data_1SJ6 # _entry.id 1SJ6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1SJ6 pdb_00001sj6 10.2210/pdb1sj6/pdb RCSB RCSB021751 ? ? WWPDB D_1000021751 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-03-22 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1SJ6 _pdbx_database_status.recvd_initial_deposition_date 2004-03-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xu, C.' 1 'Tang, Y.' 2 'Xu, Y.' 3 'Wu, J.' 4 'Shi, Y.' 5 'Zhang, Q.' 6 'Zheng, P.' 7 'Du, Y.' 8 # _citation.id primary _citation.title 'NMR structure and regulated expression in APL cell of human SH3BGRL3.' _citation.journal_abbrev 'Febs Lett.' _citation.journal_volume 579 _citation.page_first 2788 _citation.page_last 2794 _citation.year 2005 _citation.journal_id_ASTM FEBLAL _citation.country NE _citation.journal_id_ISSN 0014-5793 _citation.journal_id_CSD 0165 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15907482 _citation.pdbx_database_id_DOI 10.1016/j.febslet.2005.04.011 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, C.' 1 ? primary 'Zheng, P.' 2 ? primary 'Shen, S.' 3 ? primary 'Xu, Y.' 4 ? primary 'Wei, L.' 5 ? primary 'Gao, H.' 6 ? primary 'Wang, S.' 7 ? primary 'Zhu, C.' 8 ? primary 'Tang, Y.' 9 ? primary 'Wu, J.' 10 ? primary 'Zhang, Q.' 11 ? primary 'Shi, Y.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SH3 domain-binding glutamic acid-rich-like protein 3' _entity.formula_weight 11518.832 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SH3 domain-binding protein SH3BP-1, P1725, TNF inhibitory protein, SH3BGRL3-like protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEA VEQNTLQEFLKLALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEA VEQNTLQEFLKLALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLY n 1 4 LEU n 1 5 ARG n 1 6 VAL n 1 7 TYR n 1 8 SER n 1 9 THR n 1 10 SER n 1 11 VAL n 1 12 THR n 1 13 GLY n 1 14 SER n 1 15 ARG n 1 16 GLU n 1 17 ILE n 1 18 LYS n 1 19 SER n 1 20 GLN n 1 21 GLN n 1 22 SER n 1 23 GLU n 1 24 VAL n 1 25 THR n 1 26 ARG n 1 27 ILE n 1 28 LEU n 1 29 ASP n 1 30 GLY n 1 31 LYS n 1 32 ARG n 1 33 ILE n 1 34 GLN n 1 35 TYR n 1 36 GLN n 1 37 LEU n 1 38 VAL n 1 39 ASP n 1 40 ILE n 1 41 SER n 1 42 GLN n 1 43 ASP n 1 44 ASN n 1 45 ALA n 1 46 LEU n 1 47 ARG n 1 48 ASP n 1 49 GLU n 1 50 MET n 1 51 ARG n 1 52 ALA n 1 53 LEU n 1 54 ALA n 1 55 GLY n 1 56 ASN n 1 57 PRO n 1 58 LYS n 1 59 ALA n 1 60 THR n 1 61 PRO n 1 62 PRO n 1 63 GLN n 