data_1S04
# 
_entry.id   1S04 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.391 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1S04         pdb_00001s04 10.2210/pdb1s04/pdb 
RCSB  RCSB021198   ?            ?                   
WWPDB D_1000021198 ?            ?                   
BMRB  6045         ?            10.13018/BMR6045    
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-01-04 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-02-05 
5 'Structure model' 1 4 2024-05-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 4 'Structure model' Other                       
7 5 'Structure model' 'Data collection'           
8 5 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2            
2 4 'Structure model' pdbx_database_related 
3 4 'Structure model' pdbx_database_status  
4 4 'Structure model' pdbx_nmr_software     
5 4 'Structure model' pdbx_struct_assembly  
6 4 'Structure model' pdbx_struct_oper_list 
7 5 'Structure model' chem_comp_atom        
8 5 'Structure model' chem_comp_bond        
9 5 'Structure model' database_2            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_pdbx_database_related.db_name'       
2 4 'Structure model' '_pdbx_database_status.status_code_cs' 
3 4 'Structure model' '_pdbx_nmr_software.name'              
4 5 'Structure model' '_database_2.pdbx_DOI'                 
5 5 'Structure model' '_database_2.pdbx_database_accession'  
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1S04 
_pdbx_database_status.recvd_initial_deposition_date   2003-12-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
BMRB     6045  'Chemical Shifts and Structural Constraints' unspecified 
TargetDB PfR13 .                                            unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'liu, G.'                                         1 
'Xiao, R.'                                        2 
'Sukumaran, D.K.'                                 3 
'Acton, T.'                                       4 
'Montelione, G.T.'                                5 
'Szyperski, T.'                                   6 
'Northeast Structural Genomics Consortium (NESG)' 7 
# 
_citation.id                        primary 
_citation.title                     
;Solution Structure Of The Hypothetical Protein PF0455 From Pyrococcus furiosus: Northeast Structural Genomics Consortium Target PfR13
;
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'liu, G.'          1 ? 
primary 'Xiao, R.'         2 ? 
primary 'Sukumaran, D.K.'  3 ? 
primary 'Acton, T.'        4 ? 
primary 'Montelione, G.T.' 5 ? 
primary 'Szyperski, T.'    6 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'hypothetical protein PF0455' 
_entity.formula_weight             13179.319 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MEWEMGLQEEFLELIKLRKKKIEGRLYDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIE
EGIQVYRRFYDEEKEKKYGVVAIEIEPLEY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MEWEMGLQEEFLELIKLRKKKIEGRLYDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIE
EGIQVYRRFYDEEKEKKYGVVAIEIEPLEY
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         PfR13 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   TRP n 
1 4   GLU n 
1 5   MET n 
1 6   GLY n 
1 7   LEU n 
1 8   GLN n 
1 9   GLU n 
1 10  GLU n 
1 11  PHE n 
1 12  LEU n 
1 13  GLU n 
1 14  LEU n 
1 15  ILE n 
1 16  LYS n 
1 17  LEU n 
1 18  ARG n 
1 19  LYS n 
1 20  LYS n 
1 21  LYS n 
1 22  ILE n 
1 23  GLU n 
1 24  GLY n 
1 25  ARG n 
1 26  LEU n 
1 27  TYR n 
1 28  ASP n 
1 29  GLU n 
1 30  LYS n 
1 31  ARG n 
1 32  ARG n 
1 33  GLN n 
1 34  ILE n 
1 35  LYS n 
