data_1SQ8 # _entry.id 1SQ8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1SQ8 pdb_00001sq8 10.2210/pdb1sq8/pdb RCSB RCSB021910 ? ? WWPDB D_1000021910 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1SQ8 _pdbx_database_status.recvd_initial_deposition_date 2004-03-18 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Iwai, H.' 1 'Wider, G.' 2 'Wuthrich, K.' 3 # _citation.id primary _citation.title 'NMR Structure of a Variant 434 Repressor DNA-binding Domain Devoid of Hydroxyl Groups' _citation.journal_abbrev J.Biomol.Nmr _citation.journal_volume 29 _citation.page_first 395 _citation.page_last 398 _citation.year 2004 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15213439 _citation.pdbx_database_id_DOI 10.1023/B:JNMR.0000032609.72759.41 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Iwai, H.' 1 ? primary 'Wider, G.' 2 ? primary 'Wuthrich, K.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description dh434 _entity.formula_weight 7132.325 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'variant 434 repressor DNA-binding domain' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MLMGERIRARRIQLGLNQAELAQKVGVDQQAIEQLENGKAKRPRFLPELARALGVAVDWLLNGA _entity_poly.pdbx_seq_one_letter_code_can MLMGERIRARRIQLGLNQAELAQKVGVDQQAIEQLENGKAKRPRFLPELARALGVAVDWLLNGA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 MET n 1 4 GLY n 1 5 GLU n 1 6 ARG n 1 7 ILE n 1 8 ARG n 1 9 ALA n 1 10 ARG n 1 11 ARG n 1 12 ILE n 1 13 GLN n 1 14 LEU n 1 15 GLY n 1 16 LEU n 1 17 ASN n 1 18 GLN n 1 19 ALA n 1 20 GLU n 1 21 LEU n 1 22 ALA n 1 23 GLN n 1 24 LYS n 1 25 VAL n 1 26 GLY n 1 27 VAL n 1 28 ASP n 1 29 GLN n 1 30 GLN n 1 31 ALA n 1 32 ILE n 1 33 GLU n 1 34 GLN n 1 35 LEU n 1 36 GLU n 1 37 ASN n 1 38 GLY n 1 39 LYS n 1 40 ALA n 1 41 LYS n 1 42 ARG n 1 43 PRO n 1 44 ARG n 1 45 PHE n 1 46 LEU n 1 47 PRO n 1 48 GLU n 1 49 LEU n 1 50 ALA n 1 51 ARG n 1 52 ALA n 1 53 LEU n 1 54 GLY n 1 55 VAL n 1 56 ALA n 1 57 VAL n 1 58 ASP n 1 59 TRP n 1 60 LEU n 1 61 LEU n 1 62 ASN n 1 63 GLY n 1 64 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus 'Lambda-like viruses' _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Enterobacteria phage lambda' _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Phage 434' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10712 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pT7-7GFC _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RPC1_BP434 _struct_ref.pdbx_db_accession P16117 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 10 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1SQ8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 11 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 63 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P16117 _struct_ref_seq.db_align_beg 10 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 62 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 10 _struct_ref_seq.pdbx_auth_seq_align_end 62 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type '2D NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 286 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 4.