data_1SKH # _entry.id 1SKH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1SKH pdb_00001skh 10.2210/pdb1skh/pdb RCSB RCSB021789 ? ? WWPDB D_1000021789 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-03-01 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1SKH _pdbx_database_status.recvd_initial_deposition_date 2004-03-05 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry N _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Biverstahl, H.' 1 'Andersson, A.' 2 'Graslund, A.' 3 'Maler, L.' 4 # _citation.id primary _citation.title 'NMR solution structure and membrane interaction of the N-terminal sequence (1-30) of the bovine prion protein.' _citation.journal_abbrev Biochemistry _citation.journal_volume 43 _citation.page_first 14940 _citation.page_last 14947 _citation.year 2004 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15554701 _citation.pdbx_database_id_DOI 10.1021/bi0485070 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Biverstahl, H.' 1 ? primary 'Andersson, A.' 2 ? primary 'Graslund, A.' 3 ? primary 'Maler, L.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'Major prion protein 2' _entity.formula_weight 3424.280 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal domain (residues 1-30)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PrP, Major scrapie-associated fibril protein 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MVKSKIGSWILVLFVAMWSDVGLCKKRPKP _entity_poly.pdbx_seq_one_letter_code_can MVKSKIGSWILVLFVAMWSDVGLCKKRPKP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 LYS n 1 4 SER n 1 5 LYS n 1 6 ILE n 1 7 GLY n 1 8 SER n 1 9 TRP n 1 10 ILE n 1 11 LEU n 1 12 VAL n 1 13 LEU n 1 14 PHE n 1 15 VAL n 1 16 ALA n 1 17 MET n 1 18 TRP n 1 19 SER n 1 20 ASP n 1 21 VAL n 1 22 GLY n 1 23 LEU n 1 24 CYS n 1 25 LYS n 1 26 LYS n 1 27 ARG n 1 28 PRO n 1 29 LYS n 1 30 PRO n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name cattle _entity_src_nat.pdbx_organism_scientific 'Bos taurus' _entity_src_nat.pdbx_ncbi_taxonomy_id 9913 _entity_src_nat.genus Bos _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 TRP 9 9 9 TRP TRP A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 TRP 18 18 18 TRP TRP A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 PRO 30 30 30 PRO PRO A . n # _cell.entry_id 1SKH _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1SKH _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1SKH _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1SKH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1SKH _struct.title 'N-terminal (1-30) of bovine Prion protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1SKH _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'coil-helix-coil, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PRIO2_BOVIN _struct_ref.pdbx_db_accession Q01880 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MVKSHIGSWILVLFVAMWSDVGLCKKRPKP _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1SKH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 30 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q01880 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 30 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 30 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1SKH _struct_ref_seq_dif.mon_id LYS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 5 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q01880 _struct_ref_seq_dif.db_mon_id HIS _struct_ref_seq_dif.pdbx_seq_db_seq_num 5 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 5 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 8 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 22 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 8 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 22 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 O A LEU 13 ? ? H A MET 17 ? ? 1.58 2 4 O A LEU 13 ? ? H A MET 17 ? ? 1.54 3 5 O A LEU 13 ? ? H A MET 17 ? ? 1.57 4 6 O A LEU 13 ? ? H A MET 17 ? ? 1.57 5 9 O A ILE 6 ? ? H A TRP 9 ? ? 1.55 6 9 O A LEU 13 ? ? H A MET 17 ? ? 1.60 7 10 O A LEU 13 ? ? H A MET 17 ? ? 1.58 8 12 O A LEU 13 ? ? H A MET 17 ? ? 1.55 9 15 O A ILE 6 ? ? H A TRP 9 ? ? 1.52 10 15 O A LEU 13 ? ? H A MET 17 ? ? 1.60 11 18 O A LEU 23 ? ? H A LYS 26 ? ? 1.60 12 21 O A VAL 15 ? ? H A SER 19 ? ? 1.56 13 22 O A LYS 5 ? ? H A GLY 7 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 5 ? ? -100.61 56.29 2 1 LEU A 23 ? ? -130.73 -59.08 3 1 CYS A 24 ? ? -103.17 75.89 4 1 LYS A 25 ? ? 166.73 -31.46 5 1 ARG A 27 ? ? 62.37 151.39 6 2 LYS A 5 ? ? 46.13 83.88 7 2 VAL A 21 ? ? -110.00 -94.77 8 2 LYS A 25 ? ? -169.80 -97.63 9 2 ARG A 27 ? ? 39.06 82.54 10 3 VAL A 2 ? ? -79.45 -152.90 11 3 LYS A 3 ? ? -91.55 -105.21 12 3 LYS A 5 ? ? 164.13 -30.02 13 3 LEU A 23 ? ? -102.55 61.96 14 3 CYS A 24 ? ? 175.73 64.56 15 3 LYS A 25 ? ? 164.21 -30.04 16 3 ARG A 27 ? ? 59.50 155.47 17 4 VAL A 2 ? ? 61.33 -102.32 18 4 LYS A 3 ? ? 78.96 75.73 19 4 SER A 4 ? ? 160.13 -26.95 20 4 LEU A 23 ? ? -106.27 59.90 21 4 LYS A 25 ? ? 87.45 -11.43 22 4 LYS A 26 ? ? -77.25 -103.36 23 5 VAL A 2 ? ? 64.05 -102.07 24 5 LYS A 3 ? ? 84.33 88.56 25 5 SER A 4 ? ? 160.02 -26.99 26 5 CYS A 24 ? ? 174.12 -36.17 27 5 LYS A 26 ? ? -88.73 -103.08 28 5 LYS A 29 ? ? -178.91 90.22 29 6 VAL A 2 ? ? 60.02 -103.57 30 6 LYS A 3 ? ? 