1 36  PRO n 
1 37  GLY n 
1 38  ASP n 
1 39  VAL n 
1 40  ILE n 
1 41  SER n 
1 42  PHE n 
1 43  GLU n 
1 44  GLY n 
1 45  GLY n 
1 46  LYS n 
1 47  LEU n 
1 48  LYS n 
1 49  VAL n 
1 50  ARG n 
1 51  VAL n 
1 52  LYS n 
1 53  ALA n 
1 54  ILE n 
1 55  ARG n 
1 56  VAL n 
1 57  TYR n 
1 58  ASN n 
1 59  SER n 
1 60  PHE n 
1 61  ARG n 
1 62  GLU n 
1 63  MET n 
1 64  LEU n 
1 65  GLU n 
1 66  LYS n 
1 67  GLU n 
1 68  GLY n 
1 69  LEU n 
1 70  GLU n 
1 71  ASN n 
1 72  VAL n 
1 73  LEU n 
1 74  PRO n 
1 75  GLY n 
1 76  VAL n 
1 77  LYS n 
1 78  SER n 
1 79  ILE n 
1 80  GLU n 
1 81  GLU n 
1 82  GLY n 
1 83  ILE n 
1 84  GLN n 
1 85  VAL n 
1 86  TYR n 
1 87  ARG n 
1 88  ARG n 
1 89  PHE n 
1 90  TYR n 
1 91  ASP n 
1 92  GLU n 
1 93  GLU n 
1 94  LYS n 
1 95  GLU n 
1 96  LYS n 
1 97  LYS n 
1 98  TYR n 
1 99  GLY n 
1 100 VAL n 
1 101 VAL n 
1 102 ALA n 
1 103 ILE n 
1 104 GLU n 
1 105 ILE n 
1 106 GLU n 
1 107 PRO n 
1 108 LEU n 
1 109 GLU n 
1 110 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Pyrococcus 
_entity_src_gen.pdbx_gene_src_gene                 PF0455 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pyrococcus furiosus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2261 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pPfR13-21.2 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   TRP 3   3   3   TRP TRP A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   MET 5   5   5   MET MET A . n 
A 1 6   GLY 6   6   6   GLY GLY A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   GLN 8   8   8   GLN GLN A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  GLU 10  10  10  GLU GLU A . n 
A 1 11  PHE 11  11  11  PHE PHE A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  ILE 15  15  15  ILE ILE A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  ARG 25  25  25  ARG ARG A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  TYR 27  27  27  TYR TYR A . n 
A 1 28  ASP 28  28  28  ASP ASP A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  ARG 32  32  32  ARG ARG A . n 
A 1 33  GLN 33  33  33  GLN GLN A . n 
A 1 34  ILE 34  34  34  ILE ILE A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  ASP 38  38  38  ASP ASP A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  ILE 40  40  40  ILE ILE A . n 
A 1 41  SER 41  41  41  SER SER A . n 
A 1 42  PHE 42  42  42  PHE PHE A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  GLY 44  44  44  GLY GLY A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  ARG 50  50  50  ARG ARG A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  ALA 53  53  53  ALA ALA A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  TYR 57  57  57  TYR TYR A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  ARG 61  61  61  ARG ARG A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  MET 63  63  63  MET MET A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  GLU 70  70  70  GLU GLU A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  PRO 74  74  74  PRO PRO A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  ILE 79  79  79  ILE ILE A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  ILE 83  83  83  ILE ILE A . n 
A 1 84  GLN 84  84  84  GLN GLN A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  TYR 86  86  86  TYR TYR A . n 
A 1 87  ARG 87  87  87  ARG ARG A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  LYS 96  96  96  LYS LYS A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 GLU 106 106 106 GLU GLU A . n 
A 1 107 PRO 107 107 107 PRO PRO A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
