N 107 HIS CE1 C Y N 108 HIS NE2 N Y N 109 HIS OXT O N N 110 HIS H H N N 111 HIS H2 H N N 112 HIS HA H N N 113 HIS HB2 H N N 114 HIS HB3 H N N 115 HIS HD1 H N N 116 HIS HD2 H N N 117 HIS HE1 H N N 118 HIS HE2 H N N 119 HIS HXT H N N 120 ILE N N N N 121 ILE CA C N S 122 ILE C C N N 123 ILE O O N N 124 ILE CB C N S 125 ILE CG1 C N N 126 ILE CG2 C N N 127 ILE CD1 C N N 128 ILE OXT O N N 129 ILE H H N N 130 ILE H2 H N N 131 ILE HA H N N 132 ILE HB H N N 133 ILE HG12 H N N 134 ILE HG13 H N N 135 ILE HG21 H N N 136 ILE HG22 H N N 137 ILE HG23 H N N 138 ILE HD11 H N N 139 ILE HD12 H N N 140 ILE HD13 H N N 141 ILE HXT H N N 142 LEU N N N N 143 LEU CA C N S 144 LEU C C N N 145 LEU O O N N 146 LEU CB C N N 147 LEU CG C N N 148 LEU CD1 C N N 149 LEU CD2 C N N 150 LEU OXT O N N 151 LEU H H N N 152 LEU H2 H N N 153 LEU HA H N N 154 LEU HB2 H N N 155 LEU HB3 H N N 156 LEU HG H N N 157 LEU HD11 H N N 158 LEU HD12 H N N 159 LEU HD13 H N N 160 LEU HD21 H N N 161 LEU HD22 H N N 162 LEU HD23 H N N 163 LEU HXT H N N 164 LYS N N N N 165 LYS CA C N S 166 LYS C C N N 167 LYS O O N N 168 LYS CB C N N 169 LYS CG C N N 170 LYS CD C N N 171 LYS CE C N N 172 LYS NZ N N N 173 LYS OXT O N N 174 LYS H H N N 175 LYS H2 H N N 176 LYS HA H N N 177 LYS HB2 H N N 178 LYS HB3 H N N 179 LYS HG2 H N N 180 LYS HG3 H N N 181 LYS HD2 H N N 182 LYS HD3 H N N 183 LYS HE2 H N N 184 LYS HE3 H N N 185 LYS HZ1 H N N 186 LYS HZ2 H N N 187 LYS HZ3 H N N 188 LYS HXT H N N 189 MET N N N N 190 MET CA C N S 191 MET C C N N 192 MET O O N N 193 MET CB C N N 194 MET CG C N N 195 MET SD S N N 196 MET CE C N N 197 MET OXT O N N 198 MET H H N N 199 MET H2 H N N 200 MET HA H N N 201 MET HB2 H N N 202 MET HB3 H N N 203 MET HG2 H N N 204 MET HG3 H N N 205 MET HE1 H N N 206 MET HE2 H N N 207 MET HE3 H N N 208 MET HXT H N N 209 PHE N N N N 210 PHE CA C N S 211 PHE C C N N 212 PHE O O N N 213 PHE CB C N N 214 PHE CG C Y N 215 PHE CD1 C Y N 216 PHE CD2 C Y N 217 PHE CE1 C Y N 218 PHE CE2 C Y N 219 PHE CZ C Y N 220 PHE OXT O N N 221 PHE H H N N 222 PHE H2 H N N 223 PHE HA H N N 224 PHE HB2 H N N 225 PHE HB3 H N N 226 PHE HD1 H N N 227 PHE HD2 H N N 228 PHE HE1 H N N 229 PHE HE2 H N N 230 PHE HZ H N N 231 PHE HXT H N N 232 PRO N N N N 233 PRO CA C N S 234 PRO C C N N 235 PRO O O N N 236 PRO CB C N N 237 PRO CG C N N 238 PRO CD C N N 239 PRO OXT O N N 240 PRO H H N N 241 PRO HA H N N 242 PRO HB2 H N N 243 PRO HB3 H N N 244 PRO HG2 H N N 245 PRO HG3 H N N 246 PRO HD2 H N N 247 PRO HD3 H N N 248 PRO HXT H N N 249 SER N N N N 250 SER CA C N S 251 SER C C N N 252 SER O O N N 253 SER CB C N N 254 SER OG O N N 255 SER OXT O N N 256 SER H H N N 257 SER H2 H N N 258 SER HA H N N 259 SER HB2 H N N 260 SER HB3 H N N 261 SER HG H N N 262 SER HXT H N N 263 THR N N N N 264 THR CA C N S 265 THR C C N N 266 THR O O N N 267 THR CB C N R 268 THR OG1 O N N 269 THR CG2 C N N 270 THR OXT O N N 271 THR H H N N 272 THR H2 H N N 273 THR HA H N N 274 THR HB H N N 275 THR HG1 H N N 276 THR HG21 H N N 277 THR HG22 H