163.53 -29.57 31 6 SER A 4 ? ? -105.17 -90.55 32 6 LYS A 5 ? ? 169.83 61.09 33 6 LEU A 23 ? ? -99.68 57.63 34 6 LYS A 26 ? ? 42.87 87.67 35 6 LYS A 29 ? ? 64.98 88.85 36 7 VAL A 2 ? ? 64.92 167.71 37 7 SER A 4 ? ? 161.22 -27.58 38 7 LYS A 5 ? ? 44.73 71.08 39 7 ILE A 6 ? ? -119.77 -103.05 40 7 TRP A 9 ? ? -68.36 -71.45 41 7 LYS A 25 ? ? -152.28 47.14 42 8 SER A 4 ? ? 171.48 -33.27 43 8 LYS A 5 ? ? 86.43 -9.90 44 8 CYS A 24 ? ? -95.97 -100.71 45 8 ARG A 27 ? ? 52.94 78.92 46 9 SER A 4 ? ? 160.08 -26.96 47 9 ILE A 6 ? ? -73.16 -102.10 48 9 LYS A 25 ? ? 176.58 -36.21 49 9 LYS A 26 ? ? -69.40 -104.08 50 9 ARG A 27 ? ? -39.50 155.49 51 10 VAL A 2 ? ? -129.06 -168.34 52 10 SER A 4 ? ? 165.44 -29.76 53 10 LYS A 5 ? ? -99.42 55.07 54 10 TRP A 9 ? ? -71.82 -70.40 55 10 CYS A 24 ? ? 48.63 86.13 56 10 LYS A 25 ? ? 90.34 -37.52 57 10 LYS A 26 ? ? 166.64 -31.34 58 11 VAL A 2 ? ? -155.54 -152.89 59 11 LYS A 3 ? ? -155.02 81.35 60 11 SER A 4 ? ? -168.94 -41.39 61 11 LYS A 5 ? ? 164.38 -30.13 62 11 LYS A 29 ? ? 64.60 160.67 63 12 LYS A 3 ? ? 64.08 73.37 64 12 SER A 4 ? ? 160.28 -27.01 65 12 LYS A 5 ? ? -103.75 51.88 66 12 LEU A 23 ? ? -143.15 -50.38 67 12 CYS A 24 ? ? -113.37 70.02 68 12 LYS A 25 ? ? 164.05 -29.94 69 12 LYS A 26 ? ? -105.63 53.88 70 12 LYS A 29 ? ? 67.81 89.21 71 13 VAL A 2 ? ? -45.00 -93.44 72 13 LYS A 3 ? ? 50.40 89.69 73 13 SER A 4 ? ? 160.12 -27.07 74 13 ILE A 6 ? ? -40.44 -82.13 75 13 LEU A 23 ? ? -153.68 -46.84 76 13 LYS A 26 ? ? -128.98 -103.84 77 13 ARG A 27 ? ? -38.36 99.06 78 14 LYS A 3 ? ? 166.89 -31.49 79 14 ILE A 6 ? ? -89.97 -103.22 80 14 LEU A 23 ? ? -147.19 -61.54 81 14 CYS A 24 ? ? -51.24 108.65 82 14 LYS A 29 ? ? 59.20 159.97 83 15 LYS A 3 ? ? -82.27 -103.15 84 15 LYS A 5 ? ? 57.95 76.29 85 15 LEU A 23 ? ? -169.50 -43.94 86 15 LYS A 25 ? ? -105.35 46.61 87 15 LYS A 26 ? ? 43.27 78.38 88 15 LYS A 29 ? ? -153.37 75.09 89 16 ILE A 6 ? ? -44.85 -90.51 90 16 SER A 8 ? ? -148.16 -45.82 91 16 VAL A 21 ? ? -155.25 -45.88 92 16 LEU A 23 ? ? -101.19 62.45 93 16 LYS A 25 ? ? -147.66 20.57 94 16 LYS A 26 ? ? -97.75 -104.32 95 16 ARG A 27 ? ? 78.54 94.83 96 17 VAL A 2 ? ? -109.98 -152.90 97 17 SER A 4 ? ? 159.99 -26.98 98 17 LYS A 5 ? ? 40.80 72.46 99 17 ILE A 6 ? ? -106.77 -102.37 100 17 CYS A 24 ? ? -92.88 42.93 101 17 LYS A 25 ? ? 179.88 38.31 102 17 ARG A 27 ? ? -38.54 99.17 103 18 VAL A 2 ? ? -174.81 -152.82 104 18 LYS A 3 ? ? -171.77 -97.24 105 18 LYS A 5 ? ? -103.70 63.59 106 18 LEU A 23 ? ? 56.81 71.06 107 18 LYS A 26 ? ? -102.37 53.22 108 18 ARG A 27 ? ? 63.42 122.36 109 18 LYS A 29 ? ? -42.27 157.60 110 19 VAL A 2 ? ? -109.68 -152.91 111 19 LYS A 3 ? ? 164.27 -30.09 112 19 LEU A 23 ? ? -155.60 87.13 113 19 LYS A 25 ? ? 