1 64 ILE n 1 65 VAL n 1 66 ASN n 1 67 GLY n 1 68 ASP n 1 69 GLN n 1 70 TYR n 1 71 CYS n 1 72 GLY n 1 73 ASP n 1 74 TYR n 1 75 GLU n 1 76 LEU n 1 77 PHE n 1 78 VAL n 1 79 GLU n 1 80 ALA n 1 81 VAL n 1 82 GLU n 1 83 GLN n 1 84 ASN n 1 85 THR n 1 86 LEU n 1 87 GLN n 1 88 GLU n 1 89 PHE n 1 90 LEU n 1 91 LYS n 1 92 LEU n 1 93 ALA n 1 94 LEU n 1 95 GLU n 1 96 HIS n 1 97 HIS n 1 98 HIS n 1 99 HIS n 1 100 HIS n 1 101 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene SHEBGRL3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PET22B(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 CYS 71 71 71 CYS CYS A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 HIS 96 96 ? ? ? A . n A 1 97 HIS 97 97 ? ? ? A . n A 1 98 HIS 98 98 ? ? ? A . n A 1 99 HIS 99 99 ? ? ? A . n A 1 100 HIS 100 100 ? ? ? A . n A 1 101 HIS 101 101 ? ? ? A . n # _cell.entry_id 1SJ6 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1SJ6 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1SJ6 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1SJ6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1SJ6 _struct.title 'NMR Structure and Regulated Expression in APL Cell of Human SH3BGRL3' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1SJ6 _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'thioredoxin, Nuclear protein, PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SH3L3_HUMAN _struct_ref.pdbx_db_accession Q9H299 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEA VEQNTLQEFLKLA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1SJ6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 93 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9H299 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 93 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 93 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1SJ6 LEU A 94 ? UNP Q9H299 ? ? 'expression tag' 94 1 1 1SJ6 GLU A 95 ? UNP Q9H299 ? ? 'expression tag' 95 2 1 1SJ6 HIS A 96 ? UNP Q9H299 ? ? 'expression tag' 96 3 1 1SJ6 HIS A 97 ? UNP Q9H299 ? ? 'expression tag' 97 4 1 1SJ6 HIS A 98 ? UNP Q9H299 ? ? 'expression tag' 98 5 1 1SJ6 HIS A 99 ? UNP Q9H299 ? ? 'expression tag' 99 6 1 1SJ6 HIS A 100 ? UNP Q9H299 ? ? 'expression tag' 100 7 1 1SJ6 HIS A 101 ? UNP Q9H299 ? ? 'expression tag' 101 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 16 ? LYS A 31 ? GLU A 16 LYS A 31 1 ? 16 HELX_P HELX_P2 2 ASP A 43 ? ALA A 54 ? ASP A 43 ALA A 54 1 ? 