N N 278 THR HG23 H N N 279 THR HXT H N N 280 TYR N N N N 281 TYR CA C N S 282 TYR C C N N 283 TYR O O N N 284 TYR CB C N N 285 TYR CG C Y N 286 TYR CD1 C Y N 287 TYR CD2 C Y N 288 TYR CE1 C Y N 289 TYR CE2 C Y N 290 TYR CZ C Y N 291 TYR OH O N N 292 TYR OXT O N N 293 TYR H H N N 294 TYR H2 H N N 295 TYR HA H N N 296 TYR HB2 H N N 297 TYR HB3 H N N 298 TYR HD1 H N N 299 TYR HD2 H N N 300 TYR HE1 H N N 301 TYR HE2 H N N 302 TYR HH H N N 303 TYR HXT H N N 304 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLU N CA sing N N 67 GLU N H sing N N 68 GLU N H2 sing N N 69 GLU CA C sing N N 70 GLU CA CB sing N N 71 GLU CA HA sing N N 72 GLU C O doub N N 73 GLU C OXT sing N N 74 GLU CB CG sing N N 75 GLU CB HB2 sing N N 76 GLU CB HB3 sing N N 77 GLU CG CD sing N N 78 GLU CG HG2 sing N N 79 GLU CG HG3 sing N N 80 GLU CD OE1 doub N N 81 GLU CD OE2 sing N N 82 GLU OE2 HE2 sing N N 83 GLU OXT HXT sing N N 84 GLY N CA sing N N 85 GLY N H sing N N 86 GLY N H2 sing N N 87 GLY CA C sing N N 88 GLY CA HA2 sing N N 89 GLY CA HA3 sing N N 90 GLY C O doub N N 91 GLY C OXT sing N N 92 GLY OXT HXT sing N N 93 HIS N CA sing N N 94 HIS N H sing N N 95 HIS N H2 sing N N 96 HIS CA C sing N N 97 HIS CA CB sing N N 98 HIS CA HA sing N N 99 HIS C O doub N N 100 HIS C OXT sing N N 101 HIS CB CG sing N N 102 HIS CB HB2 sing N N 103 HIS CB HB3 sing N N 104 HIS CG ND1 sing Y N 105 HIS CG CD2 doub Y N 106 HIS ND1 CE1 doub Y N 107 HIS ND1 HD1 sing N N 108 HIS CD2 NE2 sing Y N 109 HIS CD2 HD2 sing N N 110 HIS CE1 NE2 sing Y N 111 HIS CE1 HE1 sing N N 112 HIS NE2 HE2 sing N N 113 HIS OXT HXT sing N N 114 ILE N CA sing N N 115 ILE N H sing N N 116 ILE N H2 sing N N 117 ILE CA C sing N N 118 ILE CA CB sing N N 119 ILE CA HA sing N N 120 ILE C O doub N N 121 ILE C OXT sing N N 122 ILE CB CG1 sing N N 123 ILE CB CG2 sing N N 124 ILE CB HB sing N N 125 ILE CG1 CD1 sing N N 126 ILE CG1 HG12 sing N N 127 ILE CG1 HG13 sing N N 128 ILE CG2 HG21 sing N N 129 ILE CG2 HG22 sing N N 130 ILE CG2 HG23 sing N N 131 ILE CD1 HD11 sing N N 132 ILE CD1 HD12 sing N N 133 ILE CD1 HD13 sing N N 134 ILE OXT HXT sing N N 135 LEU N CA sing N N 136 LEU N H sing N N 137 LEU N H2 sing N N 138 LEU CA C sing N N 139 LEU CA CB sing N N 140 LEU CA HA sing N N 141 LEU C O doub N N 142 LEU C OXT sing N N 143 LEU CB CG sing N N 144 LEU CB HB2 sing N N 145 LEU CB HB3 sing N N 146 LEU CG CD1 sing N N 147 LEU CG CD2 sing N N 148 LEU CG HG sing N N 149 LEU CD1 HD11 sing N N 150 LEU CD1 HD12 sing N N 151 LEU CD1 HD13 sing N N 152 LEU CD2 HD21 sing N N 153 LEU CD2 HD22 sing N N 154 LEU CD2 HD23 sing N N 155 LEU OXT HXT sing N N 156 LYS N CA sing N N 157 LYS N H sing N N 158 LYS N H2 sing N N 159 LYS CA C sing N N 160 LYS CA CB sing N N 161 LYS CA HA sing N N 162 LYS C O doub N N 163 LYS C OXT sing N N 164 LYS CB CG sing N N 165 LYS CB HB2 sing N N 166 LYS CB HB3 sing N N 167 LYS CG CD sing N N 168 LYS CG HG2 sing N N 169 LYS CG HG3 sing N N 170 LYS CD CE sing N N 171 LYS CD HD2 sing N N 172 LYS CD