data_1RYJ
# 
_entry.id   1RYJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1RYJ         pdb_00001ryj 10.2210/pdb1ryj/pdb 
RCSB  RCSB021151   ?            ?                   
WWPDB D_1000021151 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-02-24 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-03-02 
5 'Structure model' 1 4 2024-05-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
5 5 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2            
2 4 'Structure model' pdbx_struct_assembly  
3 4 'Structure model' pdbx_struct_oper_list 
4 5 'Structure model' chem_comp_atom        
5 5 'Structure model' chem_comp_bond        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2004-02-24 
_pdbx_database_PDB_obs_spr.pdb_id           1ryj 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1jsb 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1RYJ 
_pdbx_database_status.recvd_initial_deposition_date   2003-12-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
BMRB     5106  . unspecified 
TargetDB TT526 . unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yee, A.'                                         1  
'Chang, X.'                                       2  
'Pineda-Lucena, A.'                               3  
'Wu, B.'                                          4  
'Semesi, A.'                                      5  
'Le, B.'                                          6  
'Ramelot, T.'                                     7  
'Lee, G.M.'                                       8  
'Bhattacharyya, S.'                               9  
'Gutierrez, P.'                                   10 
'Denisov, A.'                                     11 
'Lee, C.H.'                                       12 
'Cort, J.R.'                                      13 
'Kozlov, G.'                                      14 
'Liao, J.'                                        15 
'Finak, G.'                                       16 
'Chen, L.'                                        17 
'Wishart, D.'                                     18 
'Lee, W.'                                         19 
'McIntosh, L.P.'                                  20 
'Gehring, K.'                                     21 
'Kennedy, M.A.'                                   22 
'Edwards, A.M.'                                   23 
'Arrowsmith, C.H.'                                24 
'Northeast Structural Genomics Consortium (NESG)' 25 
# 
_citation.id                        primary 
_citation.title                     'AN NMR APPROACH TO STRUCTURAL PROTEOMICS' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            99 
_citation.page_first                1825 
_citation.page_last                 1830 
_citation.year                      2002 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11854485 
_citation.pdbx_database_id_DOI      10.1073/pnas.042684599 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Yee, A.'           1  ? 
primary 'Chang, X.'         2  ? 
primary 'Pineda-Lucena, A.' 3  ? 
primary 'Wu, B.'            4  ? 
primary 'Semesi, A.'        5  ? 
primary 'Le, B.'            6  ? 
primary 'Ramelot, T.'       7  ? 
primary 'Lee, G.M.'         8  ? 
primary 'Bhattacharyya, S.' 9  ? 
primary 'Gutierrez, P.'     10 ? 
primary 'Denisov, A.'       11 ? 
primary 'Lee, C.H.'         12 ? 
primary 'Cort, J.R.'        13 ? 
primary 'Kozlov, G.'        14 ? 
primary 'Liao, J.'          15 ? 
primary 'Finak, G.'         16 ? 
primary 'Chen, L.'          17 ? 
primary 'Wishart, D.'       18 ? 
primary 'Lee, W.'           19 ? 
primary 'McIntosh, L.P.'    20 ? 
primary 'Gehring, K.'       21 ? 
primary 'Kennedy, M.A.'     22 ? 
primary 'Edwards, A.M.'     23 ? 