42.64 29.03 114 19 LYS A 26 ? ? -138.91 -103.31 115 19 ARG A 27 ? ? 60.53 82.34 116 20 SER A 4 ? ? -170.33 126.26 117 20 LEU A 23 ? ? -139.22 -59.42 118 20 CYS A 24 ? ? -101.32 71.19 119 20 LYS A 25 ? ? 164.04 -29.94 120 20 LYS A 26 ? ? -100.12 56.84 121 21 VAL A 2 ? ? 56.72 167.29 122 21 SER A 4 ? ? 171.25 -32.99 123 21 LYS A 5 ? ? 65.37 81.58 124 21 ILE A 10 ? ? -39.97 -29.69 125 21 LEU A 23 ? ? -178.79 37.96 126 22 LYS A 5 ? ? 84.39 8.37 127 22 ILE A 6 ? ? 70.16 -57.53 128 22 LEU A 23 ? ? -167.59 -54.92 129 22 LYS A 25 ? ? -175.06 -39.85 130 22 LYS A 26 ? ? -99.27 -99.67 131 22 ARG A 27 ? ? 168.27 -54.18 # _pdbx_nmr_ensemble.entry_id 1SKH _pdbx_nmr_ensemble.conformers_calculated_total_number 60 _pdbx_nmr_ensemble.conformers_submitted_total_number 22 _pdbx_nmr_ensemble.conformer_selection_criteria 'a combination of least constraint violations and DYANA target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1SKH _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM bovine PrP, 100 mM dihexanoyl-sn-glycero-3-phosphatidylcholine-d22 (DHPC), H2O, D2O' _pdbx_nmr_sample_details.solvent_system '100 mM dihexanoyl-sn-glycero-3-phosphatidylcholine-d22 (DHPC), H2O, D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 3.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 '2D TOCSY' # _pdbx_nmr_refine.entry_id 1SKH _pdbx_nmr_refine.method 'DYANA torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal Felix ? 'data analysis' ? 1 VNMR 6.1c collection ? 2 DYANA 1.5 'structure solution' ? 3 DYANA 1.5 refinement ? 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLY N N N N 71 GLY CA C N N 72 GLY C C N N 73 GLY O O N N 74 GLY OXT O N N 75 GLY H H N N 76 GLY H2 H N N 77 GLY HA2 H N N 78 GLY HA3 H N N 79 GLY HXT H N N 80 HIS N N N N 81 HIS CA C N S 82 HIS C C N N 83 HIS O O N N 84 HIS CB C N N 85 HIS CG C Y N 86 HIS ND1 N Y N 87 HIS CD2 C Y N 88 HIS CE1 C Y N 89 HIS NE2 N Y N 90 HIS OXT O N N 91 HIS H H N N 92 HIS H2 H N N 93 HIS HA H N N 94 HIS HB2 H N N 95 HIS HB3 H N N 96 HIS HD1 H N N 97 HIS HD2 H N N 98 HIS HE1 H N N 99 HIS HE2 H N N 100 HIS HXT H N N 101 ILE N N N N 102 ILE CA C N S 103 ILE C C N N 104 ILE O O N N 105 ILE CB C N S 106 ILE CG1 C N N 107 ILE CG2 C N N 108 ILE CD1 C N N 109 ILE OXT O N N 110 ILE H H N N 111 ILE H2 H N N 112 ILE HA H N N 113 ILE HB H N N 114 ILE HG12 H N N 115 ILE HG13 H N N 116 ILE HG21 H N N 117 ILE HG22 H N N 118 ILE HG23 H N N 119 ILE HD11 H N N 120 ILE HD12 H N N 121 ILE HD13 H N N 122 ILE HXT H N N 123 LEU N N N N 124 LEU CA C N S 125 LEU C C N N 126 LEU O O N N 127 LEU CB C N N 128 LEU CG C N N 129 LEU CD1 C N N 130 LEU CD2 C N N 131 LEU