HD3 sing N N 173 LYS CE NZ sing N N 174 LYS CE HE2 sing N N 175 LYS CE HE3 sing N N 176 LYS NZ HZ1 sing N N 177 LYS NZ HZ2 sing N N 178 LYS NZ HZ3 sing N N 179 LYS OXT HXT sing N N 180 MET N CA sing N N 181 MET N H sing N N 182 MET N H2 sing N N 183 MET CA C sing N N 184 MET CA CB sing N N 185 MET CA HA sing N N 186 MET C O doub N N 187 MET C OXT sing N N 188 MET CB CG sing N N 189 MET CB HB2 sing N N 190 MET CB HB3 sing N N 191 MET CG SD sing N N 192 MET CG HG2 sing N N 193 MET CG HG3 sing N N 194 MET SD CE sing N N 195 MET CE HE1 sing N N 196 MET CE HE2 sing N N 197 MET CE HE3 sing N N 198 MET OXT HXT sing N N 199 PHE N CA sing N N 200 PHE N H sing N N 201 PHE N H2 sing N N 202 PHE CA C sing N N 203 PHE CA CB sing N N 204 PHE CA HA sing N N 205 PHE C O doub N N 206 PHE C OXT sing N N 207 PHE CB CG sing N N 208 PHE CB HB2 sing N N 209 PHE CB HB3 sing N N 210 PHE CG CD1 doub Y N 211 PHE CG CD2 sing Y N 212 PHE CD1 CE1 sing Y N 213 PHE CD1 HD1 sing N N 214 PHE CD2 CE2 doub Y N 215 PHE CD2 HD2 sing N N 216 PHE CE1 CZ doub Y N 217 PHE CE1 HE1 sing N N 218 PHE CE2 CZ sing Y N 219 PHE CE2 HE2 sing N N 220 PHE CZ HZ sing N N 221 PHE OXT HXT sing N N 222 PRO N CA sing N N 223 PRO N CD sing N N 224 PRO N H sing N N 225 PRO CA C sing N N 226 PRO CA CB sing N N 227 PRO CA HA sing N N 228 PRO C O doub N N 229 PRO C OXT sing N N 230 PRO CB CG sing N N 231 PRO CB HB2 sing N N 232 PRO CB HB3 sing N N 233 PRO CG CD sing N N 234 PRO CG HG2 sing N N 235 PRO CG HG3 sing N N 236 PRO CD HD2 sing N N 237 PRO CD HD3 sing N N 238 PRO OXT HXT sing N N 239 SER N CA sing N N 240 SER N H sing N N 241 SER N H2 sing N N 242 SER CA C sing N N 243 SER CA CB sing N N 244 SER CA HA sing N N 245 SER C O doub N N 246 SER C OXT sing N N 247 SER CB OG sing N N 248 SER CB HB2 sing N N 249 SER CB HB3 sing N N 250 SER OG HG sing N N 251 SER OXT HXT sing N N 252 THR N CA sing N N 253 THR N H sing N N 254 THR N H2 sing N N 255 THR CA C sing N N 256 THR CA CB sing N N 257 THR CA HA sing N N 258 THR C O doub N N 259 THR C OXT sing N N 260 THR CB OG1 sing N N 261 THR CB CG2 sing N N 262 THR CB HB sing N N 263 THR OG1 HG1 sing N N 264 THR CG2 HG21 sing N N 265 THR CG2 HG22 sing N N 266 THR CG2 HG23 sing N N 267 THR OXT HXT sing N N 268 TYR N CA sing N N 269 TYR N H sing N N 270 TYR N H2 sing N N 271 TYR CA C sing N N 272 TYR CA CB sing N N 273 TYR CA HA sing N N 274 TYR C O doub N N 275 TYR C OXT sing N N 276 TYR CB CG sing N N 277 TYR CB HB2 sing N N 278 TYR CB HB3 sing N N 279 TYR CG CD1 doub Y N 280 TYR CG CD2 sing Y N 281 TYR CD1 CE1 sing Y N 282 TYR CD1 HD1 sing N N 283 TYR CD2 CE2 doub Y N 284 TYR CD2 HD2 sing N N 285 TYR CE1 CZ doub Y N 286 TYR CE1 HE1 sing N N 287 TYR CE2 CZ sing Y N 288 TYR CE2 HE2 sing N N 289 TYR CZ OH sing N N 290 TYR OH HH sing N N 291 TYR OXT HXT sing N N 292 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AMX _pdbx_nmr_spectrometer.field_strength 500 # _atom_sites.entry_id 1RIM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_