primary 'Arrowsmith, C.H.'  24 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           unknown 
_entity.formula_weight             7765.070 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'hypothetical protein mth1743' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MVIGMKFTVITDDGKKILESGAPRRIKDVLGELEIPIETVVVKKNGQIVIDEEEIFDGDIIEVIRVIYGG 
_entity_poly.pdbx_seq_one_letter_code_can   MVIGMKFTVITDDGKKILESGAPRRIKDVLGELEIPIETVVVKKNGQIVIDEEEIFDGDIIEVIRVIYGG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         TT526 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  VAL n 
1 3  ILE n 
1 4  GLY n 
1 5  MET n 
1 6  LYS n 
1 7  PHE n 
1 8  THR n 
1 9  VAL n 
1 10 ILE n 
1 11 THR n 
1 12 ASP n 
1 13 ASP n 
1 14 GLY n 
1 15 LYS n 
1 16 LYS n 
1 17 ILE n 
1 18 LEU n 
1 19 GLU n 
1 20 SER n 
1 21 GLY n 
1 22 ALA n 
1 23 PRO n 
1 24 ARG n 
1 25 ARG n 
1 26 ILE n 
1 27 LYS n 
1 28 ASP n 
1 29 VAL n 
1 30 LEU n 
1 31 GLY n 
1 32 GLU n 
1 33 LEU n 
1 34 GLU n 
1 35 ILE n 
1 36 PRO n 
1 37 ILE n 
1 38 GLU n 
1 39 THR n 
1 40 VAL n 
1 41 VAL n 
1 42 VAL n 
1 43 LYS n 
1 44 LYS n 
1 45 ASN n 
1 46 GLY n 
1 47 GLN n 
1 48 ILE n 
1 49 VAL n 
1 50 ILE n 
1 51 ASP n 
1 52 GLU n 
1 53 GLU n 
1 54 GLU n 
1 55 ILE n 
1 56 PHE n 
1 57 ASP n 
1 58 GLY n 
1 59 ASP n 
1 60 ILE n 
1 61 ILE n 
1 62 GLU n 
1 63 VAL n 
1 64 ILE n 
1 65 ARG n 
1 66 VAL n 
1 67 ILE n 
1 68 TYR n 
1 69 GLY n 
1 70 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Methanothermococcus 
_entity_src_gen.pdbx_gene_src_gene                 archaea 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Methanothermococcus thermolithotrophicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2186 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET15B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  4  4  MET MET A . n 
A 1 2  VAL 2  5  5  VAL VAL A . n 
A 1 3  ILE 3  6  6  ILE ILE A . n 
A 1 4  GLY 4  7  7  GLY GLY A . n 
A 1 5  MET 5  8  8  MET MET A . n 
A 1 6  LYS 6  9  9  LYS LYS A . n 
A 1 7  PHE 7  10 10 PHE PHE A . n 
A 1 8  THR 8  11 11 THR THR A . n 
A 1 9  VAL 9  12 12 VAL VAL A . n 
A 1 10 ILE 10 13 13 ILE ILE A . n 
A 1 11 THR 11 14 14 THR THR A . n 
A 1 12 ASP 12 15 15 ASP ASP A . n 
A 1 13 ASP 13 16 16 ASP ASP A . n 
A 1 14 GLY 14 17 17 GLY GLY A . n 
A 1 15 LYS 15 18 18 LYS LYS A . n 
A 1 16 LYS 16 19 19 LYS LYS A . n 
A 1 17 ILE 17 20 20 ILE ILE A . n 
A 1 18 LEU 18 21 21 LEU LEU A . n 
A 1 19 GLU 19 22 22 GLU GLU A . n 
A 1 20 SER 20 23 23 SER SER A . n 
A 1 21 GLY 21 24 24 GLY GLY A . n 
A 1 22 ALA 22 25 25 ALA ALA A . n 
A 1 23 PRO 23 26 26 PRO PRO A . n 
A 1 24 ARG 24 27 27 ARG ARG A . n 
A 1 25 ARG 25 28 28 ARG ARG A . n 
A 1 26 ILE 26 29 29 ILE ILE A . n 
A 1 27 LYS 27 30 30 LYS LYS A . n 
A 1 28 ASP 28 31 31 ASP ASP A . n 
A 1 29 VAL 29 32 32 VAL VAL A . n 
A 1 30 LEU 30 33 33 LEU LEU A . n 