12 HELX_P HELX_P3 3 TYR A 74 ? GLU A 82 ? TYR A 74 GLU A 82 1 ? 9 HELX_P HELX_P4 4 THR A 85 ? LYS A 91 ? THR A 85 LYS A 91 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 36 ? ASP A 39 ? GLN A 36 ASP A 39 A 2 ARG A 5 ? SER A 8 ? ARG A 5 SER A 8 A 3 GLN A 63 ? VAL A 65 ? GLN A 63 VAL A 65 A 4 TYR A 70 ? ASP A 73 ? TYR A 70 ASP A 73 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 38 ? O VAL A 38 N VAL A 6 ? N VAL A 6 A 2 3 N ARG A 5 ? N ARG A 5 O VAL A 65 ? O VAL A 65 A 3 4 N ILE A 64 ? N ILE A 64 O GLY A 72 ? O GLY A 72 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A GLN 87 ? ? H A LEU 92 ? ? 1.59 2 8 O A GLN 87 ? ? H A LEU 92 ? ? 1.59 3 12 O A GLN 87 ? ? H A LEU 92 ? ? 1.58 4 19 O A GLN 87 ? ? H A LEU 92 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 12 ? ? 63.38 144.68 2 1 ASN A 56 ? ? 179.49 113.58 3 1 ALA A 59 ? ? -57.29 -166.16 4 1 ASN A 66 ? ? -109.55 78.92 5 1 ASP A 68 ? ? -148.02 37.06 6 1 LEU A 90 ? ? -96.35 -67.62 7 1 ALA A 93 ? ? 61.40 68.81 8 1 LEU A 94 ? ? -98.29 30.32 9 2 VAL A 11 ? ? -102.43 73.83 10 2 GLN A 34 ? ? -98.66 54.09 11 2 ASN A 56 ? ? 176.56 114.70 12 2 ALA A 59 ? ? -58.42 -162.80 13 2 ASP A 68 ? ? -161.24 28.54 14 2 LEU A 90 ? ? -100.10 -65.44 15 2 LEU A 92 ? ? 48.34 27.63 16 3 ASN A 56 ? ? 179.33 113.44 17 3 ALA A 59 ? ? -60.67 -165.41 18 3 PRO A 62 ? ? -67.35 86.82 19 3 ASN A 66 ? ? -105.64 78.90 20 3 ASP A 68 ? ? -145.28 41.05 21 3 ASP A 73 ? ? -160.04 -164.50 22 3 LEU A 86 ? ? -29.10 -42.85 23 3 LEU A 90 ? ? -95.11 -71.71 24 3 LEU A 92 ? ? 58.73 -80.35 25 3 ALA A 93 ? ? -168.39 -42.59 26 3 LEU A 94 ? ? 62.16 104.01 27 4 GLN A 42 ? ? -163.52 -57.08 28 4 ASN A 56 ? ? -179.77 115.83 29 4 ALA A 59 ? ? -57.73 -166.01 30 4 ASN A 66 ? ? -97.56 43.08 31 4 LEU A 90 ? ? -100.16 -67.20 32 4 LEU A 92 ? ? 49.81 25.85 33 5 SER A 14 ? ? -75.58 -167.13 34 5 ARG A 32 ? ? 70.81 41.95 35 5 GLN A 34 ? ? -112.36 51.47 36 5 ASN A 56 ? ? 178.52 113.54 37 5 ALA A 59 ? ? -57.95 -165.21 38 5 ASP A 68 ? ? -161.81 30.12 39 5 ASP A 73 ? ? -160.11 -165.09 40 5 LEU A 90 ? ? -98.78 -72.11 41 5 LEU A 92 ? ? 61.65 -74.45 42 5 ALA A 93 ? ? -148.17 -68.86 43 6 GLN A 34 ? ? -98.89 54.11 44 6 ASN A 56 ? ? -179.83 113.28 45 6 ALA A 59 ? ? -58.91 -165.74 46 6 PRO A 62 ? ? -60.56 95.82 47 6 ASP A 68 ? ? 70.81 35.10 48 6 LEU A 90 ? ? -100.10 -66.50 49 6 LEU A 92 ? ? 