data_1RYG
# 
_entry.id   1RYG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1RYG         pdb_00001ryg 10.2210/pdb1ryg/pdb 
RCSB  RCSB021148   ?            ?                   
WWPDB D_1000021148 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-01-13 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-11-10 
5 'Structure model' 1 4 2024-10-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 4 'Structure model' 'Experimental preparation'  
7 5 'Structure model' 'Data collection'           
8 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' database_2                       
2  4 'Structure model' pdbx_nmr_exptl_sample_conditions 
3  4 'Structure model' pdbx_nmr_software                
4  4 'Structure model' pdbx_struct_assembly             
5  4 'Structure model' pdbx_struct_oper_list            
6  4 'Structure model' struct_conn                      
7  4 'Structure model' struct_ref_seq_dif               
8  4 'Structure model' struct_site                      
9  5 'Structure model' chem_comp_atom                   
10 5 'Structure model' chem_comp_bond                   
11 5 'Structure model' pdbx_entry_details               
12 5 'Structure model' pdbx_modification_feature        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                             
2 4 'Structure model' '_database_2.pdbx_database_accession'              
3 4 'Structure model' '_pdbx_nmr_exptl_sample_conditions.pressure_units' 
4 4 'Structure model' '_pdbx_nmr_software.name'                          
5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'              
6 4 'Structure model' '_struct_ref_seq_dif.details'                      
7 4 'Structure model' '_struct_site.pdbx_auth_asym_id'                   
8 4 'Structure model' '_struct_site.pdbx_auth_comp_id'                   
9 4 'Structure model' '_struct_site.pdbx_auth_seq_id'                    
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RYG 
_pdbx_database_status.recvd_initial_deposition_date   2003-12-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1NIY 'Three-dimensional solution structure of HAINANTOXIN-IV' unspecified 
PDB 1RYV 'the same protein with K27A mutant'                      unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, D.'    1 
'Lu, S.'    2 
'Gu, X.'    3 
'Liang, S.' 4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'Structure--activity relationships of hainantoxin-IV and structure determination of active and inactive sodium channel blockers' 
J.Biol.Chem.                  279 37734 37740 2004 JBCHA3 US 0021-9258 0071 ? 15201273 10.1074/jbc.M405765200 
1       'Synthesis and Oxidative Refolding of Hainantoxin-Iv' 'Acta Biochim.Biophys.Sinica' 34  516   519   2002 ?      CN 
0582-9879 ?    ? ?        ?                      
2       
;Isolation and characterization of hainantoxin-IV, a novel antagonist of tetrodotoxin-sensitive sodium channels from the Chinese bird spider Selenocosmia hainana
;
'Cell.Mol.Life Sci.'          60  972   978   2003 ?      SZ 1420-682X ?    ? ?        ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, D.'      1  ? 
primary 'Xiao, Y.'    2  ? 
primary 'Xu, X.'      3  ? 
primary 'Xiong, X.'   4  ? 
primary 'Lu, S.'      5  ? 
primary 'Liu, Z.'     6  ? 
primary 'Zhu, Q.'     7  ? 
primary 'Wang, M.'    8  ? 
primary 'Gu, X.'      9  ? 
primary 'Liang, S.'   10 ? 
1       'Liu, Z.H.'   11 ? 
1       'Chen, P.'    12 ? 
1       'Liang, S.P.' 13 ? 
2       'Liu, Z.'     14 ? 
2       'Dai, J.'     15 ? 
2       'Chen, Z.'    16 ? 
2       'Hu, W.'      17 ? 
2       'Xiao, Y.'    18 ? 