A 1 31 GLY 31 34 34 GLY GLY A . n 
A 1 32 GLU 32 35 35 GLU GLU A . n 
A 1 33 LEU 33 36 36 LEU LEU A . n 
A 1 34 GLU 34 37 37 GLU GLU A . n 
A 1 35 ILE 35 38 38 ILE ILE A . n 
A 1 36 PRO 36 39 39 PRO PRO A . n 
A 1 37 ILE 37 40 40 ILE ILE A . n 
A 1 38 GLU 38 41 41 GLU GLU A . n 
A 1 39 THR 39 42 42 THR THR A . n 
A 1 40 VAL 40 43 43 VAL VAL A . n 
A 1 41 VAL 41 44 44 VAL VAL A . n 
A 1 42 VAL 42 45 45 VAL VAL A . n 
A 1 43 LYS 43 46 46 LYS LYS A . n 
A 1 44 LYS 44 47 47 LYS LYS A . n 
A 1 45 ASN 45 48 48 ASN ASN A . n 
A 1 46 GLY 46 49 49 GLY GLY A . n 
A 1 47 GLN 47 50 50 GLN GLN A . n 
A 1 48 ILE 48 51 51 ILE ILE A . n 
A 1 49 VAL 49 52 52 VAL VAL A . n 
A 1 50 ILE 50 53 53 ILE ILE A . n 
A 1 51 ASP 51 54 54 ASP ASP A . n 
A 1 52 GLU 52 55 55 GLU GLU A . n 
A 1 53 GLU 53 56 56 GLU GLU A . n 
A 1 54 GLU 54 57 57 GLU GLU A . n 
A 1 55 ILE 55 58 58 ILE ILE A . n 
A 1 56 PHE 56 59 59 PHE PHE A . n 
A 1 57 ASP 57 60 60 ASP ASP A . n 
A 1 58 GLY 58 61 61 GLY GLY A . n 
A 1 59 ASP 59 62 62 ASP ASP A . n 
A 1 60 ILE 60 63 63 ILE ILE A . n 
A 1 61 ILE 61 64 64 ILE ILE A . n 
A 1 62 GLU 62 65 65 GLU GLU A . n 
A 1 63 VAL 63 66 66 VAL VAL A . n 
A 1 64 ILE 64 67 67 ILE ILE A . n 
A 1 65 ARG 65 68 68 ARG ARG A . n 
A 1 66 VAL 66 69 69 VAL VAL A . n 
A 1 67 ILE 67 70 70 ILE ILE A . n 
A 1 68 TYR 68 71 71 TYR TYR A . n 
A 1 69 GLY 69 72 72 GLY GLY A . n 
A 1 70 GLY 70 73 73 GLY GLY A . n 
# 
_exptl.entry_id          1RYJ 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_database_PDB_matrix.entry_id          1RYJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1RYJ 
_struct.title                     
;Solution NMR Structure of Protein Mth1743 from Methanobacterium thermoautotrophicum. Ontario Centre for Structural Proteomics target MTH1743_1_70; Northeast Structural Genomics Consortium Target TT526.
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1RYJ 
_struct_keywords.pdbx_keywords   'structural genomics, unknown function' 
_struct_keywords.text            
;beta/alpha protein, Structural Genomics, Protein Structure Initiative, OCSP, NESG, PSI, Northeast Structural Genomics Consortium, unknown function
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    O27775_METTH 
_struct_ref.pdbx_db_accession          O27775 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   MVIGMKFTVITDDGKKILESGAPRRIKDVLGELEIPIETVVVKKNGQIVIDEEEIFDGDIIEVIRVIYGG 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1RYJ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 70 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O27775 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  70 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       4 