47.59 27.98 50 6 ALA A 93 ? ? -97.53 33.69 51 7 SER A 14 ? ? -103.80 -164.03 52 7 GLN A 34 ? ? -99.07 31.22 53 7 GLN A 42 ? ? -159.08 -54.42 54 7 ASN A 56 ? ? 175.37 115.84 55 7 ALA A 59 ? ? -56.74 -167.32 56 7 ASP A 68 ? ? -148.59 41.29 57 7 LEU A 86 ? ? -32.54 -39.80 58 7 LEU A 90 ? ? -100.22 -64.64 59 7 LEU A 92 ? ? 47.29 28.80 60 8 THR A 12 ? ? 45.40 -167.74 61 8 ASN A 56 ? ? -178.64 112.74 62 8 ALA A 59 ? ? -58.07 -164.28 63 8 PRO A 62 ? ? -67.51 86.22 64 8 ASN A 66 ? ? -104.61 79.26 65 8 ASP A 68 ? ? -151.04 36.24 66 8 LEU A 86 ? ? -29.30 -46.00 67 8 LEU A 90 ? ? -92.24 -69.76 68 8 ALA A 93 ? ? -90.35 -69.73 69 8 LEU A 94 ? ? 59.71 90.95 70 9 GLN A 34 ? ? -102.00 48.07 71 9 ASN A 56 ? ? 178.22 114.21 72 9 ALA A 59 ? ? -62.66 -167.28 73 9 PRO A 62 ? ? -61.45 83.18 74 9 ASP A 68 ? ? -145.91 37.66 75 9 ASP A 73 ? ? -160.04 -166.07 76 9 LEU A 90 ? ? -100.10 -68.84 77 10 ASN A 56 ? ? 177.81 113.58 78 10 ALA A 59 ? ? -58.90 -163.55 79 10 PRO A 62 ? ? -66.89 99.53 80 10 ASP A 68 ? ? -145.67 39.88 81 10 ASP A 73 ? ? -160.14 -164.81 82 10 LEU A 90 ? ? -100.19 -63.23 83 10 LEU A 92 ? ? 61.99 -73.40 84 10 ALA A 93 ? ? -161.92 32.15 85 11 LEU A 4 ? ? -160.05 97.69 86 11 ASN A 56 ? ? 175.92 115.66 87 11 ALA A 59 ? ? -57.38 -166.06 88 11 PRO A 62 ? ? -63.65 95.75 89 11 ASP A 68 ? ? 74.91 35.73 90 11 LEU A 86 ? ? -32.85 -38.69 91 11 LEU A 90 ? ? -99.68 -69.39 92 11 LEU A 92 ? ? 46.15 28.92 93 11 LEU A 94 ? ? -93.14 48.69 94 12 THR A 12 ? ? 63.36 -168.03 95 12 ARG A 15 ? ? 84.64 -15.80 96 12 GLN A 34 ? ? -97.43 56.14 97 12 ASN A 56 ? ? 179.39 112.96 98 12 ALA A 59 ? ? -57.83 -166.16 99 12 PRO A 62 ? ? -67.21 93.95 100 12 ASP A 68 ? ? -160.53 28.14 101 12 ASP A 73 ? ? -160.07 -166.05 102 12 LEU A 86 ? ? -29.66 -44.95 103 12 LEU A 90 ? ? -86.76 -72.13 104 12 LEU A 92 ? ? 60.48 -79.61 105 12 LEU A 94 ? ? 68.45 -68.97 106 13 LEU A 4 ? ? -160.05 113.19 107 13 THR A 12 ? ? 60.28 103.39 108 13 ASN A 56 ? ? 179.34 114.22 109 13 ALA A 59 ? ? -58.56 -171.79 110 13 ASP A 68 ? ? -144.39 41.68 111 13 ASP A 73 ? ? -160.01 -169.13 112 13 LEU A 90 ? ? -99.98 -71.84 113 13 LEU A 92 ? ? 61.58 -75.01 114 13 ALA A 93 ? ? -145.94 -46.61 115 13 LEU A 94 ? ? 69.49 -66.27 116 14 THR A 12 ? ? 61.46 156.07 117 14 SER A 14 ? ? -166.33 -168.55 118 14 GLN A 34 ? ? -103.79 53.42 119 14 ASN A 56 ? ? -179.94 113.98 120 14 ALA A 59 ? ? -57.88 -166.63 121 14 ASN A 66 ? ? -102.84 67.90 122 14 ASP A 68 ? ? -147.62 41.06 123 14 LEU A 90 ? ? -97.55 -72.67 124 14 LEU A 92 ? ? 