2       'Liang, S.'   19 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 syn 
_entity.pdbx_description           Hainantoxin-IV 
_entity.formula_weight             3913.513 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              R29A 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        HnTx-IV 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       'ECLGFGKGCNPSNDQCCKSSNLVCSRKHAWCKYEI(NH2)' 
_entity_poly.pdbx_seq_one_letter_code_can   ECLGFGKGCNPSNDQCCKSSNLVCSRKHAWCKYEIX 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLU n 
1 2  CYS n 
1 3  LEU n 
1 4  GLY n 
1 5  PHE n 
1 6  GLY n 
1 7  LYS n 
1 8  GLY n 
1 9  CYS n 
1 10 ASN n 
1 11 PRO n 
1 12 SER n 
1 13 ASN n 
1 14 ASP n 
1 15 GLN n 
1 16 CYS n 
1 17 CYS n 
1 18 LYS n 
1 19 SER n 
1 20 SER n 
1 21 ASN n 
1 22 LEU n 
1 23 VAL n 
1 24 CYS n 
1 25 SER n 
1 26 ARG n 
1 27 LYS n 
1 28 HIS n 
1 29 ALA n 
1 30 TRP n 
1 31 CYS n 
1 32 LYS n 
1 33 TYR n 
1 34 GLU n 
1 35 ILE n 
1 36 NH2 n 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'synthesized using standard fmoc chemistry.' 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
NH2 non-polymer         . 'AMINO GROUP'   ? 'H2 N'           16.023  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLU 1  1  1  GLU GLU A . n 
A 1 2  CYS 2  2  2  CYS CYS A . n 
A 1 3  LEU 3  3  3  LEU LEU A . n 
A 1 4  GLY 4  4  4  GLY GLY A . n 
A 1 5  PHE 5  5  5  PHE PHE A . n 
A 1 6  GLY 6  6  6  GLY GLY A . n 
A 1 7  LYS 7  7  7  LYS LYS A . n 
A 1 8  GLY 8  8  8  GLY GLY A . n 
A 1 9  CYS 9  9  9  CYS CYS A . n 
A 1 10 ASN 10 10 10 ASN ASN A . n 
A 1 11 PRO 11 11 11 PRO PRO A . n 
A 1 12 SER 12 12 12 SER SER A . n 
A 1 13 ASN 13 13 13 ASN ASN A . n 
A 1 14 ASP 14 14 14 ASP ASP A . n 
A 1 15 GLN 15 15 15 GLN GLN A . n 
A 1 16 CYS 16 16 16 CYS CYS A . n 
A 1 17 CYS 17 17 17 CYS CYS A . n 
A 1 18 LYS 18 18 18 LYS LYS A . n 
A 1 19 SER 19 19 19 SER SER A . n 
A 1 20 SER 20 20 20 SER SER A . n 
A 1 21 ASN 21 21 21 ASN ASN A . n 
A 1 22 LEU 22 22 22 LEU LEU A . n 
A 1 23 VAL 23 23 23 VAL VAL A . n 
A 1 24 CYS 24 24 24 CYS CYS A . n 
A 1 25 SER 25 25 25 SER SER A . n 
A 1 26 ARG 26 26 26 ARG ARG A . n 
A 1 27 LYS 27 27 27 LYS LYS A . n 
A 1 28 HIS 28 28 28 HIS HIS A . n 
A 1 29 ALA 29 29 29 ALA ALA A . n 
A 1 30 TRP 30 30 30 TRP TRP A . n 
A 1 31 CYS 31 31 31 CYS CYS A . n 
A 1 32 LYS 32 32 32 LYS LYS A . n 
A 1 33 TYR 33 33 33 TYR TYR A . n 
A 1 34 GLU 34 34 34 GLU GLU A . n 
A 1 35 ILE 35 35 35 ILE ILE A . n 
A 1 36 NH2 36 36 36 NH2 NH2 A . n 
# 
_cell.entry_id           1RYG 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1RYG 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_exptl.entry_id          1RYG 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_database_PDB_matrix.entry_id          1RYG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1RYG 
_struct.title                     
'Three dimensional solution structure of the R29A MUTANT of sodium channels inhibitor HAINANTOXIN-IV by 2D 1H-NMR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RYG 
_struct_keywords.pdbx_keywords   TOXIN 
_struct_keywords.text            'Neurotoxin, Inhibitor cystine knot motif, TOXIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TXHA4_SELHA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P83471 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1RYG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 35 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P83471 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  35 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       35 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1RYG 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      29 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P83471 
_struct_ref_seq_dif.db_mon_id                    ARG 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          29 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            29 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 2  SG ? ? ? 1_555 A CYS 17 SG ? ? A CYS 2  A CYS 17 1_555 ? ? ? ? ? ? ? 2.020 ? ? 
disulf2 disulf ?    ? A CYS 9  SG ? ? ? 1_555 A CYS 24 SG ? ? A CYS 9  A CYS 24 1_555 ? ? ? ? ? ? ? 2.021 ? ? 
disulf3 disulf ?    ? A CYS 16 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 16 A CYS 31 1_555 ? ? ? ? ? ? ? 2.019 ? ? 