_struct_ref_seq.pdbx_auth_seq_align_end       73 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ARG 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        25 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       LEU 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        33 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ARG 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         28 
_struct_conf.end_auth_comp_id        LEU 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         36 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   9 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 14 ? SER A 20 ? GLY A 17 SER A 23 
A 2 MET A 5  ? THR A 11 ? MET A 8  THR A 14 
A 3 ILE A 60 ? ARG A 65 ? ILE A 63 ARG A 68 
A 4 VAL A 40 ? LYS A 44 ? VAL A 43 LYS A 47 
A 5 GLN A 47 ? ILE A 48 ? GLN A 50 ILE A 51 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O SER A 20 ? O SER A 23 N MET A 5  ? N MET A 8  
A 2 3 N THR A 8  ? N THR A 11 O ILE A 61 ? O ILE A 64 
A 3 4 O GLU A 62 ? O GLU A 65 N LYS A 43 ? N LYS A 46 
A 4 5 N LYS A 44 ? N LYS A 47 O GLN A 47 ? O GLN A 50 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  2  HZ3 A LYS 30 ? ? OD2 A ASP 54 ? ? 1.60 
2  4  OD1 A ASP 16 ? ? HZ1 A LYS 19 ? ? 1.56 
3  4  HZ1 A LYS 30 ? ? OD2 A ASP 54 ? ? 1.58 
4  4  HZ3 A LYS 47 ? ? OD2 A ASP 62 ? ? 1.59 
5  5  HZ3 A LYS 47 ? ? OD2 A ASP 62 ? ? 1.60 
6  7  HZ1 A LYS 47 ? ? OD2 A ASP 62 ? ? 1.57 
7  9  HB  A VAL 52 ? ? HG3 A GLU 56 ? ? 1.20 
8  9  HZ2 A LYS 9  ? ? OD1 A ASP 60 ? ? 1.59 
9  11 HZ3 A LYS 47 ? ? O   A GLU 57 ? ? 1.59 
10 15 HZ3 A LYS 47 ? ? O   A GLU 57 ? ? 1.60 
11 16 OD2 A ASP 16 ? ? HZ1 A LYS 19 ? ? 1.57 
12 20 HZ1 A LYS 9  ? ? OE1 A GLU 22 ? ? 1.59 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  GLU A 37 ? ? 40.27   70.12   
2  3  GLU A 37 ? ? 54.58   73.01   
3  3  ASN A 48 ? ? 68.02   -73.89  
4  4  THR A 14 ? ? -129.07 -157.73 
5  4  GLU A 37 ? ? 59.95   77.63   
6  4  ASN A 48 ? ? 66.88   -32.54  
7  5  ASN A 48 ? ? 68.94   -66.06  
8  6  THR A 14 ? ? -127.92 -162.05 
9  6  GLU A 37 ? ? 58.97   77.77   
10 6  ASN A 48 ? ? 71.08   -53.24  
11 8  THR A 14 ? ? -129.15 -163.03 
12 8  GLU A 37 ? ? 62.23   75.18   
13 8  ASN A 48 ? ? 65.49   -1.01   
14 10 TYR A 71 ? ? 78.63   -5.73   
15 13 ASN A 48 ? ? 71.65   -61.30  
16 14 PRO A 39 ? ? -59.93  92.03   
17 14 ASN A 48 ? ? 58.54   19.70   
18 16 TYR A 71 ? ? -151.05 -70.22  
19 17 GLU A 37 ? ? 59.21   75.66   
20 17 PRO A 39 ? ? -58.61  90.46   
21 18 PRO A 39 ? ? -60.59  98.57   
22 19 PRO A 39 ? ? -65.87  65.39   
23 20 GLU A 37 ? ? 54.85   80.98   
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'PSI, Protein Structure Initiative' 
_pdbx_SG_project.full_name_of_center   'Northeast Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     NESG 
# 
_pdbx_nmr_ensemble.entry_id                                      1RYJ 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1RYJ 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1mM mth1743, 450 mM NaCl, 25 mM Na2PO4, 1mM Benzamidine, 1xinhibitor cooktail, 0.01% NaN3, pH 6.5' 
