data_1SQR # _entry.id 1SQR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1SQR pdb_00001sqr 10.2210/pdb1sqr/pdb RCSB RCSB021928 ? ? WWPDB D_1000021928 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-16 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_related 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_related.db_name' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1SQR _pdbx_database_status.recvd_initial_deposition_date 2004-03-19 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_mr REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id PfR48 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Snyder, D.A.' 1 'Aramini, J.M.' 2 'Huang, Y.J.' 3 'Xiao, R.' 4 'Cort, J.R.' 5 'Shastry, R.' 6 'Ma, L.C.' 7 'Liu, J.' 8 'Rost, B.' 9 'Acton, T.B.' 10 'Kennedy, M.A.' 11 'Montelione, G.T.' 12 'Northeast Structural Genomics Consortium (NESG)' 13 # _citation.id primary _citation.title ;Solution Structure of the 50S Ribosomal Protein L35AE from Pyrococcus furiosus: Northeast Structural Genomics Consortium Target PfR48 ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Snyder, D.A.' 1 ? primary 'Aramini, J.M.' 2 ? primary 'Huang, Y.J.' 3 ? primary 'Xiao, R.' 4 ? primary 'Cort, J.R.' 5 ? primary 'Shastry, R.' 6 ? primary 'Ma, L.C.' 7 ? primary 'Liu, J.' 8 ? primary 'Rost, B.' 9 ? primary 'Acton, T.B.' 10 ? primary 'Kennedy, M.A.' 11 ? primary 'Montelione, G.T.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description '50S ribosomal protein L35Ae' _entity.formula_weight 10826.713 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRIKGVVLSYRRSKENQHNNVMIIKPLDVNSREEASKLIGRLVLWKSPSGKILKGKIVRVHGTKGAVRARFEKGLPGQAL GDYVEIVLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MRIKGVVLSYRRSKENQHNNVMIIKPLDVNSREEASKLIGRLVLWKSPSGKILKGKIVRVHGTKGAVRARFEKGLPGQAL GDYVEIVLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier PfR48 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 ILE n 1 4 LYS n 1 5 GLY n 1 6 VAL n 1 7 VAL n 1 8 LEU n 1 9 SER n 1 10 TYR n 1 11 ARG n 1 12 ARG n 1 13 SER n 1 14 LYS n 1 15 GLU n 1 16 ASN n 1 17 GLN n 1 18 HIS n 1 19 ASN n 1 20 ASN n 1 21 VAL n 1 22 MET n 1 23 ILE n 1 24 ILE n 1 25 LYS n 1 26 PRO n 1 27 LEU n 1 28 ASP n 1 29 VAL n 1 30 ASN n 1 31 SER n 1 32 ARG n 1 33 GLU n 1 34 GLU n 1 35 ALA n 1 36 SER n 1 37 LYS n 1 38 LEU n 1 39 ILE n 1 40 GLY n 1 41 ARG n 1 42 LEU n 1 43 VAL n 1 44 LEU n 1 45 TRP n 1 46 LYS n 1 47 SER n 1 48 PRO n 1 49 SER n 1 50 GLY n 1 51 LYS n 1 52 ILE n 1 53 LEU n 1 54 LYS n 1 55 GLY n 1 56 LYS n 1 57 ILE n 1 58 VAL n 1 59 ARG n 1 60 VAL n 1 61 HIS n 1 62 GLY n 1 63 THR n 1 64 LYS n 1 65 GLY n 1 66 ALA n 1 67 VAL n 1 68 ARG n 1 69 ALA n 1 