# 
_cell.entry_id           1S04 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1S04 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_exptl.entry_id          1S04 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_database_PDB_matrix.entry_id          1S04 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1S04 
_struct.title                     
'Solution NMR Structure of Protein PF0455 from Pyrococcus furiosus. Northeast Structural Genomics Consortium Target PfR13' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1S04 
_struct_keywords.pdbx_keywords   'Structural genomics, unknown function' 
_struct_keywords.text            
;Structural genomics, PfR13, PF0455, Reduced-dimensionality, GFT, Northeast Structural Genomics Consortium, NESG, protein structure initiative, PSI, unknown function
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q8U3L1_PYRFU 
_struct_ref.pdbx_db_accession          Q8U3L1 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MEWEMGLQEEFLELIKLRKKKIEGRLYDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIE
EGIQVYRRFYDEEKEKKYGVVAIEIEPLEY
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1S04 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 110 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8U3L1 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  110 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       110 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 8  ? ARG A 18 ? GLN A 8  ARG A 18 1 ? 11 
HELX_P HELX_P2 2 ASP A 28 ? ILE A 34 ? ASP A 28 ILE A 34 1 ? 7  
HELX_P HELX_P3 3 SER A 59 ? GLU A 67 ? SER A 59 GLU A 67 1 ? 9  
HELX_P HELX_P4 4 SER A 78 ? TYR A 90 ? SER A 78 TYR A 90 1 ? 13 
HELX_P HELX_P5 5 ASP A 91 ? TYR A 98 ? ASP A 91 TYR A 98 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 3   ? MET A 5   ? TRP A 3   MET A 5   
A 2 ILE A 40  ? PHE A 42  ? ILE A 40  PHE A 42  
A 3 LEU A 47  ? ALA A 53  ? LEU A 47  ALA A 53  
A 4 GLU A 104 ? GLU A 106 ? GLU A 104 GLU A 106 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TRP A 3  ? N TRP A 3  O SER A 41  ? O SER A 41  
A 2 3 N ILE A 40 ? N ILE A 40 O VAL A 49  ? O VAL A 49  
A 3 4 N ALA A 53 ? N ALA A 53 O GLU A 104 ? O GLU A 104 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1  H   A ILE 40 ? ? O    A VAL 49  ? ? 1.55 
2  1  O   A PHE 60 ? ? H    A LEU 64  ? ? 1.57 
3  2  O   A TRP 3  ? ? H    A SER 41  ? ? 1.55 
4  2  O   A LEU 69 ? ? H    A LEU 73  ? ? 1.58 
5  3  O   A LEU 69 ? ? H    A LEU 73  ? ? 1.47 
6  4  HZ1 A LYS 16 ? ? OE1  A GLU 109 ? ? 1.58 
7  4  O   A TYR 86 ? ? H    A TYR 90  ? ? 1.59 
8  5  O   A GLU 67 ? ? HD21 A ASN 71  ? ? 1.52 
9  5  O   A GLU 92 ? ? H    A LYS 96  ? ? 1.60 
10 6  H   A LYS 52 ? ? O    A GLU 104 ? ? 1.52 
11 6  O   A GLU 62 ? ? H    A LYS 66  ? ? 1.59 
12 7  HH  A TYR 57 ? ? OE2  A GLU 67  ? ? 1.51 
13 7  O   A ARG 61 ? ? H    A GLU 65  ? ? 1.54 
14 8  O   A LEU 14 ? ? H    A ARG 18  ? ? 1.47 
15 8  O   A LEU 69 ? ? H    A LEU 73  ? ? 1.52 
16 10 O   A LEU 14 ? ? H    A ARG 18  ? ? 1.47 
17 10 O   A TRP 3  ? ? H    A SER 41  ? ? 1.51 
18 10 HG  A SER 41 ? ? O    A GLY 44  ? ? 1.57 
19 12 O   A TRP 3  ? ? H    A SER 41  ? ? 1.50 
20 12 O   A LEU 69 ? ? H    A LEU 73  ? ? 1.54 
21 12 H   A LYS 52 ? ? O    A GLU 104 ? ? 1.55 
22 13 O   A TRP 3  ? ? H    A SER 41  ? ? 1.52 
23 13 O   A LEU 69 ? ? H    A LEU 73  ? ? 1.58 
24 14 O   A LEU 69 ? ? H    A LEU 73  ? ? 1.55 
25 14 O   A GLU 92 ? ? H    A LYS 96  ? ? 1.56 
26 15 O   A LEU 14 ? ? H    A ARG 18  ? ? 1.52 
27 15 H   A ILE 40 ? ? O    A VAL 49  ? ? 1.53 
28 15 O   A LEU 69 ? ? H    A LEU 73  ? ? 1.54 
29 16 O   A LEU 14 ? ? H    A ARG 18  ? ? 1.47 