OXT O N N 132 LEU H H N N 133 LEU H2 H N N 134 LEU HA H N N 135 LEU HB2 H N N 136 LEU HB3 H N N 137 LEU HG H N N 138 LEU HD11 H N N 139 LEU HD12 H N N 140 LEU HD13 H N N 141 LEU HD21 H N N 142 LEU HD22 H N N 143 LEU HD23 H N N 144 LEU HXT H N N 145 LYS N N N N 146 LYS CA C N S 147 LYS C C N N 148 LYS O O N N 149 LYS CB C N N 150 LYS CG C N N 151 LYS CD C N N 152 LYS CE C N N 153 LYS NZ N N N 154 LYS OXT O N N 155 LYS H H N N 156 LYS H2 H N N 157 LYS HA H N N 158 LYS HB2 H N N 159 LYS HB3 H N N 160 LYS HG2 H N N 161 LYS HG3 H N N 162 LYS HD2 H N N 163 LYS HD3 H N N 164 LYS HE2 H N N 165 LYS HE3 H N N 166 LYS HZ1 H N N 167 LYS HZ2 H N N 168 LYS HZ3 H N N 169 LYS HXT H N N 170 MET N N N N 171 MET CA C N S 172 MET C C N N 173 MET O O N N 174 MET CB C N N 175 MET CG C N N 176 MET SD S N N 177 MET CE C N N 178 MET OXT O N N 179 MET H H N N 180 MET H2 H N N 181 MET HA H N N 182 MET HB2 H N N 183 MET HB3 H N N 184 MET HG2 H N N 185 MET HG3 H N N 186 MET HE1 H N N 187 MET HE2 H N N 188 MET HE3 H N N 189 MET HXT H N N 190 PHE N N N N 191 PHE CA C N S 192 PHE C C N N 193 PHE O O N N 194 PHE CB C N N 195 PHE CG C Y N 196 PHE CD1 C Y N 197 PHE CD2 C Y N 198 PHE CE1 C Y N 199 PHE CE2 C Y N 200 PHE CZ C Y N 201 PHE OXT O N N 202 PHE H H N N 203 PHE H2 H N N 204 PHE HA H N N 205 PHE HB2 H N N 206 PHE HB3 H N N 207 PHE HD1 H N N 208 PHE HD2 H N N 209 PHE HE1 H N N 210 PHE HE2 H N N 211 PHE HZ H N N 212 PHE HXT H N N 213 PRO N N N N 214 PRO CA C N S 215 PRO C C N N 216 PRO O O N N 217 PRO CB C N N 218 PRO CG C N N 219 PRO CD C N N 220 PRO OXT O N N 221 PRO H H N N 222 PRO HA H N N 223 PRO HB2 H N N 224 PRO HB3 H N N 225 PRO HG2 H N N 226 PRO HG3 H N N 227 PRO HD2 H N N 228 PRO HD3 H N N 229 PRO HXT H N N 230 SER N N N N 231 SER CA C N S 232 SER C C N N 233 SER O O N N 234 SER CB C N N 235 SER OG O N N 236 SER OXT O N N 237 SER H H N N 238 SER H2 H N N 239 SER HA H N N 240 SER HB2 H N N 241 SER HB3 H N N 242 SER HG H N N 243 SER HXT H N N 244 TRP N N N N 245 TRP CA C N S 246 TRP C C N N 247 TRP O O N N 248 TRP CB C N N 249 TRP CG C Y N 250 TRP CD1 C Y N 251 TRP CD2 C Y N 252 TRP NE1 N Y N 253 TRP CE2 C Y N 254 TRP CE3 C Y N 255 TRP CZ2 C Y N 256 TRP CZ3 C Y N 257 TRP CH2 C Y N 258 TRP OXT O N N 259 TRP H H N N 260 TRP H2 H N N 261 TRP HA H N N 262 TRP HB2 H N N 263 TRP HB3 H N N 264 TRP HD1 H N N 265 TRP HE1 H N N 266 TRP HE3 H N N 267 TRP HZ2 H N N 268 TRP HZ3 H N N 269 TRP HH2 H N N 270 TRP HXT H N N 271 VAL N N N N 272 VAL CA C N S 273 VAL C C N N 274 VAL O O N N 275 VAL CB C N N 276 VAL CG1 C N N 277 VAL CG2 C N N 278 VAL OXT O N N 279 VAL H H N N 280 VAL H2 H N N 281 VAL HA H N N 282 VAL HB H N N 283 VAL HG11 