covale1 covale both ? A ILE 35 C  ? ? ? 1_555 A NH2 36 N  ? ? A ILE 35 A NH2 36 1_555 ? ? ? ? ? ? ? 1.312 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 NH2 A 36 ? ILE A 35 ? NH2 A 36 ? 1_555 ILE A 35 ? 1_555 .  .  ILE 3 NH2 None 'Terminal amidation' 
2 CYS A 2  ? CYS A 17 ? CYS A 2  ? 1_555 CYS A 17 ? 1_555 SG SG .   . .   None 'Disulfide bridge'   
3 CYS A 9  ? CYS A 24 ? CYS A 9  ? 1_555 CYS A 24 ? 1_555 SG SG .   . .   None 'Disulfide bridge'   
4 CYS A 16 ? CYS A 31 ? CYS A 16 ? 1_555 CYS A 31 ? 1_555 SG SG .   . .   None 'Disulfide bridge'   
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 22 ? CYS A 24 ? LEU A 22 CYS A 24 
A 2 CYS A 31 ? TYR A 33 ? CYS A 31 TYR A 33 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   VAL 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    23 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    VAL 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     23 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   LYS 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    32 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    LYS 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     32 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    NH2 
_struct_site.pdbx_auth_seq_id     36 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    2 
_struct_site.details              'BINDING SITE FOR RESIDUE NH2 A 36' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 GLU A 34 ? GLU A 34 . ? 1_555 ? 
2 AC1 2 ILE A 35 ? ILE A 35 . ? 1_555 ? 
# 
_pdbx_entry_details.entry_id                   1RYG 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  ASN A 13 ? ? -115.43 65.76   
2  2  ASN A 21 ? ? 55.95   87.23   
3  4  ASN A 13 ? ? -112.43 56.36   
4  5  ASN A 13 ? ? -116.20 71.47   
5  6  ASN A 13 ? ? -100.89 54.04   
6  7  ASN A 21 ? ? 57.56   83.55   
7  8  ASN A 13 ? ? -116.71 73.78   
8  9  ASN A 13 ? ? -112.07 57.55   
9  9  ASN A 21 ? ? 54.91   72.70   
10 9  GLU A 34 ? ? -103.20 75.86   
11 10 GLN A 15 ? ? -140.30 38.29   
12 10 ASN A 21 ? ? 49.51   70.39   
13 11 CYS A 9  ? ? -114.69 -166.11 
14 14 CYS A 9  ? ? -148.27 -159.95 
15 14 ASN A 13 ? ? -105.74 65.88   
16 15 ASN A 13 ? ? -114.97 64.86   
17 15 GLN A 15 ? ? -106.90 40.71   
18 16 ASN A 13 ? ? -114.97 69.14   
19 16 ASN A 21 ? ? 50.05   75.10   
20 17 ASN A 21 ? ? 59.80   70.58   
21 18 ASN A 13 ? ? -119.71 69.80   
22 19 ASN A 13 ? ? -107.92 62.31   
23 20 ASN A 13 ? ? -111.69 67.57   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1  ARG A 26 ? ? 0.317 'SIDE CHAIN' 
2  2  ARG A 26 ? ? 0.309 'SIDE CHAIN' 
3  3  ARG A 26 ? ? 0.318 'SIDE CHAIN' 
4  4  ARG A 26 ? ? 0.316 'SIDE CHAIN' 
5  5  ARG A 26 ? ? 0.307 'SIDE CHAIN' 
6  6  ARG A 26 ? ? 0.310 'SIDE CHAIN' 
7  7  ARG A 26 ? ? 0.318 'SIDE CHAIN' 
8  8  ARG A 26 ? ? 0.312 'SIDE CHAIN' 
9  9  ARG A 26 ? ? 0.294 'SIDE CHAIN' 
10 10 ARG A 26 ? ? 0.316 'SIDE CHAIN' 
11 11 ARG A 26 ? ? 0.303 'SIDE CHAIN' 
12 12 ARG A 26 ? ? 0.312 'SIDE CHAIN' 
13 13 ARG A 26 ? ? 0.315 'SIDE CHAIN' 
14 14 ARG A 26 ? ? 0.317 'SIDE CHAIN' 
15 15 ARG A 26 ? ? 0.318 'SIDE CHAIN' 
16 16 ARG A 26 ? ? 0.313 'SIDE CHAIN' 
17 17 ARG A 26 ? ? 0.311 'SIDE CHAIN' 
18 18 ARG A 26 ? ? 0.310 'SIDE CHAIN' 
19 19 ARG A 26 ? ? 0.317 'SIDE CHAIN' 
20 20 ARG A 26 ? ? 0.303 'SIDE CHAIN' 
# 
_pdbx_nmr_ensemble.entry_id                                      1RYG 
_pdbx_nmr_ensemble.conformers_calculated_total_number            50 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1RYG 
_pdbx_nmr_representative.conformer_id         13 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         5.0mM 
_pdbx_nmr_sample_details.solvent_system   '20mM deuterium acetic acid BU, 90% H2O, 10% D2O' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         295 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  4.00 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      20 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 NOESY    1 
2 1 DQF-COSY 1 
3 1 TOCSY    1 
# 
_pdbx_nmr_details.entry_id   1RYG 
_pdbx_nmr_details.text       'this structure was determined using standard 2D homonuclear techniques.' 