30 16 H   A MET 5  ? ? O    A SER 41  ? ? 1.50 
31 16 O   A LEU 69 ? ? H    A LEU 73  ? ? 1.55 
32 16 O   A TRP 3  ? ? H    A SER 41  ? ? 1.60 
33 17 O   A LEU 14 ? ? H    A ARG 18  ? ? 1.45 
34 17 H   A MET 5  ? ? O    A SER 41  ? ? 1.51 
35 18 O   A LEU 69 ? ? H    A LEU 73  ? ? 1.52 
36 18 H   A ILE 40 ? ? O    A VAL 49  ? ? 1.55 
37 19 O   A LEU 14 ? ? H    A ARG 18  ? ? 1.47 
38 19 H   A ILE 40 ? ? O    A VAL 49  ? ? 1.54 
39 19 O   A PHE 60 ? ? H    A LEU 64  ? ? 1.60 
40 20 O   A TRP 3  ? ? H    A SER 41  ? ? 1.50 
41 20 O   A LEU 69 ? ? H    A LEU 73  ? ? 1.56 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  LYS A 21  ? ? -125.70 -114.12 
2   1  ARG A 25  ? ? 158.46  104.59  
3   1  LEU A 26  ? ? -39.30  133.66  
4   1  ASP A 38  ? ? -164.88 -166.45 
5   1  VAL A 72  ? ? -133.99 -52.44  
6   1  VAL A 76  ? ? -39.43  148.73  
7   1  LEU A 108 ? ? -100.74 51.06   
8   2  LYS A 21  ? ? -123.04 -113.53 
9   2  ARG A 25  ? ? 171.64  114.50  
10  2  LEU A 26  ? ? -39.41  135.40  
11  2  TYR A 27  ? ? -69.24  89.98   
12  2  VAL A 72  ? ? -139.60 -48.05  
13  2  VAL A 76  ? ? -39.97  148.60  
14  2  GLU A 109 ? ? -126.24 -98.21  
15  3  LYS A 21  ? ? -124.54 -111.37 
16  3  ARG A 25  ? ? 161.01  129.24  
17  3  LEU A 26  ? ? -37.43  124.81  
18  3  ASP A 28  ? ? -178.52 -176.00 
19  3  ASP A 38  ? ? -164.33 -169.56 
20  3  VAL A 76  ? ? -39.82  152.05  
21  4  LYS A 21  ? ? -119.43 -115.27 
22  4  LEU A 26  ? ? -55.65  109.73  
23  4  TYR A 27  ? ? -45.75  173.37  
24  4  VAL A 72  ? ? -138.37 -53.98  
25  4  VAL A 76  ? ? -38.47  155.72  
26  5  MET A 5   ? ? -124.10 -159.26 
27  5  LYS A 21  ? ? -115.69 -116.24 
28  5  ARG A 25  ? ? 175.74  -178.36 
29  5  ASP A 28  ? ? -68.96  -176.57 
30  5  VAL A 72  ? ? -152.46 -56.49  
31  5  VAL A 76  ? ? -39.82  150.70  
32  5  GLU A 109 ? ? -130.14 -101.03 
33  6  LYS A 21  ? ? -118.77 -114.68 
34  6  ARG A 25  ? ? 158.91  121.43  
35  6  LEU A 26  ? ? -39.04  133.00  
36  6  ASP A 28  ? ? -101.19 -168.10 
37  6  GLU A 43  ? ? 39.14   40.19   
38  6  VAL A 72  ? ? -137.30 -58.20  
39  6  GLU A 109 ? ? -146.67 -104.85 
40  7  LYS A 21  ? ? -126.15 -115.23 
41  7  ARG A 25  ? ? 175.88  101.14  
42  7  LEU A 26  ? ? -38.56  141.41  
43  7  VAL A 72  ? ? -137.33 -58.78  
44  7  VAL A 76  ? ? -38.81  146.72  
45  7  GLU A 109 ? ? -69.40  -96.60  
46  8  LYS A 21  ? ? -126.23 -103.23 
47  8  ARG A 25  ? ? 170.27  110.09  
48  8  LEU A 26  ? ? -38.78  135.84  
49  8  VAL A 72  ? ? -134.93 -46.44  
50  8  VAL A 76  ? ? -39.51  152.95  
51  9  MET A 5   ? ? -174.08 105.38  
52  9  LYS A 21  ? ? -113.70 -111.78 
53  9  ARG A 25  ? ? 158.48  135.88  
54  9  ASP A 28  ? ? -70.46  -166.87 
55  9  ASP A 38  ? ? -67.45  -171.65 
56  9  VAL A 72  ? ? -136.18 -54.00  
57  9  VAL A 76  ? ? -39.50  153.13  
58  9  GLU A 109 ? ? -146.27 -142.98 
59  10 LEU A 7   ? ? -171.39 146.76  
60  10 LYS A 21  ? ? -128.85 -107.66 
61  10 ARG A 25  ? ? 161.24  100.99  
62  10 LEU A 26  ? ? -36.46  123.01  
63  10 GLU A 43  ? ? 38.04   40.30   
64  10 VAL A 72  ? ? -137.94 -49.62  
65  10 VAL A 76  ? ? -38.56  148.17  
66  10 LEU A 108 ? ? -59.00  87.30   
67  10 GLU A 109 ? ? -160.85 -145.97 
68  11 LYS A 21  ? ? -117.33 -112.19 
69  11 ILE A 22  ? ? -167.21 -167.12 
70  11 ARG A 25  ? ? 177.59  105.96  
71  11 LEU A 26  ? ? -39.12  153.06  
72  11 VAL A 72  ? ? -137.42 -50.19  
73  11 VAL A 76  ? ? -39.33  152.11  
74  11 GLU A 109 ? ? -121.60 -143.27 
75  12 LYS A 21  ? ? -115.05 -114.76 
76  12 ARG A 25  ? ? 177.08  145.89  
77  12 TYR A 27  ? ? -63.77  90.66   
78  12 VAL A 72  ? ? -139.76 -46.39  
79  12 VAL A 76  ? ? -39.79  149.25  