H N N 284 VAL HG12 H N N 285 VAL HG13 H N N 286 VAL HG21 H N N 287 VAL HG22 H N N 288 VAL HG23 H N N 289 VAL HXT H N N 290 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLY N CA sing N N 67 GLY N H sing N N 68 GLY N H2 sing N N 69 GLY CA C sing N N 70 GLY CA HA2 sing N N 71 GLY CA HA3 sing N N 72 GLY C O doub N N 73 GLY C OXT sing N N 74 GLY OXT HXT sing N N 75 HIS N CA sing N N 76 HIS N H sing N N 77 HIS N H2 sing N N 78 HIS CA C sing N N 79 HIS CA CB sing N N 80 HIS CA HA sing N N 81 HIS C O doub N N 82 HIS C OXT sing N N 83 HIS CB CG sing N N 84 HIS CB HB2 sing N N 85 HIS CB HB3 sing N N 86 HIS CG ND1 sing Y N 87 HIS CG CD2 doub Y N 88 HIS ND1 CE1 doub Y N 89 HIS ND1 HD1 sing N N 90 HIS CD2 NE2 sing Y N 91 HIS CD2 HD2 sing N N 92 HIS CE1 NE2 sing Y N 93 HIS CE1 HE1 sing N N 94 HIS NE2 HE2 sing N N 95 HIS OXT HXT sing N N 96 ILE N CA sing N N 97 ILE N H sing N N 98 ILE N H2 sing N N 99 ILE CA C sing N N 100 ILE CA CB sing N N 101 ILE CA HA sing N N 102 ILE C O doub N N 103 ILE C OXT sing N N 104 ILE CB CG1 sing N N 105 ILE CB CG2 sing N N 106 ILE CB HB sing N N 107 ILE CG1 CD1 sing N N 108 ILE CG1 HG12 sing N N 109 ILE CG1 HG13 sing N N 110 ILE CG2 HG21 sing N N 111 ILE CG2 HG22 sing N N 112 ILE CG2 HG23 sing N N 113 ILE CD1 HD11 sing N N 114 ILE CD1 HD12 sing N N 115 ILE CD1 HD13 sing N N 116 ILE OXT HXT sing N N 117 LEU N CA sing N N 118 LEU N H sing N N 119 LEU N H2 sing N N 120 LEU CA C sing N N 121 LEU CA CB sing N N 122 LEU CA HA sing N N 123 LEU C O doub N N 124 LEU C OXT sing N N 125 LEU CB CG sing N N 126 LEU CB HB2 sing N N 127 LEU CB HB3 sing N N 128 LEU CG CD1 sing N N 129 LEU CG CD2 sing N N 130 LEU CG HG sing N N 131 LEU CD1 HD11 sing N N 132 LEU CD1 HD12 sing N N 133 LEU CD1 HD13 sing N N 134 LEU CD2 HD21 sing N N 135 LEU CD2 HD22 sing N N 136 LEU CD2 HD23 sing N N 137 LEU OXT HXT sing N N 138 LYS N CA sing N N 139 LYS N H sing N N 140 LYS N H2 sing N N 141 LYS CA C sing N N 142 LYS CA CB sing N N 143 LYS CA HA sing N N 144 LYS C O doub N N 145 LYS C OXT sing N N 146 LYS CB CG sing N N 147 LYS CB HB2 sing N N 148 LYS CB HB3 sing N N 149 LYS CG CD sing N N 150 LYS CG HG2 sing N N 151 LYS CG HG3 sing N N 152 LYS CD CE sing N N 153 LYS CD HD2 sing N N 154 LYS CD HD3 sing N N 155 LYS CE NZ sing N N 156 LYS CE HE2 sing N N 157 LYS CE HE3 sing N N 158 LYS NZ HZ1 sing N N 159 LYS NZ HZ2 sing N N 160 LYS NZ HZ3 sing N N 161 LYS OXT HXT sing N N 162 MET N CA sing N N 163 MET N H sing N N 164 MET N H2 sing N N 165 MET CA C sing N N 166 MET CA CB sing N N 167 MET CA HA sing N N 168 MET C O doub N N 169 MET C OXT sing N N 170 MET CB CG sing N N 171 MET CB HB2 sing N N 172 MET CB HB3 sing