# 
_pdbx_nmr_refine.entry_id           1RYG 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            
;the structures are based on 366 NOE- derived distance constraints, 15 dihedral angle restraints, 9 fake distance restraints from disulfide bonds and 12 hydrogen- bond constrains.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement X-PLOR 3.851 ? 1 
processing Felix  98.0  ? 2 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
ILE N    N N N 158 
ILE CA   C N S 159 
ILE C    C N N 160 
ILE O    O N N 161 
ILE CB   C N S 162 
ILE CG1  C N N 163 
ILE CG2  C N N 164 
ILE CD1  C N N 165 
ILE OXT  O N N 166 
ILE H    H N N 167 
ILE H2   H N N 168 
ILE HA   H N N 169 
ILE HB   H N N 170 
ILE HG12 H N N 171 
ILE HG13 H N N 172 
ILE HG21 H N N 173 
ILE HG22 H N N 174 
ILE HG23 H N N 175 
ILE HD11 H N N 176 
ILE HD12 H N N 177 
ILE HD13 H N N 178 
ILE HXT  H N N 179 
LEU N    N N N 180 
LEU CA   C N S 181 
LEU C    C N N 182 
LEU O    O N N 183 
LEU CB   C N N 184 
LEU CG   C N N 185 
LEU CD1  C N N 186 
LEU CD2  C N N 187 
LEU OXT  O N N 188 
LEU H    H N N 189 
LEU H2   H N N 190 
LEU HA   H N N 191 
LEU HB2  H N N 192 
LEU HB3  H N N 193 
LEU HG   H N N 194 
LEU HD11 H N N 195 
LEU HD12 H N N 196 
LEU HD13 H N N 197 
LEU HD21 H N N 198 
LEU HD22 H N N 199 
LEU HD23 H N N 200 
LEU HXT  H N N 201 
LYS N    N N N 202 
LYS CA   C N S 203 
LYS C    C N N 204 
LYS O    O N N 205 
LYS CB   C N N 206 
LYS CG   C N N 207 
LYS CD   C N N 208 
LYS CE   C N N 209 
LYS NZ   N N N 210 
LYS OXT  O N N 211 
LYS H    H N N 212 
LYS H2   H N N 213 
LYS HA   H N N 214 
LYS HB2  H N N 215 
LYS HB3  H N N 216 
LYS HG2  H N N 217 
LYS HG3  H N N 218 
LYS HD2  H N N 219 
LYS HD3  H N N 220 
LYS HE2  H N N 221 
LYS HE3  H N N 222 
LYS HZ1  H N N 223 
LYS HZ2  H N N 224 
LYS HZ3  H N N 225 
LYS HXT  H N N 226 
NH2 N    N N N 227 
NH2 HN1  H N N 228 
NH2 HN2  H N N 229 
PHE N    N N N 230 
PHE CA   C N S 231 
PHE C    C N N 232 
PHE O    O N N 233 
PHE CB   C N N 234 
PHE CG   C Y N 235 
PHE CD1  C Y N 236 
PHE CD2  C Y N 237 
PHE CE1  C Y N 238 
PHE CE2  C Y N 239 
PHE CZ   C Y N 240 
PHE OXT  O N N 241 
PHE H    H N N 242 
PHE H2   H N N 243 
PHE HA   H N N 244 
PHE HB2  H N N 245 
PHE HB3  H N N 246 
PHE HD1  H N N 247 
PHE HD2  H N N 248 
PHE HE1  H N N 249 
PHE HE2  H N N 250 
PHE HZ   H N N 251 
PHE HXT  H N N 252 
PRO N    N N N 253 
PRO CA   C N S 254 
PRO C    C N N 255 
PRO O    O N N 256 
PRO CB   C N N 257 
PRO CG   C N N 258 
PRO CD   C N N 259 
PRO OXT  O N N 260 
PRO H    H N N 261 
PRO HA   H N N 262 
PRO HB2  H N N 263 
PRO HB3  H N N 264 
PRO HG2  H N N 265 
PRO HG3  H N N 266 
PRO HD2  H N N 267 
PRO HD3  H N N 268 
PRO HXT  H N N 269 