80  12 GLU A 106 ? ? -162.18 100.21  
81  12 GLU A 109 ? ? -133.58 -141.75 
82  13 LYS A 21  ? ? -125.42 -116.84 
83  13 ILE A 22  ? ? -145.67 -149.97 
84  13 ARG A 25  ? ? 160.27  115.14  
85  13 VAL A 72  ? ? -137.20 -51.15  
86  13 VAL A 76  ? ? -40.04  151.36  
87  14 LYS A 21  ? ? -120.46 -115.49 
88  14 ARG A 25  ? ? 176.09  120.88  
89  14 LEU A 26  ? ? -37.86  127.11  
90  14 ASP A 28  ? ? -104.36 -160.97 
91  14 VAL A 72  ? ? -140.27 -47.02  
92  14 VAL A 76  ? ? -39.07  149.58  
93  15 LEU A 7   ? ? -75.72  -113.75 
94  15 LYS A 21  ? ? -131.23 -105.57 
95  15 ARG A 25  ? ? 179.26  99.64   
96  15 LEU A 26  ? ? -37.22  143.76  
97  15 ASP A 28  ? ? -68.03  -179.23 
98  15 VAL A 72  ? ? -134.93 -46.83  
99  15 VAL A 76  ? ? -39.92  149.71  
100 15 LEU A 108 ? ? -101.51 58.39   
101 15 GLU A 109 ? ? -117.69 -142.73 
102 16 LYS A 21  ? ? -132.44 -104.03 
103 16 ARG A 25  ? ? 179.38  108.87  
104 16 LEU A 26  ? ? -36.94  132.60  
105 16 VAL A 72  ? ? -136.19 -52.61  
106 16 VAL A 76  ? ? -38.60  152.92  
107 16 GLU A 106 ? ? -160.78 102.62  
108 16 LEU A 108 ? ? -100.58 54.37   
109 17 LYS A 21  ? ? -129.76 -101.65 
110 17 ARG A 25  ? ? 159.43  117.96  
111 17 LEU A 26  ? ? -39.19  135.92  
112 17 ASP A 28  ? ? -102.52 -169.74 
113 17 VAL A 72  ? ? -146.80 -55.29  
114 17 VAL A 76  ? ? -38.93  150.36  
115 18 LEU A 7   ? ? -170.48 -179.12 
116 18 LYS A 21  ? ? -116.67 -113.55 
117 18 ARG A 25  ? ? 176.74  137.67  
118 18 LEU A 26  ? ? -37.46  111.23  
119 18 VAL A 72  ? ? -137.51 -51.77  
120 18 VAL A 76  ? ? -43.39  157.31  
121 18 TYR A 90  ? ? -116.26 -161.70 
122 18 GLU A 109 ? ? -149.52 20.23   
123 19 LYS A 21  ? ? -126.78 -107.12 
124 19 ARG A 25  ? ? 178.88  115.96  
125 19 LEU A 26  ? ? -37.23  133.63  
126 19 TYR A 27  ? ? -65.74  77.07   
127 19 ASP A 28  ? ? -71.25  -165.66 
128 19 VAL A 72  ? ? -138.07 -50.50  
129 19 VAL A 76  ? ? -38.37  148.83  
130 19 GLU A 109 ? ? -143.06 16.87   
131 20 LYS A 21  ? ? -116.67 -116.00 
132 20 ARG A 25  ? ? 169.67  117.65  
133 20 LEU A 26  ? ? -39.87  144.86  
134 20 VAL A 72  ? ? -137.66 -49.42  
135 20 VAL A 76  ? ? -38.30  152.18  
136 20 LEU A 108 ? ? -61.44  88.50   
137 20 GLU A 109 ? ? -162.24 -141.89 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'PSI, Protein Structure Initiative' 
_pdbx_SG_project.full_name_of_center   'Northeast Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     NESG 
# 
_pdbx_nmr_ensemble.entry_id                                      1S04 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1S04 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'fewest violations' 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'20 mM MES, 100 mM NaCl, 10 mM DTT, 5 mM CaCl2, 0.02% NaN3, 95% H2O/5% D2O, protein U-15N,13C' 
_pdbx_nmr_sample_details.solvent_system   '95% H2O/5% D2O' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY     
2 1 1 3D_15N-separated_NOESY     
3 1 1 HNHA                       
4 1 1 '3D RD HCCHCOSY'           
5 1 1 'GFT (4,3)D HNNCACBCA'     
6 1 1 'GFT (4,3)D HNN(CO)CACBCA' 
# 
_pdbx_nmr_refine.entry_id           1S04 
_pdbx_nmr_refine.method             'distance geometry, simulated annealing, torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
DYANA   1.5 refinement      Guntert  1 
XEASY   1.3 'data analysis' Bartels  2 
NMRPipe 1.0 processing      Delaglio 3 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
GLN N    N N N 74  
GLN CA   C N S 75  
GLN C    C N N 76  
GLN O    O N N 77  
GLN CB   C N N 78  
GLN CG   C N N 79  
GLN CD   C N N 80  
GLN OE1  O N N 81  
GLN NE2  N N N 82  
GLN OXT  O N N 83  
GLN H    H N N 84  
GLN H2   H N N 85  