70 ARG n 1 71 PHE n 1 72 GLU n 1 73 LYS n 1 74 GLY n 1 75 LEU n 1 76 PRO n 1 77 GLY n 1 78 GLN n 1 79 ALA n 1 80 LEU n 1 81 GLY n 1 82 ASP n 1 83 TYR n 1 84 VAL n 1 85 GLU n 1 86 ILE n 1 87 VAL n 1 88 LEU n 1 89 GLU n 1 90 HIS n 1 91 HIS n 1 92 HIS n 1 93 HIS n 1 94 HIS n 1 95 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pyrococcus _entity_src_gen.pdbx_gene_src_gene 'RPL35AE, PF1872' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus furiosus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2261 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)MGK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 TRP 45 45 45 TRP TRP A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 LEU 88 88 ? ? ? A . n A 1 89 GLU 89 89 ? ? ? A . n A 1 90 HIS 90 90 ? ? ? A . n A 1 91 HIS 91 91 ? ? ? A . n A 1 92 HIS 92 92 ? ? ? A . n A 1 93 HIS 93 93 ? ? ? A . n A 1 94 HIS 94 94 ? ? ? A . n A 1 95 HIS 95 95 ? ? ? A . n # _cell.entry_id 1SQR _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1SQR _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1SQR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1SQR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1SQR _struct.title ;Solution Structure of the 50S Ribosomal Protein L35AE from Pyrococcus furiosus. Northeast Structural Genomics Consortium Target PfR48. ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1SQR _struct_keywords.pdbx_keywords RIBOSOME _struct_keywords.text ;PfR48, AUTOSTRUCTURE, RIBOSOMAL PROTEIN, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, BETA-BARREL, NESG, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, RIBOSOME ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RL35A_PYRFU _struct_ref.pdbx_db_accession Q8TZV6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRIKGVVLSYRRSKENQHNNVMIIKPLDVNSREEASKLIGRLVLWKSPSGKILKGKIVRVHGTKGAVRARFEKGLPGQAL GDYVEIV ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1SQR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 87 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8TZV6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 87 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 87 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1SQR LEU A 88 ? UNP Q8TZV6 ? ? 'cloning artifact' 88 1 1 1SQR GLU A 89 ? UNP Q8TZV6 ? ? 'cloning artifact' 89 2 1 1SQR HIS A 90 ? UNP Q8TZV6 ? ? 'cloning artifact' 90 3 1 1SQR HIS A 91 ? UNP Q8TZV6 ? ? 'cloning artifact' 91 4 1 1SQR HIS A 92 ? UNP Q8TZV6 ? ? 'cloning artifact' 92 5 1 1SQR HIS A 93 ? UNP Q8TZV6 ? ? 'cloning artifact' 93 6 1 1SQR HIS A 94 ? UNP Q8TZV6 ? ? 'cloning artifact' 94 7 1 1SQR HIS A 95 ? UNP Q8TZV6 ? ? 