SER N    N N N 270 
SER CA   C N S 271 
SER C    C N N 272 
SER O    O N N 273 
SER CB   C N N 274 
SER OG   O N N 275 
SER OXT  O N N 276 
SER H    H N N 277 
SER H2   H N N 278 
SER HA   H N N 279 
SER HB2  H N N 280 
SER HB3  H N N 281 
SER HG   H N N 282 
SER HXT  H N N 283 
TRP N    N N N 284 
TRP CA   C N S 285 
TRP C    C N N 286 
TRP O    O N N 287 
TRP CB   C N N 288 
TRP CG   C Y N 289 
TRP CD1  C Y N 290 
TRP CD2  C Y N 291 
TRP NE1  N Y N 292 
TRP CE2  C Y N 293 
TRP CE3  C Y N 294 
TRP CZ2  C Y N 295 
TRP CZ3  C Y N 296 
TRP CH2  C Y N 297 
TRP OXT  O N N 298 
TRP H    H N N 299 
TRP H2   H N N 300 
TRP HA   H N N 301 
TRP HB2  H N N 302 
TRP HB3  H N N 303 
TRP HD1  H N N 304 
TRP HE1  H N N 305 
TRP HE3  H N N 306 
TRP HZ2  H N N 307 
TRP HZ3  H N N 308 
TRP HH2  H N N 309 
TRP HXT  H N N 310 
TYR N    N N N 311 
TYR CA   C N S 312 
TYR C    C N N 313 
TYR O    O N N 314 
TYR CB   C N N 315 
TYR CG   C Y N 316 
TYR CD1  C Y N 317 
TYR CD2  C Y N 318 
TYR CE1  C Y N 319 
TYR CE2  C Y N 320 
TYR CZ   C Y N 321 
TYR OH   O N N 322 
TYR OXT  O N N 323 
TYR H    H N N 324 
TYR H2   H N N 325 
TYR HA   H N N 326 
TYR HB2  H N N 327 
TYR HB3  H N N 328 
TYR HD1  H N N 329 
TYR HD2  H N N 330 
TYR HE1  H N N 331 
TYR HE2  H N N 332 
TYR HH   H N N 333 
TYR HXT  H N N 334 
VAL N    N N N 335 
VAL CA   C N S 336 
VAL C    C N N 337 
VAL O    O N N 338 
VAL CB   C N N 339 
VAL CG1  C N N 340 
VAL CG2  C N N 341 
VAL OXT  O N N 342 
VAL H    H N N 343 
VAL H2   H N N 344 
VAL HA   H N N 345 
VAL HB   H N N 346 
VAL HG11 H N N 347 
VAL HG12 H N N 348 
VAL HG13 H N N 349 
VAL HG21 H N N 350 
VAL HG22 H N N 351 
VAL HG23 H N N 352 
VAL HXT  H N N 353 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
NH2 N   HN1  sing N N 216 
NH2 N   HN2  sing N N 217 
PHE N   CA   sing N N 218 
PHE N   H    sing N N 219 
PHE N   H2   sing N N 220 
PHE CA  C    sing N N 221 
PHE CA  CB   sing N N 222 
PHE CA  HA   sing N N 223 
PHE C   O    doub N N 224 
PHE C   OXT  sing N N 225 
PHE CB  CG   sing N N 226 
PHE CB  HB2  sing N N 227 
PHE CB  HB3  sing N N 228 
PHE CG  CD1  doub Y N 229 
PHE CG  CD2  sing Y N 230 
PHE CD1 CE1  sing Y N 231 
PHE CD1 HD1  sing N N 232 
PHE CD2 CE2  doub Y N 233 
PHE CD2 HD2  sing N N 234 
PHE CE1 CZ   doub Y N 235 
PHE CE1 HE1  sing N N 236 
PHE CE2 CZ   sing Y N 237 
PHE CE2 HE2  sing N N 238 
PHE CZ  HZ   sing N N 239 
PHE OXT HXT  sing N N 240 
PRO N   CA   sing N N 241 
PRO N   CD   sing N N 242 
PRO N   H    sing N N 243 
PRO CA  C    sing N N 244 
PRO CA  CB   sing N N 245 
PRO CA  HA   sing N N 246 
PRO C   O    doub N N 247 
PRO C   OXT  sing N N 248 
PRO CB  CG   sing N N 249 
PRO CB  HB2  sing N N 250 
PRO CB  HB3  sing N N 251 