GLN HA   H N N 86  
GLN HB2  H N N 87  
GLN HB3  H N N 88  
GLN HG2  H N N 89  
GLN HG3  H N N 90  
GLN HE21 H N N 91  
GLN HE22 H N N 92  
GLN HXT  H N N 93  
GLU N    N N N 94  
GLU CA   C N S 95  
GLU C    C N N 96  
GLU O    O N N 97  
GLU CB   C N N 98  
GLU CG   C N N 99  
GLU CD   C N N 100 
GLU OE1  O N N 101 
GLU OE2  O N N 102 
GLU OXT  O N N 103 
GLU H    H N N 104 
GLU H2   H N N 105 
GLU HA   H N N 106 
GLU HB2  H N N 107 
GLU HB3  H N N 108 
GLU HG2  H N N 109 
GLU HG3  H N N 110 
GLU HE2  H N N 111 
GLU HXT  H N N 112 
GLY N    N N N 113 
GLY CA   C N N 114 
GLY C    C N N 115 
GLY O    O N N 116 
GLY OXT  O N N 117 
GLY H    H N N 118 
GLY H2   H N N 119 
GLY HA2  H N N 120 
GLY HA3  H N N 121 
GLY HXT  H N N 122 
ILE N    N N N 123 
ILE CA   C N S 124 
ILE C    C N N 125 
ILE O    O N N 126 
ILE CB   C N S 127 
ILE CG1  C N N 128 
ILE CG2  C N N 129 
ILE CD1  C N N 130 
ILE OXT  O N N 131 
ILE H    H N N 132 
ILE H2   H N N 133 
ILE HA   H N N 134 
ILE HB   H N N 135 
ILE HG12 H N N 136 
ILE HG13 H N N 137 
ILE HG21 H N N 138 
ILE HG22 H N N 139 
ILE HG23 H N N 140 
ILE HD11 H N N 141 
ILE HD12 H N N 142 
ILE HD13 H N N 143 
ILE HXT  H N N 144 
LEU N    N N N 145 
LEU CA   C N S 146 
LEU C    C N N 147 
LEU O    O N N 148 
LEU CB   C N N 149 
LEU CG   C N N 150 
LEU CD1  C N N 151 
LEU CD2  C N N 152 
LEU OXT  O N N 153 
LEU H    H N N 154 
LEU H2   H N N 155 
LEU HA   H N N 156 
LEU HB2  H N N 157 
LEU HB3  H N N 158 
LEU HG   H N N 159 
LEU HD11 H N N 160 
LEU HD12 H N N 161 
LEU HD13 H N N 162 
LEU HD21 H N N 163 
LEU HD22 H N N 164 
LEU HD23 H N N 165 
LEU HXT  H N N 166 
LYS N    N N N 167 
LYS CA   C N S 168 
LYS C    C N N 169 
LYS O    O N N 170 
LYS CB   C N N 171 
LYS CG   C N N 172 
LYS CD   C N N 173 
LYS CE   C N N 174 
LYS NZ   N N N 175 
LYS OXT  O N N 176 
LYS H    H N N 177 
LYS H2   H N N 178 
LYS HA   H N N 179 
LYS HB2  H N N 180 
LYS HB3  H N N 181 
LYS HG2  H N N 182 
LYS HG3  H N N 183 
LYS HD2  H N N 184 
LYS HD3  H N N 185 
LYS HE2  H N N 186 
LYS HE3  H N N 187 
LYS HZ1  H N N 188 
LYS HZ2  H N N 189 
LYS HZ3  H N N 190 
LYS HXT  H N N 191 
MET N    N N N 192 
MET CA   C N S 193 
MET C    C N N 194 
MET O    O N N 195 
MET CB   C N N 196 
MET CG   C N N 197 
MET SD   S N N 198 
MET CE   C N N 199 
MET OXT  O N N 200 
MET H    H N N 201 
MET H2   H N N 202 
MET HA   H N N 203 
MET HB2  H N N 204 
MET HB3  H N N 205 
MET HG2  H N N 206 
MET HG3  H N N 207 
MET HE1  H N N 208 
MET HE2  H N N 209 
MET HE3  H N N 210 
MET HXT  H N N 211 
PHE N    N N N 212 
PHE CA   C N S 213 
PHE C    C N N 214 
PHE O    O N N 215 
PHE CB   C N N 216 
PHE CG   C Y N 217 
PHE CD1  C Y N 218 
PHE CD2  C Y N 219 
PHE CE1  C Y N 220 
PHE CE2  C Y N 221 
PHE CZ   C Y N 222 
PHE OXT  O N N 223 
PHE H    H N N 224 
PHE H2   H N N 225 
PHE HA   H N N 226 
PHE HB2  H N N 227 
PHE HB3  H N N 228 
PHE HD1  H N N 229 
PHE HD2  H N N 230 
PHE HE1  H N N 231 
PHE HE2  H N N 232 
PHE HZ   H N N 233 
PHE HXT  H N N 234 
PRO N    N N N 235 
PRO CA   C N S 236 
PRO C    C N N 237 
PRO O    O N N 238 
PRO CB   C N N 239 
PRO CG   C N N 240 
PRO CD   C N N 241 
PRO OXT  O N N 242 
PRO H    H N N 243 
PRO HA   H N N 244 
PRO HB2  H N N 245 
PRO HB3  H N N 246 
PRO HG2  H N N 247 
PRO HG3  H N N 248 
PRO HD2  H N N 249 
PRO HD3  H N N 250 
PRO HXT  H N N 251 
SER N    N N N 252 
SER CA   C N S 253 
SER C    C N N 254 
SER O    O N N 255 
SER CB   C N N 256 
SER OG   O N N 257 
SER OXT  O N N 258 
SER H    H N N 259 
SER H2   H N N 260 
SER HA   H N N 261 
SER HB2  H N N 262 
SER HB3  H N N 263 
SER HG   H N N 264 
SER HXT  H N N 265 
TRP N    N N N 266 