N N 173 MET CG SD sing N N 174 MET CG HG2 sing N N 175 MET CG HG3 sing N N 176 MET SD CE sing N N 177 MET CE HE1 sing N N 178 MET CE HE2 sing N N 179 MET CE HE3 sing N N 180 MET OXT HXT sing N N 181 PHE N CA sing N N 182 PHE N H sing N N 183 PHE N H2 sing N N 184 PHE CA C sing N N 185 PHE CA CB sing N N 186 PHE CA HA sing N N 187 PHE C O doub N N 188 PHE C OXT sing N N 189 PHE CB CG sing N N 190 PHE CB HB2 sing N N 191 PHE CB HB3 sing N N 192 PHE CG CD1 doub Y N 193 PHE CG CD2 sing Y N 194 PHE CD1 CE1 sing Y N 195 PHE CD1 HD1 sing N N 196 PHE CD2 CE2 doub Y N 197 PHE CD2 HD2 sing N N 198 PHE CE1 CZ doub Y N 199 PHE CE1 HE1 sing N N 200 PHE CE2 CZ sing Y N 201 PHE CE2 HE2 sing N N 202 PHE CZ HZ sing N N 203 PHE OXT HXT sing N N 204 PRO N CA sing N N 205 PRO N CD sing N N 206 PRO N H sing N N 207 PRO CA C sing N N 208 PRO CA CB sing N N 209 PRO CA HA sing N N 210 PRO C O doub N N 211 PRO C OXT sing N N 212 PRO CB CG sing N N 213 PRO CB HB2 sing N N 214 PRO CB HB3 sing N N 215 PRO CG CD sing N N 216 PRO CG HG2 sing N N 217 PRO CG HG3 sing N N 218 PRO CD HD2 sing N N 219 PRO CD HD3 sing N N 220 PRO OXT HXT sing N N 221 SER N CA sing N N 222 SER N H sing N N 223 SER N H2 sing N N 224 SER CA C sing N N 225 SER CA CB sing N N 226 SER CA HA sing N N 227 SER C O doub N N 228 SER C OXT sing N N 229 SER CB OG sing N N 230 SER CB HB2 sing N N 231 SER CB HB3 sing N N 232 SER OG HG sing N N 233 SER OXT HXT sing N N 234 TRP N CA sing N N 235 TRP N H sing N N 236 TRP N H2 sing N N 237 TRP CA C sing N N 238 TRP CA CB sing N N 239 TRP CA HA sing N N 240 TRP C O doub N N 241 TRP C OXT sing N N 242 TRP CB CG sing N N 243 TRP CB HB2 sing N N 244 TRP CB HB3 sing N N 245 TRP CG CD1 doub Y N 246 TRP CG CD2 sing Y N 247 TRP CD1 NE1 sing Y N 248 TRP CD1 HD1 sing N N 249 TRP CD2 CE2 doub Y N 250 TRP CD2 CE3 sing Y N 251 TRP NE1 CE2 sing Y N 252 TRP NE1 HE1 sing N N 253 TRP CE2 CZ2 sing Y N 254 TRP CE3 CZ3 doub Y N 255 TRP CE3 HE3 sing N N 256 TRP CZ2 CH2 doub Y N 257 TRP CZ2 HZ2 sing N N 258 TRP CZ3 CH2 sing Y N 259 TRP CZ3 HZ3 sing N N 260 TRP CH2 HH2 sing N N 261 TRP OXT HXT sing N N 262 VAL N CA sing N N 263 VAL N H sing N N 264 VAL N H2 sing N N 265 VAL CA C sing N N 266 VAL CA CB sing N N 267 VAL CA HA sing N N 268 VAL C O doub N N 269 VAL C OXT sing N N 270 VAL CB CG1 sing N N 271 VAL CB CG2 sing N N 272 VAL CB HB sing N N 273 VAL CG1 HG11 sing N N 274 VAL CG1 HG12 sing N N 275 VAL CG1 HG13 sing N N 276 VAL CG2 HG21 sing N N 277 VAL CG2 HG22 sing N N 278 VAL CG2 HG23 sing N N 279 VAL OXT HXT sing N N 280 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 1SKH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_