60.36 -75.59 125 14 ALA A 93 ? ? -142.53 -49.77 126 14 LEU A 94 ? ? 60.02 75.58 127 15 THR A 12 ? ? 61.99 163.47 128 15 GLN A 34 ? ? -100.14 54.43 129 15 ASN A 56 ? ? -179.95 112.98 130 15 ALA A 59 ? ? -63.15 -165.64 131 15 PRO A 62 ? ? -69.91 96.75 132 15 ASP A 68 ? ? -160.55 31.72 133 15 LEU A 86 ? ? -32.49 -38.61 134 15 LEU A 90 ? ? -97.08 -72.01 135 15 LEU A 92 ? ? 61.20 -74.84 136 15 ALA A 93 ? ? -140.03 -45.48 137 15 LEU A 94 ? ? -64.09 80.37 138 16 SER A 14 ? ? -59.13 176.81 139 16 GLN A 34 ? ? -113.89 50.83 140 16 ASN A 56 ? ? -178.90 113.08 141 16 ALA A 59 ? ? -61.39 -163.03 142 16 ASP A 68 ? ? -158.86 28.86 143 16 ASP A 73 ? ? -127.37 -167.03 144 16 LEU A 86 ? ? -31.70 -38.91 145 16 LEU A 90 ? ? -95.54 -73.60 146 16 LEU A 92 ? ? 60.96 -77.98 147 16 ALA A 93 ? ? -134.18 -61.03 148 16 LEU A 94 ? ? 61.34 82.87 149 17 ASN A 56 ? ? 176.05 115.20 150 17 ALA A 59 ? ? -58.81 -164.09 151 17 PRO A 62 ? ? -67.84 90.50 152 17 ASN A 66 ? ? -99.74 50.90 153 17 ASP A 68 ? ? -149.92 40.47 154 17 LEU A 90 ? ? -90.56 -75.93 155 17 LEU A 92 ? ? 45.55 27.14 156 17 ALA A 93 ? ? 168.69 -74.64 157 17 LEU A 94 ? ? -160.34 -46.23 158 18 THR A 12 ? ? 56.28 -169.69 159 18 ASN A 56 ? ? -177.95 113.66 160 18 ALA A 59 ? ? -58.52 -163.51 161 18 PRO A 62 ? ? -68.60 93.03 162 18 ASP A 68 ? ? -161.90 29.63 163 18 CYS A 71 ? ? -79.31 -88.80 164 18 ASP A 73 ? ? -119.55 -162.61 165 18 LEU A 86 ? ? -31.73 -38.20 166 18 LEU A 90 ? ? -100.19 -63.40 167 18 LEU A 92 ? ? 49.13 26.69 168 19 ASN A 56 ? ? 173.15 117.16 169 19 ALA A 59 ? ? -58.79 -162.22 170 19 PRO A 62 ? ? -64.78 84.54 171 19 ASP A 68 ? ? -147.38 38.84 172 19 ASP A 73 ? ? -160.21 -162.82 173 19 LEU A 90 ? ? -97.23 -70.40 174 19 LEU A 92 ? ? 58.71 -79.99 175 19 ALA A 93 ? ? -165.62 -56.02 176 19 LEU A 94 ? ? 59.27 97.48 177 20 ARG A 15 ? ? 84.20 -16.21 178 20 GLN A 34 ? ? -113.69 51.42 179 20 ASN A 56 ? ? 170.81 117.15 180 20 ALA A 59 ? ? -56.29 -166.60 181 20 PRO A 62 ? ? -65.41 81.76 182 20 ASP A 68 ? ? -155.10 33.18 183 20 ASP A 73 ? ? -160.10 -164.42 184 20 LEU A 90 ? ? -91.51 -77.64 185 20 LEU A 94 ? ? 