TRP CA   C N S 267 
TRP C    C N N 268 
TRP O    O N N 269 
TRP CB   C N N 270 
TRP CG   C Y N 271 
TRP CD1  C Y N 272 
TRP CD2  C Y N 273 
TRP NE1  N Y N 274 
TRP CE2  C Y N 275 
TRP CE3  C Y N 276 
TRP CZ2  C Y N 277 
TRP CZ3  C Y N 278 
TRP CH2  C Y N 279 
TRP OXT  O N N 280 
TRP H    H N N 281 
TRP H2   H N N 282 
TRP HA   H N N 283 
TRP HB2  H N N 284 
TRP HB3  H N N 285 
TRP HD1  H N N 286 
TRP HE1  H N N 287 
TRP HE3  H N N 288 
TRP HZ2  H N N 289 
TRP HZ3  H N N 290 
TRP HH2  H N N 291 
TRP HXT  H N N 292 
TYR N    N N N 293 
TYR CA   C N S 294 
TYR C    C N N 295 
TYR O    O N N 296 
TYR CB   C N N 297 
TYR CG   C Y N 298 
TYR CD1  C Y N 299 
TYR CD2  C Y N 300 
TYR CE1  C Y N 301 
TYR CE2  C Y N 302 
TYR CZ   C Y N 303 
TYR OH   O N N 304 
TYR OXT  O N N 305 
TYR H    H N N 306 
TYR H2   H N N 307 
TYR HA   H N N 308 
TYR HB2  H N N 309 
TYR HB3  H N N 310 
TYR HD1  H N N 311 
TYR HD2  H N N 312 
TYR HE1  H N N 313 
TYR HE2  H N N 314 
TYR HH   H N N 315 
TYR HXT  H N N 316 
VAL N    N N N 317 
VAL CA   C N S 318 
VAL C    C N N 319 
VAL O    O N N 320 
VAL CB   C N N 321 
VAL CG1  C N N 322 
VAL CG2  C N N 323 
VAL OXT  O N N 324 
VAL H    H N N 325 
VAL H2   H N N 326 
VAL HA   H N N 327 
VAL HB   H N N 328 
VAL HG11 H N N 329 
VAL HG12 H N N 330 
VAL HG13 H N N 331 
VAL HG21 H N N 332 
VAL HG22 H N N 333 
VAL HG23 H N N 334 
VAL HXT  H N N 335 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
ILE N   CA   sing N N 116 
ILE N   H    sing N N 117 
ILE N   H2   sing N N 118 
ILE CA  C    sing N N 119 
ILE CA  CB   sing N N 120 
ILE CA  HA   sing N N 121 
ILE C   O    doub N N 122 
ILE C   OXT  sing N N 123 
ILE CB  CG1  sing N N 124 
ILE CB  CG2  sing N N 125 
ILE CB  HB   sing N N 126 
ILE CG1 CD1  sing N N 127 
ILE CG1 HG12 sing N N 128 
ILE CG1 HG13 sing N N 129 
ILE CG2 HG21 sing N N 130 
ILE CG2 HG22 sing N N 131 
ILE CG2 HG23 sing N N 132 
ILE CD1 HD11 sing N N 133 
ILE CD1 HD12 sing N N 134 
ILE CD1 HD13 sing N N 135 
ILE OXT HXT  sing N N 136 
LEU N   CA   sing N N 137 
LEU N   H    sing N N 138 
LEU N   H2   sing N N 139 
LEU CA  C    sing N N 140 
LEU CA  CB   sing N N 141 
LEU CA  HA   sing N N 142 
LEU C   O    doub N N 143 
LEU C   OXT  sing N N 144 
LEU CB  CG   sing N N 145 
LEU CB  HB2  sing N N 146 
LEU CB  HB3  sing N N 147 
LEU CG  CD1  sing N N 148 
LEU CG  CD2  sing N N 149 
LEU CG  HG   sing N N 150 
LEU CD1 HD11 sing N N 151 
LEU CD1 HD12 sing N N 152 
LEU CD1 HD13 sing N N 153 
LEU CD2 HD21 sing N N 154 
LEU CD2 HD22 sing N N 155 
LEU CD2 HD23 sing N N 156 
LEU OXT HXT  sing N N 157 
LYS N   CA   sing N N 158 
LYS N   H    sing N N 159 
LYS N   H2   sing N N 160 
LYS CA  C    sing N N 161 
LYS CA  CB   sing N N 162 
LYS CA  HA   sing N N 163 
LYS C   O    doub N N 164 
LYS C   OXT  sing N N 165 
LYS CB  CG   sing N N 166 
LYS CB  HB2  sing N N 167 
LYS CB  HB3  sing N N 168 
LYS CG  CD   sing N N 169 
LYS CG  HG2  sing N N 170 
LYS CG  HG3  sing N N 171 
LYS CD  CE   sing N N 172 
LYS CD  HD2  sing N N 173 
LYS CD  HD3  sing N N 174 
LYS CE  NZ   sing N N 175 
LYS CE  HE2  sing N N 176 
LYS CE  HE3  sing N N 177 
LYS NZ  HZ1  sing N N 178 
LYS NZ  HZ2  sing N N 179 
LYS NZ  HZ3  sing N N 180 
LYS OXT HXT  sing N N 181 
MET N   CA   sing N N 182 
MET N   H    sing N N 183 
MET N   H2   sing N N 184 
MET CA  C    sing N N 185 
MET CA  CB   sing N N 186 
MET CA  HA   sing N N 187 
MET C   O    doub N N 188 
MET C   OXT  sing N N 189 
MET CB  CG   sing N N 190 
MET CB  HB2  sing N N 191 
MET CB  HB3  sing N N 192 
MET CG  SD   sing N N 193 
MET CG  HG2  sing N N 194 
MET CG  HG3  sing N N 195 
MET SD  CE   sing N N 196 