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '5mM dh434, unlabeled; 25mM Potassium phosphate buffer' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model UNITYPLUS _pdbx_nmr_spectrometer.field_strength 750 # _pdbx_nmr_refine.entry_id 1SQ8 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1SQ8 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DYANA 1.2 'structure solution' ? 1 OPAL ? refinement ? 2 # _exptl.entry_id 1SQ8 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1SQ8 _struct.title 'a variant 434 repressor DNA binding domain devoid of hydroxyl groups, NMR, 20 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1SQ8 _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'HELIX-turn-Helix, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 2 ? LEU A 14 ? LEU A 1 LEU A 13 1 ? 13 HELX_P HELX_P2 2 ASN A 17 ? GLY A 26 ? ASN A 16 GLY A 25 1 ? 10 HELX_P HELX_P3 3 ASP A 28 ? ASN A 37 ? ASP A 27 ASN A 36 1 ? 10 HELX_P HELX_P4 4 PHE A 45 ? GLY A 54 ? PHE A 44 GLY A 53 1 ? 10 HELX_P HELX_P5 5 ALA A 56 ? ASN A 62 ? ALA A 55 ASN A 61 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1SQ8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1SQ8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 LEU 2 1 1 LEU LEU A . n A 1 3 MET 3 2 2 MET MET A . n A 1 4 GLY 4 3 3 GLY GLY A . n A 1 5 GLU 5 4 4 GLU GLU A . n A 1 6 ARG 6 5 5 ARG ARG A . n A 1 7 ILE 7 6 6 ILE ILE A . n A 1 8 ARG 8 7 7 ARG ARG A . n A 1 9 ALA 9 8 8 ALA ALA A . n A 1 10 ARG 10 9 9 ARG ARG A . n A 1 11 ARG 11 10 10 ARG ARG A . n A 1 12 ILE 12 11 11 ILE ILE A . n A 1 13 GLN 13 12 12 GLN GLN A . n A 1 14 LEU 14 13 13 LEU LEU A . n A 1 15 GLY 15 14 14 GLY GLY A . n A 1 16 LEU 16 15 15 LEU LEU A . n A 1 17 ASN 17 16 16 ASN ASN A . n A 1 18 GLN 18 17 17 GLN GLN A . n A 1 19 ALA 19 18 18 ALA ALA A . n A 1 20 GLU 20 19 19 GLU GLU A . n A 1 21 LEU 21 20 20 LEU LEU A . n A 1 22 ALA 22 21 21 ALA ALA A . n A 1 23 GLN 23 22 22 GLN GLN A . n A 1 24 LYS 24 23 23 LYS LYS A . n A 1 25 VAL 25 24 24 VAL VAL A . n A 1 26 GLY 26 25 25 GLY GLY A . n A 1 27 VAL 27 26 26 VAL VAL A . n A 1 28 ASP 28 27 27 ASP ASP A . n A 1 29 GLN 29 28 28 GLN GLN A . n A 1 30 GLN 30 29 29 GLN GLN A . n A 1 31 ALA 31 30 30 ALA ALA A . n A 1 32 ILE 32 31 31 ILE ILE A . n A 1 33 GLU 33 32 32 GLU GLU A . n A 1 34 GLN 34 33 33 GLN GLN A . n A 1 35 LEU 35 34 34 LEU LEU A . n A 1 36 GLU 36 35 35 GLU GLU A . n A 1 37 ASN 37 36 36 ASN ASN A . n A 1 38 GLY 38 37 37 GLY GLY A . n A 1 39 LYS 39 38 38 LYS LYS A . n A 1 40 ALA 40 39 39 ALA ALA A . n A 1 41 LYS 41 40 40 LYS LYS A . n A 1 42 ARG 42 41 41 ARG ARG A . n A 1 43 PRO 43 42 42 PRO PRO A . n A 1 44 ARG 44 43 43 ARG ARG A . n A 1 45 PHE 45 44 44 PHE PHE A . n A 1 46 LEU 46 45 45 LEU LEU A . n A 1 47 PRO 47 46 46 PRO PRO A . n A 1 48 GLU 48 47 47 GLU GLU A . n A 1 49 LEU 49 48 48 LEU LEU A . n A 1 50 ALA 50 49 49 ALA ALA A . n A 1 51 ARG 51 50 50 ARG ARG A . n A 1 52 ALA 52 51 51 ALA ALA A . n A 1 53 LEU 53 52 52 LEU LEU A . n A 1 54 GLY 54 53 53 GLY GLY A . n A 1 55 VAL 55 54 54 VAL VAL A . n A 1 56 ALA 56 55 55 ALA ALA A . n A 1 57 VAL 57 56 56 VAL VAL A . n A 1 58 ASP 58 57 57 ASP ASP A . n A 1 59 TRP 59 58 58 TRP TRP A . n A 1 60 LEU 60 59 59 LEU LEU A . n A 1 61 LEU 61 60 60 LEU LEU A . n A 1 62 ASN 62 61 61 ASN ASN A . n A 1 63 GLY 63 62 62 GLY GLY A . n A 1 64 ALA 64 63 63 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-07-20 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH1 A ARG 10 ? ? 