61.44 -79.91 # _pdbx_nmr_ensemble.entry_id 1SJ6 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1SJ6 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;2mM SH3BGRL3 U-15N, 13C; 20mM phosphate buffer NA; 100mM NaCl, pH7.0; 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H20, 10% D20' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 295 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM NaCl, 20mM phosphate buffer' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 '3D HCCH-COSY' 3 1 1 3D_13C-separated_NOESY 4 1 1 3D_15N-separated_NOESY 5 1 1 '3D CBCA(CO)NH' 6 1 1 3D_CBCANH 7 1 1 '3D HNCO' 8 1 1 '3D_H(CCO)NH_TOCSY' 9 1 1 '3D_C(CO)NH_TOCSY' 10 1 1 '3D HCCH-TOCSY' # _pdbx_nmr_details.entry_id 1SJ6 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy' # _pdbx_nmr_refine.entry_id 1SJ6 _pdbx_nmr_refine.method 'distance geometry, simulated annealing, molecular dynamics, torsion angle dynamics' _pdbx_nmr_refine.details ;the structures are based on a total of 1463 restraints, 1306 are NOE-derived distance constraints, 101 dihedral angle restraints, 56 distance restraints from hydrogen bonds ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe 2.2 processing F.Delaglio 1 CNS 1.1 'structure solution' A.T.Brunger 2 Sparky SPARKY3 'data analysis' T.D.Goddard&D.G.Kneller 3 CNS 1.1 refinement A.T.Brunger 4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 96 ? A HIS 96 2 1 Y 1 A HIS 97 ? A HIS 97 3 1 Y 1 A HIS 98 ? A HIS 98 4 1 Y 1 A HIS 99 ? A HIS 99 5 1 Y 1 A HIS 100 ? A HIS 100 6 1 Y 1 A HIS 101 ? A HIS 101 7 2 Y 1 A HIS 96 ? A HIS 96 8 2 Y 1 A HIS 97 ? A HIS 97 9 2 Y 1 A HIS 98 ? A HIS 98 10 2 Y 1 A HIS 99 ? A HIS 99 11 2 Y 1 A HIS 100 ? A HIS 100 12 2 Y 1 A HIS 101 ? A HIS 101 13 3 Y 1 A HIS 96 ? A HIS 96 14 3 Y 1 A HIS 97 ? A HIS 97 15 3 Y 1 A HIS 98 ? A HIS 98 16 3 Y 1 A HIS 99 ? A HIS 99 17 3 Y 1 A HIS 100 ? A HIS 100 18 3 Y 1 A HIS 101 ? A HIS 101 19 4 Y 1 A HIS 96 ? A HIS 96 20 4 Y 1 A HIS 97 ? A HIS 97 21 4 Y 1 A HIS 98 ? A HIS 98 22 4 Y 1 A HIS 99 ? A HIS 99 23 4 Y 1 A HIS 100 ? A HIS 100 24 4 Y 1 A HIS 101 ? A HIS 101 25 5 Y 1 A HIS 96 ? A HIS 96 26 5 Y 1 A HIS 97 ? A HIS 97 27 5 Y 1 A HIS 98 ? A HIS 98 28 5 Y 1 A HIS 99 ? A HIS 99 29 5 Y 1 A HIS 100 ? A HIS 100 30 5 Y 1 A HIS 101 ? A HIS 101 31 6 Y 1 A HIS 96 ? A HIS 96 32 6 Y 1 A HIS 97 ? A HIS 97 33 6 Y 1 A HIS 98 ? A HIS 98 34 6 Y 1 A HIS 99 ? A HIS 99 35 6 Y 1 A HIS 100 ? A HIS 100 36 6 Y 1 A HIS 101 ? A HIS 101 37 7 Y 1 A HIS 96 ? A HIS 96 38 7 Y 1 A HIS 97 ? A HIS 97 39 7 Y 1 A HIS 98 ? A HIS 98 40 7 Y 1 A HIS 99 ? A HIS 99 41 7 Y 1 A HIS 100 ? A HIS 100 42 7 Y 1 A HIS 101 ? A HIS 101 43 8 Y 1 A HIS 96 ? A HIS 96 44 8 Y 1 A HIS 97 ? A HIS 97 45 8 Y 1 A HIS 98 ? A HIS 98 46 8 Y 1 A HIS 99 ? A HIS 99 47 8 Y 1 A HIS 100 ? A HIS 100 