PRO CG  CD   sing N N 252 
PRO CG  HG2  sing N N 253 
PRO CG  HG3  sing N N 254 
PRO CD  HD2  sing N N 255 
PRO CD  HD3  sing N N 256 
PRO OXT HXT  sing N N 257 
SER N   CA   sing N N 258 
SER N   H    sing N N 259 
SER N   H2   sing N N 260 
SER CA  C    sing N N 261 
SER CA  CB   sing N N 262 
SER CA  HA   sing N N 263 
SER C   O    doub N N 264 
SER C   OXT  sing N N 265 
SER CB  OG   sing N N 266 
SER CB  HB2  sing N N 267 
SER CB  HB3  sing N N 268 
SER OG  HG   sing N N 269 
SER OXT HXT  sing N N 270 
TRP N   CA   sing N N 271 
TRP N   H    sing N N 272 
TRP N   H2   sing N N 273 
TRP CA  C    sing N N 274 
TRP CA  CB   sing N N 275 
TRP CA  HA   sing N N 276 
TRP C   O    doub N N 277 
TRP C   OXT  sing N N 278 
TRP CB  CG   sing N N 279 
TRP CB  HB2  sing N N 280 
TRP CB  HB3  sing N N 281 
TRP CG  CD1  doub Y N 282 
TRP CG  CD2  sing Y N 283 
TRP CD1 NE1  sing Y N 284 
TRP CD1 HD1  sing N N 285 
TRP CD2 CE2  doub Y N 286 
TRP CD2 CE3  sing Y N 287 
TRP NE1 CE2  sing Y N 288 
TRP NE1 HE1  sing N N 289 
TRP CE2 CZ2  sing Y N 290 
TRP CE3 CZ3  doub Y N 291 
TRP CE3 HE3  sing N N 292 
TRP CZ2 CH2  doub Y N 293 
TRP CZ2 HZ2  sing N N 294 
TRP CZ3 CH2  sing Y N 295 
TRP CZ3 HZ3  sing N N 296 
TRP CH2 HH2  sing N N 297 
TRP OXT HXT  sing N N 298 
TYR N   CA   sing N N 299 
TYR N   H    sing N N 300 
TYR N   H2   sing N N 301 
TYR CA  C    sing N N 302 
TYR CA  CB   sing N N 303 
TYR CA  HA   sing N N 304 
TYR C   O    doub N N 305 
TYR C   OXT  sing N N 306 
TYR CB  CG   sing N N 307 
TYR CB  HB2  sing N N 308 
TYR CB  HB3  sing N N 309 
TYR CG  CD1  doub Y N 310 
TYR CG  CD2  sing Y N 311 
TYR CD1 CE1  sing Y N 312 
TYR CD1 HD1  sing N N 313 
TYR CD2 CE2  doub Y N 314 
TYR CD2 HD2  sing N N 315 
TYR CE1 CZ   doub Y N 316 
TYR CE1 HE1  sing N N 317 
TYR CE2 CZ   sing Y N 318 
TYR CE2 HE2  sing N N 319 
TYR CZ  OH   sing N N 320 
TYR OH  HH   sing N N 321 
TYR OXT HXT  sing N N 322 
VAL N   CA   sing N N 323 
VAL N   H    sing N N 324 
VAL N   H2   sing N N 325 
VAL CA  C    sing N N 326 
VAL CA  CB   sing N N 327 
VAL CA  HA   sing N N 328 
VAL C   O    doub N N 329 
VAL C   OXT  sing N N 330 
VAL CB  CG1  sing N N 331 
VAL CB  CG2  sing N N 332 
VAL CB  HB   sing N N 333 
VAL CG1 HG11 sing N N 334 
VAL CG1 HG12 sing N N 335 
VAL CG1 HG13 sing N N 336 
VAL CG2 HG21 sing N N 337 
VAL CG2 HG22 sing N N 338 
VAL CG2 HG23 sing N N 339 
VAL OXT HXT  sing N N 340 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             DRX 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    500 
_pdbx_nmr_spectrometer.type              ? 
# 
_atom_sites.entry_id                    1RYG 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_