_pdbx_nmr_sample_details.solvent_system   '95% H2O/5% D2O' 
# 
_pdbx_nmr_exptl.experiment_id   1 
_pdbx_nmr_exptl.solution_id     1 
_pdbx_nmr_exptl.conditions_id   1 
_pdbx_nmr_exptl.type            '3D 13C,15N-simultaneous NOESY' 
# 
_pdbx_nmr_refine.entry_id           1RYJ 
_pdbx_nmr_refine.method             
;torsion angle dyanmics  
simulated annealing 
restrained molecular dynamic simulations
;
_pdbx_nmr_refine.details            '1496 NOE-derived distance constraints, 103 dihedral angle constraints, 34 hydrogen bonds' 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
NMRPipe 2.1 processing           'Delaglio, F.' 1 
DYANA   1.5 'structure solution' Gunter,P.      2 
CNS     1.0 refinement           ?              3 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
GLN N    N N N 74  
GLN CA   C N S 75  
GLN C    C N N 76  
GLN O    O N N 77  
GLN CB   C N N 78  
GLN CG   C N N 79  
GLN CD   C N N 80  
GLN OE1  O N N 81  
GLN NE2  N N N 82  
GLN OXT  O N N 83  
GLN H    H N N 84  
GLN H2   H N N 85  
GLN HA   H N N 86  
GLN HB2  H N N 87  
GLN HB3  H N N 88  
GLN HG2  H N N 89  
GLN HG3  H N N 90  
GLN HE21 H N N 91  
GLN HE22 H N N 92  
GLN HXT  H N N 93  
GLU N    N N N 94  
GLU CA   C N S 95  
GLU C    C N N 96  
GLU O    O N N 97  
GLU CB   C N N 98  
GLU CG   C N N 99  
GLU CD   C N N 100 
GLU OE1  O N N 101 
GLU OE2  O N N 102 
GLU OXT  O N N 103 
GLU H    H N N 104 
GLU H2   H N N 105 
GLU HA   H N N 106 
GLU HB2  H N N 107 
GLU HB3  H N N 108 
GLU HG2  H N N 109 
GLU HG3  H N N 110 
GLU HE2  H N N 111 
GLU HXT  H N N 112 
GLY N    N N N 113 
GLY CA   C N N 114 
GLY C    C N N 115 
GLY O    O N N 116 
GLY OXT  O N N 117 
GLY H    H N N 118 
GLY H2   H N N 119 
GLY HA2  H N N 120 
GLY HA3  H N N 121 
GLY HXT  H N N 122 
ILE N    N N N 123 
ILE CA   C N S 124 
ILE C    C N N 125 
ILE O    O N N 126 
ILE CB   C N S 127 
ILE CG1  C N N 128 
ILE CG2  C N N 129 
ILE CD1  C N N 130 
ILE OXT  O N N 131 
ILE H    H N N 132 
ILE H2   H N N 133 
ILE HA   H N N 134 
ILE HB   H N N 135 
ILE HG12 H N N 136 
ILE HG13 H N N 137 
ILE HG21 H N N 138 
ILE HG22 H N N 139 
ILE HG23 H N N 140 
ILE HD11 H N N 141 
ILE HD12 H N N 142 
ILE HD13 H N N 143 
ILE HXT  H N N 144 
LEU N    N N N 145 
LEU CA   C N S 146 
LEU C    C N N 147 
LEU O    O N N 148 
LEU CB   C N N 149 
LEU CG   C N N 150 
LEU CD1  C N N 151 
LEU CD2  C N N 152 
LEU OXT  O N N 153 
LEU H    H N N 154 
LEU H2   H N N 155 
LEU HA   H N N 156 
LEU HB2  H N N 157 
LEU HB3  H N N 158 
LEU HG   H N N 159 
LEU HD11 H N N 160 
LEU HD12 H N N 161 
LEU HD13 H N N 162 
LEU HD21 H N N 163 
LEU HD22 H N N 164 
LEU HD23 H N N 165 
LEU HXT  H N N 166 
LYS N    N N N 167 
LYS CA   C N S 168 
LYS C    C N N 169 
LYS O    O N N 170 
LYS CB   C N N 171 
LYS CG   C N N 172 
LYS CD   C N N 173 
LYS CE   C N N 174 
