data_1RTO # _entry.id 1RTO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1RTO pdb_00001rto 10.2210/pdb1rto/pdb WWPDB D_1000176223 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1RTN _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RTO _pdbx_database_status.recvd_initial_deposition_date 1995-02-21 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _audit_author.name 'Skelton, N.J.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Proton NMR assignments and solution conformation of RANTES, a chemokine of the C-C type.' _citation.journal_abbrev Biochemistry _citation.journal_volume 34 _citation.page_first 5329 _citation.page_last 5342 _citation.year 1995 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 7537088 _citation.pdbx_database_id_DOI 10.1021/bi00016a004 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Skelton, N.J.' 1 ? primary 'Aspiras, F.' 2 ? primary 'Ogez, J.' 3 ? primary 'Schall, T.J.' 4 ? # _cell.entry_id 1RTO _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1RTO _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description RANTES _entity.formula_weight 7862.011 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS _entity_poly.pdbx_seq_one_letter_code_can SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 PRO n 1 3 TYR n 1 4 SER n 1 5 SER n 1 6 ASP n 1 7 THR n 1 8 THR n 1 9 PRO n 1 10 CYS n 1 11 CYS n 1 12 PHE n 1 13 ALA n 1 14 TYR n 1 15 ILE n 1 16 ALA n 1 17 ARG n 1 18 PRO n 1 19 LEU n 1 20 PRO n 1 21 ARG n 1 22 ALA n 1 23 HIS n 1 24 ILE n 1 25 LYS n 1 26 GLU n 1 27 TYR n 1 28 PHE n 1 29 TYR n 1 30 THR n 1 31 SER n 1 32 GLY n 1 33 LYS n 1 34 CYS n 1 35 SER n 1 36 ASN n 1 37 PRO n 1 38 ALA n 1 39 VAL n 1 40 VAL n 1 41 PHE n 1 42 VAL n 1 43 THR n 1 44 ARG n 1 45 LYS n 1 46 ASN n 1 47 ARG n 1 48 GLN n 1 49 VAL n 1 50 CYS n 1 51 ALA n 1 52 ASN n 1 53 PRO n 1 54 GLU n 1 55 LYS n 1 56 LYS n 1 57 TRP n 1 58 VAL n 1 59 ARG n 1 60 GLU n 1 61 TYR n 1 62 ILE n 1 63 ASN n 1 64 SER n 1 65 LEU n 1 66 GLU n 1 67 MET n 1 68 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CCL5_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P13501 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKW VREYINSLEMS ; _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1RTO A 1 ? 68 ? P13501 24 ? 91 ? 1 68 2 1 1RTO B 1 ? 68 ? P13501 24 ? 91 ? 1 68 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1RTO _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement DGII ? HAVEL 1 refinement X-PLOR 3.1 BRUNGER 2 # _exptl.entry_id 1RTO _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1RTO _struct.title 'PROTON NMR ASSIGNMENTS AND SOLUTION CONFORMATION OF RANTES, A CHEMOKINE OF THE CC TYPE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1RTO _struct_keywords.pdbx_keywords CHEMOKINE _struct_keywords.text 'CHEMOTACTIC CYTOKINE, CHEMOKINE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AH1 TRP A 57 ? GLU A 66 ? TRP A 57 GLU A 66 1 ? 10 HELX_P HELX_P2 BH1 TRP B 57 ? GLU B 66 ? TRP B 57 GLU B 66 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 10 A CYS 34 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 50 SG ? ? A CYS 11 A CYS 50 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf3 disulf ? ? B CYS 10 SG ? ? ? 1_555 B CYS 34 SG ? ? B CYS 10 B CYS 34 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf4 disulf ? ? B CYS 11 SG ? ? ? 1_555 B CYS 50 SG ? ? B CYS 11 B CYS 50 1_555 ? ? ? ? ? ? ? 