'cloning artifact' 95 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 31 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ILE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 39 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 31 _struct_conf.end_auth_comp_id ILE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 39 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 42 ? TRP A 45 ? LEU A 42 TRP A 45 A 2 LEU A 53 ? VAL A 60 ? LEU A 53 VAL A 60 A 3 VAL A 67 ? ARG A 70 ? VAL A 67 ARG A 70 A 4 VAL A 21 ? PRO A 26 ? VAL A 21 PRO A 26 A 5 LYS A 4 ? ARG A 11 ? LYS A 4 ARG A 11 A 6 TYR A 83 ? GLU A 85 ? TYR A 83 GLU A 85 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TRP A 45 ? N TRP A 45 O LEU A 53 ? O LEU A 53 A 2 3 N ARG A 59 ? N ARG A 59 O ARG A 68 ? O ARG A 68 A 3 4 O ALA A 69 ? O ALA A 69 N MET A 22 ? N MET A 22 A 4 5 O LYS A 25 ? O LYS A 25 N VAL A 6 ? N VAL A 6 A 5 6 N GLY A 5 ? N GLY A 5 O VAL A 84 ? O VAL A 84 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A GLY 62 ? ? HG1 A THR 63 ? ? 1.56 2 2 O A ARG 32 ? ? H A SER 36 ? ? 1.59 3 8 O A GLU 15 ? ? H A GLN 17 ? ? 1.45 4 8 O A THR 63 ? ? H A GLY 65 ? ? 1.45 5 10 O A LYS 73 ? ? H A LEU 75 ? ? 1.52 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 8 ? ? -109.86 -61.32 2 1 ARG A 12 ? ? -100.16 62.51 3 1 SER A 13 ? ? -38.80 117.63 4 1 GLU A 15 ? ? -58.33 -162.35 5 1 GLN A 17 ? ? -158.47 16.71 6 1 HIS A 18 ? ? -173.79 -5.25 7 1 ASN A 19 ? ? 68.30 173.66 8 1 LEU A 27 ? ? -19.33 -85.32 9 1 ASP A 28 ? ? -93.10 -91.86 10 1 PRO A 48 ? ? -47.96 178.11 11 1 VAL A 58 ? ? -99.00 -63.46 12 1 THR A 63 ? ? 51.10 -94.85 13 1 LYS A 64 ? ? -94.50 50.17 14 1 GLN A 78 ? ? 47.66 95.07 15 1 ILE A 86 ? ? -109.40 73.49 16 2 ARG A 12 ? ? -91.66 59.31 17 2 SER A 13 ? ? 56.09 -82.74 18 2 LYS A 14 ? ? 63.22 -170.84 19 2 GLU A 15 ? ? -55.34 -179.49 20 2 ASN A 16 ? ? 47.35 92.86 21 2 GLN A 17 ? ? -37.91 133.00 22 2 HIS A 18 ? ? -176.41 11.13 23 2 ASN A 19 ? ? 53.70 171.29 24 2 PRO A 26 ? ? -59.57 72.41 25 2 LEU A 27 ? ? 51.99 -116.33 26 2 ASP A 28 ? ? -74.00 -92.78 27 2 ASN A 30 ? ? -92.29 47.40 28 2 SER A 49 ? ? -69.01 39.97 29 2 THR A 63 ? ? 51.55 -88.11 30 2 LYS A 64 ? ? -90.18 51.74 31 2 ALA A 66 ? ? -68.71 -177.89 32 2 LYS A 73 ? ? -81.55 -77.72 33 2 ALA A 79 ? ? -163.10 23.80 34 2 ILE A 86 ? ? -107.97 72.46 35 3 ARG A 12 ? ? -104.57 61.11 36 3 SER A 13 ? ? 36.65 60.18 37 3 LYS A 14 ? ? -38.78 -80.09 38 3 GLU A 15 ? ? -66.10 -88.90 39 3 ASN A 16 ? ? -163.89 102.69 40 3 HIS A 18 ? ? -169.69 -59.25 41 3 ASN A 19 ? ? 166.72 -32.59 42 3 PRO A 26 ? ? -61.44 87.54 43 3 LEU A 27 ? ? 36.32 -133.82 44 3 ASP A 28 ? ? -44.04 -92.73 45 3 ASN A 30 ? ? -82.60 41.69 46 3 ILE A 39 ? ? -48.52 -19.88 47 3 SER A 49 ? ? -69.66 5.07 48 3 THR A 63 ? ? 