MET CE  HE1  sing N N 197 
MET CE  HE2  sing N N 198 
MET CE  HE3  sing N N 199 
MET OXT HXT  sing N N 200 
PHE N   CA   sing N N 201 
PHE N   H    sing N N 202 
PHE N   H2   sing N N 203 
PHE CA  C    sing N N 204 
PHE CA  CB   sing N N 205 
PHE CA  HA   sing N N 206 
PHE C   O    doub N N 207 
PHE C   OXT  sing N N 208 
PHE CB  CG   sing N N 209 
PHE CB  HB2  sing N N 210 
PHE CB  HB3  sing N N 211 
PHE CG  CD1  doub Y N 212 
PHE CG  CD2  sing Y N 213 
PHE CD1 CE1  sing Y N 214 
PHE CD1 HD1  sing N N 215 
PHE CD2 CE2  doub Y N 216 
PHE CD2 HD2  sing N N 217 
PHE CE1 CZ   doub Y N 218 
PHE CE1 HE1  sing N N 219 
PHE CE2 CZ   sing Y N 220 
PHE CE2 HE2  sing N N 221 
PHE CZ  HZ   sing N N 222 
PHE OXT HXT  sing N N 223 
PRO N   CA   sing N N 224 
PRO N   CD   sing N N 225 
PRO N   H    sing N N 226 
PRO CA  C    sing N N 227 
PRO CA  CB   sing N N 228 
PRO CA  HA   sing N N 229 
PRO C   O    doub N N 230 
PRO C   OXT  sing N N 231 
PRO CB  CG   sing N N 232 
PRO CB  HB2  sing N N 233 
PRO CB  HB3  sing N N 234 
PRO CG  CD   sing N N 235 
PRO CG  HG2  sing N N 236 
PRO CG  HG3  sing N N 237 
PRO CD  HD2  sing N N 238 
PRO CD  HD3  sing N N 239 
PRO OXT HXT  sing N N 240 
SER N   CA   sing N N 241 
SER N   H    sing N N 242 
SER N   H2   sing N N 243 
SER CA  C    sing N N 244 
SER CA  CB   sing N N 245 
SER CA  HA   sing N N 246 
SER C   O    doub N N 247 
SER C   OXT  sing N N 248 
SER CB  OG   sing N N 249 
SER CB  HB2  sing N N 250 
SER CB  HB3  sing N N 251 
SER OG  HG   sing N N 252 
SER OXT HXT  sing N N 253 
TRP N   CA   sing N N 254 
TRP N   H    sing N N 255 
TRP N   H2   sing N N 256 
TRP CA  C    sing N N 257 
TRP CA  CB   sing N N 258 
TRP CA  HA   sing N N 259 
TRP C   O    doub N N 260 
TRP C   OXT  sing N N 261 
TRP CB  CG   sing N N 262 
TRP CB  HB2  sing N N 263 
TRP CB  HB3  sing N N 264 
TRP CG  CD1  doub Y N 265 
TRP CG  CD2  sing Y N 266 
TRP CD1 NE1  sing Y N 267 
TRP CD1 HD1  sing N N 268 
TRP CD2 CE2  doub Y N 269 
TRP CD2 CE3  sing Y N 270 
TRP NE1 CE2  sing Y N 271 
TRP NE1 HE1  sing N N 272 
TRP CE2 CZ2  sing Y N 273 
TRP CE3 CZ3  doub Y N 274 
TRP CE3 HE3  sing N N 275 
TRP CZ2 CH2  doub Y N 276 
TRP CZ2 HZ2  sing N N 277 
TRP CZ3 CH2  sing Y N 278 
TRP CZ3 HZ3  sing N N 279 
TRP CH2 HH2  sing N N 280 
TRP OXT HXT  sing N N 281 
TYR N   CA   sing N N 282 
TYR N   H    sing N N 283 
TYR N   H2   sing N N 284 
TYR CA  C    sing N N 285 
TYR CA  CB   sing N N 286 
TYR CA  HA   sing N N 287 
TYR C   O    doub N N 288 
TYR C   OXT  sing N N 289 
TYR CB  CG   sing N N 290 
TYR CB  HB2  sing N N 291 
TYR CB  HB3  sing N N 292 
TYR CG  CD1  doub Y N 293 
TYR CG  CD2  sing Y N 294 
TYR CD1 CE1  sing Y N 295 
TYR CD1 HD1  sing N N 296 
TYR CD2 CE2  doub Y N 297 
TYR CD2 HD2  sing N N 298 
TYR CE1 CZ   doub Y N 299 
TYR CE1 HE1  sing N N 300 
TYR CE2 CZ   sing Y N 301 
TYR CE2 HE2  sing N N 302 
TYR CZ  OH   sing N N 303 
TYR OH  HH   sing N N 304 
TYR OXT HXT  sing N N 305 
VAL N   CA   sing N N 306 
VAL N   H    sing N N 307 
VAL N   H2   sing N N 308 
VAL CA  C    sing N N 309 
VAL CA  CB   sing N N 310 
VAL CA  HA   sing N N 311 
VAL C   O    doub N N 312 
VAL C   OXT  sing N N 313 
VAL CB  CG1  sing N N 314 
VAL CB  CG2  sing N N 315 
VAL CB  HB   sing N N 316 
VAL CG1 HG11 sing N N 317 
VAL CG1 HG12 sing N N 318 
VAL CG1 HG13 sing N N 319 
VAL CG2 HG21 sing N N 320 
VAL CG2 HG22 sing N N 321 
VAL CG2 HG23 sing N N 322 
VAL OXT HXT  sing N N 323 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Varian INOVA 750 
2 ? Varian INOVA 600 
# 
_atom_sites.entry_id                    1S04 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_