LYS NZ   N N N 175 
LYS OXT  O N N 176 
LYS H    H N N 177 
LYS H2   H N N 178 
LYS HA   H N N 179 
LYS HB2  H N N 180 
LYS HB3  H N N 181 
LYS HG2  H N N 182 
LYS HG3  H N N 183 
LYS HD2  H N N 184 
LYS HD3  H N N 185 
LYS HE2  H N N 186 
LYS HE3  H N N 187 
LYS HZ1  H N N 188 
LYS HZ2  H N N 189 
LYS HZ3  H N N 190 
LYS HXT  H N N 191 
MET N    N N N 192 
MET CA   C N S 193 
MET C    C N N 194 
MET O    O N N 195 
MET CB   C N N 196 
MET CG   C N N 197 
MET SD   S N N 198 
MET CE   C N N 199 
MET OXT  O N N 200 
MET H    H N N 201 
MET H2   H N N 202 
MET HA   H N N 203 
MET HB2  H N N 204 
MET HB3  H N N 205 
MET HG2  H N N 206 
MET HG3  H N N 207 
MET HE1  H N N 208 
MET HE2  H N N 209 
MET HE3  H N N 210 
MET HXT  H N N 211 
PHE N    N N N 212 
PHE CA   C N S 213 
PHE C    C N N 214 
PHE O    O N N 215 
PHE CB   C N N 216 
PHE CG   C Y N 217 
PHE CD1  C Y N 218 
PHE CD2  C Y N 219 
PHE CE1  C Y N 220 
PHE CE2  C Y N 221 
PHE CZ   C Y N 222 
PHE OXT  O N N 223 
PHE H    H N N 224 
PHE H2   H N N 225 
PHE HA   H N N 226 
PHE HB2  H N N 227 
PHE HB3  H N N 228 
PHE HD1  H N N 229 
PHE HD2  H N N 230 
PHE HE1  H N N 231 
PHE HE2  H N N 232 
PHE HZ   H N N 233 
PHE HXT  H N N 234 
PRO N    N N N 235 
PRO CA   C N S 236 
PRO C    C N N 237 
PRO O    O N N 238 
PRO CB   C N N 239 
PRO CG   C N N 240 
PRO CD   C N N 241 
PRO OXT  O N N 242 
PRO H    H N N 243 
PRO HA   H N N 244 
PRO HB2  H N N 245 
PRO HB3  H N N 246 
PRO HG2  H N N 247 
PRO HG3  H N N 248 
PRO HD2  H N N 249 
PRO HD3  H N N 250 
PRO HXT  H N N 251 
SER N    N N N 252 
SER CA   C N S 253 
SER C    C N N 254 
SER O    O N N 255 
SER CB   C N N 256 
SER OG   O N N 257 
SER OXT  O N N 258 
SER H    H N N 259 
SER H2   H N N 260 
SER HA   H N N 261 
SER HB2  H N N 262 
SER HB3  H N N 263 
SER HG   H N N 264 
SER HXT  H N N 265 
THR N    N N N 266 
THR CA   C N S 267 
THR C    C N N 268 
THR O    O N N 269 
THR CB   C N R 270 
THR OG1  O N N 271 
THR CG2  C N N 272 
THR OXT  O N N 273 
THR H    H N N 274 
THR H2   H N N 275 
THR HA   H N N 276 
THR HB   H N N 277 
THR HG1  H N N 278 
THR HG21 H N N 279 
THR HG22 H N N 280 
THR HG23 H N N 281 
THR HXT  H N N 282 
TYR N    N N N 283 
TYR CA   C N S 284 
TYR C    C N N 285 
TYR O    O N N 286 
TYR CB   C N N 287 
TYR CG   C Y N 288 
TYR CD1  C Y N 289 
TYR CD2  C Y N 290 
TYR CE1  C Y N 291 
TYR CE2  C Y N 292 
TYR CZ   C Y N 293 
TYR OH   O N N 294 
TYR OXT  O N N 295 
TYR H    H N N 296 
TYR H2   H N N 297 
TYR HA   H N N 298 
TYR HB2  H N N 299 
TYR HB3  H N N 300 
TYR HD1  H N N 301 
TYR HD2  H N N 302 
TYR HE1  H N N 303 
TYR HE2  H N N 304 
TYR HH   H N N 305 
TYR HXT  H N N 306 
VAL N    N N N 307 
VAL CA   C N S 308 
VAL C    C N N 309 
VAL O    O N N 310 
VAL CB   C N N 311 
VAL CG1  C N N 312 
VAL CG2  C N N 313 
VAL OXT  O N N 314 
VAL H    H N N 315 
VAL H2   H N N 316 
VAL HA   H N N 317 