55.95 156.41 49 3 LYS A 64 ? ? 68.98 -21.05 50 3 ALA A 66 ? ? 176.38 147.57 51 3 LYS A 73 ? ? -156.28 -65.19 52 3 GLN A 78 ? ? -169.01 -69.25 53 3 ILE A 86 ? ? -105.76 72.74 54 4 SER A 13 ? ? -178.48 -124.27 55 4 GLU A 15 ? ? 63.08 -73.23 56 4 ASN A 16 ? ? 39.19 -109.71 57 4 GLN A 17 ? ? -151.79 36.33 58 4 HIS A 18 ? ? -163.85 -9.48 59 4 LEU A 27 ? ? -34.05 -82.91 60 4 ASP A 28 ? ? -87.09 -86.84 61 4 ASN A 30 ? ? -91.98 33.82 62 4 THR A 63 ? ? 56.35 142.47 63 4 LYS A 64 ? ? 57.59 17.85 64 4 ALA A 66 ? ? -68.70 -178.43 65 4 LYS A 73 ? ? -81.59 -78.28 66 4 PRO A 76 ? ? -53.61 -81.06 67 4 ALA A 79 ? ? -83.88 39.68 68 4 ILE A 86 ? ? -100.57 72.41 69 5 SER A 13 ? ? 66.22 171.70 70 5 LYS A 14 ? ? -170.54 49.83 71 5 GLU A 15 ? ? -163.64 -61.85 72 5 GLN A 17 ? ? 35.83 -110.76 73 5 HIS A 18 ? ? -173.39 25.49 74 5 ASN A 19 ? ? -39.38 121.65 75 5 PRO A 26 ? ? -66.02 82.81 76 5 LEU A 27 ? ? 33.04 -82.95 77 5 ASP A 28 ? ? -98.40 -87.27 78 5 ASN A 30 ? ? -91.81 42.01 79 5 PRO A 48 ? ? -49.01 91.56 80 5 SER A 49 ? ? 38.69 60.86 81 5 THR A 63 ? ? 58.67 138.57 82 5 LYS A 73 ? ? -84.05 -80.43 83 5 ILE A 86 ? ? -110.10 72.79 84 6 LEU A 8 ? ? -109.49 -60.84 85 6 SER A 13 ? ? -47.12 165.71 86 6 LYS A 14 ? ? -120.95 -96.15 87 6 GLN A 17 ? ? -58.71 100.99 88 6 HIS A 18 ? ? -174.76 -12.11 89 6 ASN A 19 ? ? 67.43 -178.02 90 6 PRO A 26 ? ? -64.41 70.90 91 6 LEU A 27 ? ? 51.01 -79.98 92 6 ASP A 28 ? ? -109.81 -87.17 93 6 ASN A 30 ? ? -91.88 43.30 94 6 SER A 47 ? ? -173.47 79.77 95 6 LYS A 51 ? ? -175.00 139.09 96 6 THR A 63 ? ? 58.69 -89.32 97 6 LYS A 64 ? ? -90.84 55.51 98 6 ALA A 66 ? ? -69.22 -177.65 99 6 LYS A 73 ? ? -82.68 -77.87 100 6 PRO A 76 ? ? -49.16 -179.26 101 6 GLN A 78 ? ? -135.01 -142.71 102 6 ALA A 79 ? ? 64.32 -10.12 103 6 LEU A 80 ? ? -66.64 99.34 104 6 ILE A 86 ? ? -103.65 74.08 105 7 ARG A 12 ? ? -115.31 75.30 106 7 SER A 13 ? ? -48.70 165.49 107 7 GLU A 15 ? ? -144.31 -55.83 108 7 ASN A 16 ? ? -80.15 -156.76 109 7 HIS A 18 ? ? -156.93 21.41 110 7 ASN A 20 ? ? -171.80 122.25 111 7 LEU A 27 ? ? -49.55 -77.49 112 7 ASP A 28 ? ? -94.51 -88.61 113 7 ASN A 30 ? ? -88.51 40.62 114 7 SER A 49 ? ? -78.72 21.54 115 7 THR A 63 ? ? 54.79 164.91 116 7 LYS A 64 ? ? 67.10 -17.30 117 7 ALA A 66 ? ? 174.68 149.01 118 7 LYS A 73 ? ? -154.88 -64.70 119 7 ALA A 79 ? ? -154.40 8.14 120 7 ILE A 86 ? ? -101.06 73.30 121 8 ASN A 16 ? ? 64.21 -47.10 122 8 GLN A 17 ? ? -77.84 45.80 123 8 HIS A 18 ? ? -161.74 -26.09 124 8 ASN A 19 ? ? 69.92 161.15 125 8 LEU A 27 ? ? -45.28 -80.79 126 8 ASP A 28 ? ? -93.80 -84.90 127 8 VAL A 29 ? ? 