2.021 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 24 ? THR A 30 ? ILE A 24 THR A 30 A 2 ALA A 38 ? ARG A 44 ? ALA A 38 ARG A 44 A 3 ARG A 47 ? ALA A 51 ? ARG A 47 ALA A 51 B 1 ILE B 24 ? THR B 30 ? ILE B 24 THR B 30 B 2 ALA B 38 ? ARG B 44 ? ALA B 38 ARG B 44 B 3 ARG B 47 ? ALA B 51 ? ARG B 47 ALA B 51 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 26 ? O GLU A 26 N VAL A 42 ? N VAL A 42 A 2 3 O PHE A 41 ? O PHE A 41 N VAL A 49 ? N VAL A 49 B 1 2 O GLU B 26 ? O GLU B 26 N VAL B 42 ? N VAL B 42 B 2 3 O PHE B 41 ? O PHE B 41 N VAL B 49 ? N VAL B 49 # _database_PDB_matrix.entry_id 1RTO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1RTO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 MET 67 67 67 MET MET A . n A 1 68 SER 68 68 68 SER SER A . n B 1 1 SER 1 1 1 SER SER B . n B 1 2 PRO 2 2 2 PRO PRO B . n B 1 3 TYR 3 3 3 TYR TYR B . n B 1 4 SER 4 4 4 SER SER B . n B 1 5 SER 5 5 5 SER SER B . n B 1 6 ASP 6 6 6 ASP ASP B . n B 1 7 THR 7 7 7 THR THR B . n B 1 8 THR 8 8 8 THR THR B . n B 1 9 PRO 9 9 9 PRO PRO B . n B 1 10 CYS 10 10 10 CYS CYS B . n B 1 11 CYS 11 11 11 CYS CYS B . n B 1 12 PHE 12 12 12 PHE PHE B . n B 1 13 ALA 13 13 13 ALA ALA B . n B 1 14 TYR 14 14 14 TYR TYR B . n B 1 15 ILE 15 15 15 ILE ILE B . n B 1 16 ALA 16 16 16 ALA ALA B . n B 1 17 ARG 17 17 17 ARG ARG B . n B 1 18 PRO 18 18 18 PRO PRO B . n B 1 19 LEU 19 19 19 LEU LEU B . n B 1 20 PRO 20 20 20 PRO PRO B . n B 1 21 ARG 21 21 21 ARG ARG B . n B 1 22 ALA 22 22 22 ALA ALA B . n B 1 23 HIS 23 23 23 HIS HIS B . n B 1 24 ILE 24 24 24 ILE ILE B . n B 1 25 LYS 25 25 25 LYS LYS B . n B 1 26 GLU 26 26 26 GLU GLU B . n B 1 27 TYR 27 27 27 TYR TYR B . n B 1 28 PHE 28 28 28 PHE PHE B . n B 1 29 TYR 29 29 29 TYR TYR B . n B 1 30 THR 30 30 30 THR THR B . n B 1 31 SER 31 31 31 SER SER B . n B 1 32 GLY 32 32 32 GLY GLY B . n B 1 33 LYS 33 33 33 LYS LYS B . n B 1 34 CYS 34 34 34 CYS CYS B . n B 1 35 SER 35 35 35 SER SER B . n B 1 36 ASN 36 36 36 ASN ASN B . n B 1 37 PRO 37 37 37 PRO PRO B . n B 1 38 ALA 38 38 38 ALA ALA B . n B 1 39 VAL 39 39 39 VAL VAL B . n B 1 40 VAL 40 40 40 VAL VAL B . n B 1 41 PHE 41 41 41 PHE PHE B . n B 1 42 VAL 42 42 42 VAL VAL B . n B 1 43 THR 43 43 43 THR THR B . n B 1 44 ARG 44 44 44 ARG ARG B . n B 1 45 LYS 45 45 45 LYS LYS B . n B 1 46 ASN 46 46 46 ASN ASN B . n B 1 47 ARG 47 47 47 ARG ARG B . n B 1 48 GLN 48 48 48 GLN GLN B . n B 1 49 VAL 49 49 49 VAL VAL B . n B 1 50 CYS 50 50 50 CYS CYS B . n B 1 51 ALA 51 51 51 ALA ALA B . n B 1 52 ASN 52 52 52 ASN ASN B . n B 1 53 PRO 53 53 53 PRO PRO B . n B 1 54 GLU 54 54 54 GLU GLU B . n B 1 55 LYS 55 55 55 LYS LYS B . n B 1 56 LYS 56 56 56 LYS LYS B . n B 1 57 TRP 57 57 57 TRP TRP B . n B 1 58 VAL 58 58 58 VAL VAL B . n B 1 59 ARG 59 59 59 ARG ARG B . n B 1 60 GLU 60 60 60 GLU GLU B . n B 1 61 TYR 61 61 61 TYR TYR B . n B 1 62 ILE 62 62 62 ILE ILE B . n B 1 63 ASN 63 63 63 ASN ASN B . n B 1 64 SER 64 64 64 SER SER B . n B 1 65 LEU 65 65 65 LEU LEU B . n B 1 66 GLU 66 66 66 GLU GLU B . n B 1 67 MET 67 67 67 MET MET B . n B 1 68 SER 68 68 68 SER SER B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-06-03 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2 ? ? -77.92 -89.21 2 1 TYR A 3 ? ? -161.54 63.52 3 1 SER A 31 ? ? -179.04 -159.54 4 1 LYS A 33 ? ? -89.79 30.29 5 1 MET A 67 ? ? -53.74 -171.11 6 1 PRO B 2 ? ? -77.93 -89.18 7 1 TYR B 3 ? ? -161.49 63.48 8 1 SER B 31 ? ? -179.09 -159.57 9 1 LYS B 33 ? ? -89.85 30.31 10 1 MET B 67 ? ? -53.73 -171.17 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 17 ? ? 0.226 'SIDE CHAIN' 2 1 ARG A 21 ? ? 0.198 'SIDE CHAIN' 3 1 ARG A 44 ? ? 0.078 'SIDE CHAIN' 4 1 ARG A 47 ? ? 0.105 'SIDE CHAIN' 5 1 ARG A 59 ? ? 0.202 'SIDE CHAIN' 6 1 ARG B 17 ? ? 0.226 'SIDE CHAIN' 7 1 ARG B 21 ? ? 0.198 'SIDE CHAIN' 8 1 ARG B 44 ? ? 0.078 'SIDE CHAIN' 9 1 ARG B 47 ? ? 0.106 'SIDE CHAIN' 10 1 ARG B 59 ? ? 0.202 'SIDE CHAIN' #