VAL HB   H N N 318 
VAL HG11 H N N 319 
VAL HG12 H N N 320 
VAL HG13 H N N 321 
VAL HG21 H N N 322 
VAL HG22 H N N 323 
VAL HG23 H N N 324 
VAL HXT  H N N 325 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
ILE N   CA   sing N N 116 
ILE N   H    sing N N 117 
ILE N   H2   sing N N 118 
ILE CA  C    sing N N 119 
ILE CA  CB   sing N N 120 
ILE CA  HA   sing N N 121 
ILE C   O    doub N N 122 
ILE C   OXT  sing N N 123 
ILE CB  CG1  sing N N 124 
ILE CB  CG2  sing N N 125 
ILE CB  HB   sing N N 126 
ILE CG1 CD1  sing N N 127 
ILE CG1 HG12 sing N N 128 
ILE CG1 HG13 sing N N 129 
ILE CG2 HG21 sing N N 130 
ILE CG2 HG22 sing N N 131 
ILE CG2 HG23 sing N N 132 
ILE CD1 HD11 sing N N 133 
ILE CD1 HD12 sing N N 134 
ILE CD1 HD13 sing N N 135 
ILE OXT HXT  sing N N 136 
LEU N   CA   sing N N 137 
LEU N   H    sing N N 138 
LEU N   H2   sing N N 139 
LEU CA  C    sing N N 140 
LEU CA  CB   sing N N 141 
LEU CA  HA   sing N N 142 
LEU C   O    doub N N 143 
LEU C   OXT  sing N N 144 
LEU CB  CG   sing N N 145 
LEU CB  HB2  sing N N 146 
LEU CB  HB3  sing N N 147 
LEU CG  CD1  sing N N 148 
LEU CG  CD2  sing N N 149 
LEU CG  HG   sing N N 150 
LEU CD1 HD11 sing N N 151 
LEU CD1 HD12 sing N N 152 
LEU CD1 HD13 sing N N 153 
LEU CD2 HD21 sing N N 154 
LEU CD2 HD22 sing N N 155 
LEU CD2 HD23 sing N N 156 
LEU OXT HXT  sing N N 157 
LYS N   CA   sing N N 158 
LYS N   H    sing N N 159 
LYS N   H2   sing N N 160 
LYS CA  C    sing N N 161 
LYS CA  CB   sing N N 162 
LYS CA  HA   sing N N 163 
LYS C   O    doub N N 164 
LYS C   OXT  sing N N 165 
LYS CB  CG   sing N N 166 
LYS CB  HB2  sing N N 167 
LYS CB  HB3  sing N N 168 
LYS CG  CD   sing N N 169 
LYS CG  HG2  sing N N 170 
LYS CG  HG3  sing N N 171 
LYS CD  CE   sing N N 172 
LYS CD  HD2  sing N N 173 
LYS CD  HD3  sing N N 174 
LYS CE  NZ   sing N N 175 
LYS CE  HE2  sing N N 176 
LYS CE  HE3  sing N N 177 
LYS NZ  HZ1  sing N N 178 
LYS NZ  HZ2  sing N N 179 
LYS NZ  HZ3  sing N N 180 
LYS OXT HXT  sing N N 181 
MET N   CA   sing N N 182 
MET N   H    sing N N 183 
MET N   H2   sing N N 184 
MET CA  C    sing N N 185 
MET CA  CB   sing N N 186 
MET CA  HA   sing N N 187 
MET C   O    doub N N 188 
MET C   OXT  sing N N 189 
MET CB  CG   sing N N 190 
MET CB  HB2  sing N N 191 
MET CB  HB3  sing N N 192 
MET CG  SD   sing N N 193 
MET CG  HG2  sing N N 194 
MET CG  HG3  sing N N 195 
MET SD  CE   sing N N 196 
MET CE  HE1  sing N N 197 
MET CE  HE2  sing N N 198 
MET CE  HE3  sing N N 199 
MET OXT HXT  sing N N 200 
PHE N   CA   sing N N 201 
PHE N   H    sing N N 202 
PHE N   H2   sing N N 203 
PHE CA  C    sing N N 204 
PHE CA  CB   sing N N 205 
PHE CA  HA   sing N N 206 
PHE C   O    doub N N 207 
PHE C   OXT  sing N N 208 
PHE CB  CG   sing N N 209 
PHE CB  HB2  sing N N 210 
PHE CB  HB3  sing N N 211 
PHE CG  CD1  doub Y N 212 