39.99 53.63 128 8 ASN A 30 ? ? -88.53 44.36 129 8 SER A 36 ? ? -44.38 -18.61 130 8 ILE A 39 ? ? -48.63 -16.31 131 8 LYS A 51 ? ? -165.16 101.06 132 8 THR A 63 ? ? 53.53 171.87 133 8 LYS A 64 ? ? 65.57 -52.94 134 8 ALA A 66 ? ? 174.87 159.59 135 8 LYS A 73 ? ? -80.96 -77.60 136 8 PRO A 76 ? ? -76.06 -82.89 137 8 GLN A 78 ? ? 70.32 62.93 138 8 ILE A 86 ? ? -103.44 74.48 139 9 LYS A 14 ? ? -148.47 -45.55 140 9 ASN A 16 ? ? 68.61 -5.95 141 9 GLN A 17 ? ? 65.93 124.83 142 9 HIS A 18 ? ? -169.70 -6.36 143 9 ASN A 19 ? ? 69.74 161.82 144 9 PRO A 26 ? ? -67.86 59.20 145 9 LEU A 27 ? ? 54.31 -79.76 146 9 ASP A 28 ? ? -101.29 -90.75 147 9 THR A 63 ? ? 68.22 -34.18 148 9 ALA A 66 ? ? 172.68 150.26 149 9 GLU A 72 ? ? -74.95 36.50 150 9 LYS A 73 ? ? 93.28 -32.97 151 9 PRO A 76 ? ? -69.34 -174.90 152 9 GLN A 78 ? ? 69.48 145.81 153 9 ALA A 79 ? ? 166.91 -21.00 154 9 ILE A 86 ? ? -108.69 73.20 155 10 ARG A 12 ? ? -101.35 62.31 156 10 SER A 13 ? ? 59.69 164.58 157 10 LYS A 14 ? ? -133.18 -69.67 158 10 ASN A 16 ? ? 46.29 81.42 159 10 HIS A 18 ? ? -175.46 -54.52 160 10 ASN A 19 ? ? -178.32 -153.87 161 10 PRO A 26 ? ? -65.17 74.12 162 10 LEU A 27 ? ? 37.92 -82.64 163 10 ASP A 28 ? ? -99.24 -87.11 164 10 ASN A 30 ? ? -93.63 47.22 165 10 SER A 49 ? ? -70.50 20.64 166 10 THR A 63 ? ? 52.92 -99.99 167 10 ALA A 66 ? ? -67.90 -177.50 168 10 LYS A 73 ? ? -160.03 -45.66 169 10 PRO A 76 ? ? -59.08 -80.95 170 10 ILE A 86 ? ? -110.01 72.05 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 2 ? ? 0.226 'SIDE CHAIN' 2 1 ARG A 12 ? ? 0.309 'SIDE CHAIN' 3 1 ARG A 59 ? ? 0.206 'SIDE CHAIN' 4 1 ARG A 68 ? ? 0.257 'SIDE CHAIN' 5 1 ARG A 70 ? ? 0.212 'SIDE CHAIN' 6 2 ARG A 2 ? ? 0.296 'SIDE CHAIN' 7 2 ARG A 11 ? ? 0.238 'SIDE CHAIN' 8 2 ARG A 12 ? ? 0.309 'SIDE CHAIN' 9 2 ARG A 32 ? ? 0.203 'SIDE CHAIN' 10 2 ARG A 41 ? ? 0.110 'SIDE CHAIN' 11 2 ARG A 59 ? ? 0.241 'SIDE CHAIN' 12 2 ARG A 68 ? ? 0.129 'SIDE CHAIN' 13 2 ARG A 70 ? ? 0.173 'SIDE CHAIN' 14 3 ARG A 2 ? ? 0.117 'SIDE CHAIN' 15 3 ARG A 11 ? ? 0.195 'SIDE CHAIN' 16 3 ARG A 12 ? ? 0.282 'SIDE CHAIN' 17 3 ARG A 32 ? ? 0.157 'SIDE CHAIN' 18 3 ARG A 41 ? ? 0.195 'SIDE CHAIN' 19 3 ARG A 59 ? ? 0.308 'SIDE CHAIN' 20 3 ARG A 68 ? ? 0.270 'SIDE CHAIN' 21 3 ARG A 70 ? ? 0.182 'SIDE CHAIN' 22 4 ARG A 2 ? ? 0.268 'SIDE CHAIN' 23 4 ARG A 11 ? ? 0.153 'SIDE CHAIN' 24 4 ARG A 12 ? ? 0.211 'SIDE CHAIN' 25 4 ARG A 32 ? ? 0.303 'SIDE CHAIN' 26 4 ARG A 41 ? ? 0.221 'SIDE CHAIN' 27 4 ARG A 59 ? ? 0.233 'SIDE CHAIN' 28 4 ARG A 68 ? ? 0.183 'SIDE CHAIN' 29 4 ARG A 70 ? ? 0.133 'SIDE CHAIN' 30 5 ARG A 2 ? ? 0.306 'SIDE CHAIN' 31 5 ARG A 11 ? ? 0.296 'SIDE CHAIN' 32 5 ARG A 12 ? ? 0.094 'SIDE CHAIN' 33 5 ARG A 32 ? ? 0.244 'SIDE CHAIN' 34 5 ARG A 41 ? ? 