123.99 120.30 3.69 0.50 N 2 1 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH2 A ARG 10 ? ? 116.52 120.30 -3.78 0.50 N 3 2 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH2 A ARG 10 ? ? 116.92 120.30 -3.38 0.50 N 4 3 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH2 A ARG 10 ? ? 116.56 120.30 -3.74 0.50 N 5 4 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH2 A ARG 10 ? ? 117.22 120.30 -3.08 0.50 N 6 5 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH1 A ARG 10 ? ? 124.07 120.30 3.77 0.50 N 7 5 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH2 A ARG 10 ? ? 115.37 120.30 -4.93 0.50 N 8 6 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.58 120.30 3.28 0.50 N 9 7 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH1 A ARG 10 ? ? 123.67 120.30 3.37 0.50 N 10 7 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH2 A ARG 10 ? ? 116.60 120.30 -3.70 0.50 N 11 8 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH2 A ARG 10 ? ? 116.84 120.30 -3.46 0.50 N 12 9 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH2 A ARG 10 ? ? 116.61 120.30 -3.69 0.50 N 13 11 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH1 A ARG 10 ? ? 123.90 120.30 3.60 0.50 N 14 12 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH1 A ARG 10 ? ? 124.06 120.30 3.76 0.50 N 15 12 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH2 A ARG 10 ? ? 116.62 120.30 -3.68 0.50 N 16 14 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH1 A ARG 10 ? ? 124.44 120.30 4.14 0.50 N 17 17 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH2 A ARG 10 ? ? 116.12 120.30 -4.18 0.50 N 18 18 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH2 A ARG 10 ? ? 117.14 120.30 -3.16 0.50 N 19 19 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH1 A ARG 10 ? ? 124.08 120.30 3.78 0.50 N 20 19 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH2 A ARG 10 ? ? 117.29 120.30 -3.01 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 40 ? ? -76.62 -76.18 2 2 LEU A 1 ? ? 85.94 -176.26 3 2 LYS A 40 ? ? -125.38 -66.67 4 4 LYS A 40 ? ? -76.38 -76.36 5 5 ARG A 43 ? ? -60.77 4.21 6 6 PHE A 44 ? ? -69.07 7.05 7 7 LYS A 40 ? ? -77.50 -72.35 8 10 LYS A 40 ? ? -95.83 -70.71 9 10 ASN A 61 ? ? -98.96 -72.89 10 11 LYS A 40 ? ? -73.06 -72.51 11 13 LEU A 1 ? ? 83.04 -163.42 12 14 LEU A 1 ? ? 86.73 -172.92 13 15 LYS A 40 ? ? -122.89 -70.43 14 15 ASN A 61 ? ? -102.52 -73.36 15 16 LYS A 40 ? ? -131.33 -63.22 16 17 LYS A 40 ? ? -122.58 -72.19 17 19 ASN A 61 ? ? -85.56 -76.67 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 7 ? ? 0.080 'SIDE CHAIN' 2 4 ARG A 5 ? ? 0.084 'SIDE CHAIN' 3 4 ARG A 9 ? ? 0.083 'SIDE CHAIN' 4 6 ARG A 9 ? ? 0.083 'SIDE CHAIN' 5 8 ARG A 9 ? ? 0.099 'SIDE CHAIN' 6 9 ARG A 41 ? ? 0.076 'SIDE CHAIN' 7 11 ARG A 7 ? ? 0.152 'SIDE CHAIN' 8 12 ARG A 43 ? ? 0.076 'SIDE CHAIN' 9 15 ARG A 41 ? ? 0.075 'SIDE CHAIN' 10 17 ARG A 5 ? ? 0.121 'SIDE CHAIN' 11 18 ARG A 5 ? ? 0.133 'SIDE CHAIN' 12 18 ARG A 50 ? ? 0.084 'SIDE CHAIN' 13 20 ARG A 9 ? ? 0.080 'SIDE CHAIN' 14 20 ARG A 10 ? ? 0.089 'SIDE CHAIN' #