48 8 Y 1 A HIS 101 ? A HIS 101 49 9 Y 1 A HIS 96 ? A HIS 96 50 9 Y 1 A HIS 97 ? A HIS 97 51 9 Y 1 A HIS 98 ? A HIS 98 52 9 Y 1 A HIS 99 ? A HIS 99 53 9 Y 1 A HIS 100 ? A HIS 100 54 9 Y 1 A HIS 101 ? A HIS 101 55 10 Y 1 A HIS 96 ? A HIS 96 56 10 Y 1 A HIS 97 ? A HIS 97 57 10 Y 1 A HIS 98 ? A HIS 98 58 10 Y 1 A HIS 99 ? A HIS 99 59 10 Y 1 A HIS 100 ? A HIS 100 60 10 Y 1 A HIS 101 ? A HIS 101 61 11 Y 1 A HIS 96 ? A HIS 96 62 11 Y 1 A HIS 97 ? A HIS 97 63 11 Y 1 A HIS 98 ? A HIS 98 64 11 Y 1 A HIS 99 ? A HIS 99 65 11 Y 1 A HIS 100 ? A HIS 100 66 11 Y 1 A HIS 101 ? A HIS 101 67 12 Y 1 A HIS 96 ? A HIS 96 68 12 Y 1 A HIS 97 ? A HIS 97 69 12 Y 1 A HIS 98 ? A HIS 98 70 12 Y 1 A HIS 99 ? A HIS 99 71 12 Y 1 A HIS 100 ? A HIS 100 72 12 Y 1 A HIS 101 ? A HIS 101 73 13 Y 1 A HIS 96 ? A HIS 96 74 13 Y 1 A HIS 97 ? A HIS 97 75 13 Y 1 A HIS 98 ? A HIS 98 76 13 Y 1 A HIS 99 ? A HIS 99 77 13 Y 1 A HIS 100 ? A HIS 100 78 13 Y 1 A HIS 101 ? A HIS 101 79 14 Y 1 A HIS 96 ? A HIS 96 80 14 Y 1 A HIS 97 ? A HIS 97 81 14 Y 1 A HIS 98 ? A HIS 98 82 14 Y 1 A HIS 99 ? A HIS 99 83 14 Y 1 A HIS 100 ? A HIS 100 84 14 Y 1 A HIS 101 ? A HIS 101 85 15 Y 1 A HIS 96 ? A HIS 96 86 15 Y 1 A HIS 97 ? A HIS 97 87 15 Y 1 A HIS 98 ? A HIS 98 88 15 Y 1 A HIS 99 ? A HIS 99 89 15 Y 1 A HIS 100 ? A HIS 100 90 15 Y 1 A HIS 101 ? A HIS 101 91 16 Y 1 A HIS 96 ? A HIS 96 92 16 Y 1 A HIS 97 ? A HIS 97 93 16 Y 1 A HIS 98 ? A HIS 98 94 16 Y 1 A HIS 99 ? A HIS 99 95 16 Y 1 A HIS 100 ? A HIS 100 96 16 Y 1 A HIS 101 ? A HIS 101 97 17 Y 1 A HIS 96 ? A HIS 96 98 17 Y 1 A HIS 97 ? A HIS 97 99 17 Y 1 A HIS 98 ? A HIS 98 100 17 Y 1 A HIS 99 ? A HIS 99 101 17 Y 1 A HIS 100 ? A HIS 100 102 17 Y 1 A HIS 101 ? A HIS 101 103 18 Y 1 A HIS 96 ? A HIS 96 104 18 Y 1 A HIS 97 ? A HIS 97 105 18 Y 1 A HIS 98 ? A HIS 98 106 18 Y 1 A HIS 99 ? A HIS 99 107 18 Y 1 A HIS 100 ? A HIS 100 108 18 Y 1 A HIS 101 ? A HIS 101 109 19 Y 1 A HIS 96 ? A HIS 96 110 19 Y 1 A HIS 97 ? A HIS 97 111 19 Y 1 A HIS 98 ? A HIS 98 112 19 Y 1 A HIS 99 ? A HIS 99 113 19 Y 1 A HIS 100 ? A HIS 100 114 19 Y 1 A HIS 101 ? A HIS 101 115 20 Y 1 A HIS 96 ? A HIS 96 116 20 Y 1 A HIS 97 ? A HIS 97 117 20 Y 1 A HIS 98 ? A HIS 98 118 20 Y 1 A HIS 99 ? A HIS 99 119 20 Y 1 A HIS 100 ? A HIS 100 120 20 Y 1 A HIS 101 ? A HIS 101 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 500 2 ? Bruker DMX 600 # _atom_sites.entry_id 1SJ6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_