PHE CG  CD2  sing Y N 213 
PHE CD1 CE1  sing Y N 214 
PHE CD1 HD1  sing N N 215 
PHE CD2 CE2  doub Y N 216 
PHE CD2 HD2  sing N N 217 
PHE CE1 CZ   doub Y N 218 
PHE CE1 HE1  sing N N 219 
PHE CE2 CZ   sing Y N 220 
PHE CE2 HE2  sing N N 221 
PHE CZ  HZ   sing N N 222 
PHE OXT HXT  sing N N 223 
PRO N   CA   sing N N 224 
PRO N   CD   sing N N 225 
PRO N   H    sing N N 226 
PRO CA  C    sing N N 227 
PRO CA  CB   sing N N 228 
PRO CA  HA   sing N N 229 
PRO C   O    doub N N 230 
PRO C   OXT  sing N N 231 
PRO CB  CG   sing N N 232 
PRO CB  HB2  sing N N 233 
PRO CB  HB3  sing N N 234 
PRO CG  CD   sing N N 235 
PRO CG  HG2  sing N N 236 
PRO CG  HG3  sing N N 237 
PRO CD  HD2  sing N N 238 
PRO CD  HD3  sing N N 239 
PRO OXT HXT  sing N N 240 
SER N   CA   sing N N 241 
SER N   H    sing N N 242 
SER N   H2   sing N N 243 
SER CA  C    sing N N 244 
SER CA  CB   sing N N 245 
SER CA  HA   sing N N 246 
SER C   O    doub N N 247 
SER C   OXT  sing N N 248 
SER CB  OG   sing N N 249 
SER CB  HB2  sing N N 250 
SER CB  HB3  sing N N 251 
SER OG  HG   sing N N 252 
SER OXT HXT  sing N N 253 
THR N   CA   sing N N 254 
THR N   H    sing N N 255 
THR N   H2   sing N N 256 
THR CA  C    sing N N 257 
THR CA  CB   sing N N 258 
THR CA  HA   sing N N 259 
THR C   O    doub N N 260 
THR C   OXT  sing N N 261 
THR CB  OG1  sing N N 262 
THR CB  CG2  sing N N 263 
THR CB  HB   sing N N 264 
THR OG1 HG1  sing N N 265 
THR CG2 HG21 sing N N 266 
THR CG2 HG22 sing N N 267 
THR CG2 HG23 sing N N 268 
THR OXT HXT  sing N N 269 
TYR N   CA   sing N N 270 
TYR N   H    sing N N 271 
TYR N   H2   sing N N 272 
TYR CA  C    sing N N 273 
TYR CA  CB   sing N N 274 
TYR CA  HA   sing N N 275 
TYR C   O    doub N N 276 
TYR C   OXT  sing N N 277 
TYR CB  CG   sing N N 278 
TYR CB  HB2  sing N N 279 
TYR CB  HB3  sing N N 280 
TYR CG  CD1  doub Y N 281 
TYR CG  CD2  sing Y N 282 
TYR CD1 CE1  sing Y N 283 
TYR CD1 HD1  sing N N 284 
TYR CD2 CE2  doub Y N 285 
TYR CD2 HD2  sing N N 286 
TYR CE1 CZ   doub Y N 287 
TYR CE1 HE1  sing N N 288 
TYR CE2 CZ   sing Y N 289 
TYR CE2 HE2  sing N N 290 
TYR CZ  OH   sing N N 291 
TYR OH  HH   sing N N 292 
TYR OXT HXT  sing N N 293 
VAL N   CA   sing N N 294 
VAL N   H    sing N N 295 
VAL N   H2   sing N N 296 
VAL CA  C    sing N N 297 
VAL CA  CB   sing N N 298 
VAL CA  HA   sing N N 299 
VAL C   O    doub N N 300 
VAL C   OXT  sing N N 301 
VAL CB  CG1  sing N N 302 
VAL CB  CG2  sing N N 303 
VAL CB  HB   sing N N 304 
VAL CG1 HG11 sing N N 305 
VAL CG1 HG12 sing N N 306 
VAL CG1 HG13 sing N N 307 
VAL CG2 HG21 sing N N 308 
VAL CG2 HG22 sing N N 309 
VAL CG2 HG23 sing N N 310 
VAL OXT HXT  sing N N 311 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Varian INOVA 600 
2 ? Varian INOVA 500 
# 
_atom_sites.entry_id                    1RYJ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_