0.299 'SIDE CHAIN' 35 5 ARG A 68 ? ? 0.310 'SIDE CHAIN' 36 5 ARG A 70 ? ? 0.199 'SIDE CHAIN' 37 6 ARG A 2 ? ? 0.308 'SIDE CHAIN' 38 6 ARG A 11 ? ? 0.291 'SIDE CHAIN' 39 6 ARG A 12 ? ? 0.218 'SIDE CHAIN' 40 6 ARG A 32 ? ? 0.180 'SIDE CHAIN' 41 6 ARG A 41 ? ? 0.159 'SIDE CHAIN' 42 6 ARG A 59 ? ? 0.309 'SIDE CHAIN' 43 6 ARG A 68 ? ? 0.151 'SIDE CHAIN' 44 6 ARG A 70 ? ? 0.096 'SIDE CHAIN' 45 7 ARG A 2 ? ? 0.098 'SIDE CHAIN' 46 7 ARG A 11 ? ? 0.240 'SIDE CHAIN' 47 7 ARG A 32 ? ? 0.167 'SIDE CHAIN' 48 7 ARG A 41 ? ? 0.306 'SIDE CHAIN' 49 7 ARG A 59 ? ? 0.309 'SIDE CHAIN' 50 7 ARG A 68 ? ? 0.240 'SIDE CHAIN' 51 7 ARG A 70 ? ? 0.239 'SIDE CHAIN' 52 8 ARG A 2 ? ? 0.308 'SIDE CHAIN' 53 8 ARG A 11 ? ? 0.247 'SIDE CHAIN' 54 8 ARG A 12 ? ? 0.300 'SIDE CHAIN' 55 8 ARG A 32 ? ? 0.127 'SIDE CHAIN' 56 8 ARG A 41 ? ? 0.183 'SIDE CHAIN' 57 8 ARG A 68 ? ? 0.226 'SIDE CHAIN' 58 8 ARG A 70 ? ? 0.088 'SIDE CHAIN' 59 9 ARG A 2 ? ? 0.206 'SIDE CHAIN' 60 9 ARG A 11 ? ? 0.125 'SIDE CHAIN' 61 9 ARG A 12 ? ? 0.259 'SIDE CHAIN' 62 9 ARG A 41 ? ? 0.193 'SIDE CHAIN' 63 9 ARG A 59 ? ? 0.308 'SIDE CHAIN' 64 9 ARG A 68 ? ? 0.307 'SIDE CHAIN' 65 9 ARG A 70 ? ? 0.120 'SIDE CHAIN' 66 10 ARG A 2 ? ? 0.090 'SIDE CHAIN' 67 10 ARG A 11 ? ? 0.308 'SIDE CHAIN' 68 10 ARG A 12 ? ? 0.209 'SIDE CHAIN' 69 10 ARG A 32 ? ? 0.203 'SIDE CHAIN' 70 10 ARG A 41 ? ? 0.286 'SIDE CHAIN' 71 10 ARG A 59 ? ? 0.300 'SIDE CHAIN' 72 10 ARG A 68 ? ? 0.199 'SIDE CHAIN' 73 10 ARG A 70 ? ? 0.280 'SIDE CHAIN' # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_nmr_ensemble.entry_id 1SQR _pdbx_nmr_ensemble.conformers_calculated_total_number 56 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1SQR _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1.07 MM PfR48 U-15N,13C 20 MM MES, 100 MM NACL, 5 MM CACL2, 10 MM DTT, 0.02% NAN3, PH 6.5' '95% H2O/5% D2O' 2 '1.07 MM PfR48 U-15N,13C 20 MM MES, 100 MM NACL, 5 MM CACL2, 10 MM DTT, 0.02% NAN3, PH 6.5' '100% D2O' 3 '0.1 MM PfR48 U-15N,5%-13C 20 MM MES, 100 MM NACL, 5 MM CACL2, 10 MM DTT, 0.02% NAN3, PH 6.5' '95% H2O/5% D2O' 4 '0.5 MM PfR48 U-15N 20 MM MES, 100 MM NACL, 5 MM CACL2, 10 MM DTT, 0.02% NAN3, PH 6.5' '95% H2O/5% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '3D 13C-NOESY (aliphatic), HCCH-COSY' 2 2 1 '3D 13C-NOESY (aliphatic and aromatic), 13C,1H-HSQC' 3 2 1 4D_13C-separated_NOESY 4 1 1 3D-TOCSYs 5 4 1 'H/D EXCHANGE' 6 3 1 '3D 15N-NOESY, backbone TR experiments' 7 1 1 'high-resolution/non-constant-time 13C,1H-HSQC' # _pdbx_nmr_details.entry_id 1SQR _pdbx_nmr_details.text ;THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY. AUTOMATIC BACKBONE RESONANCE ASSIGNMENTS WERE MADE USING AUTOASSIGN. MANUAL SIDE CHAIN ASSIGNMENTS. AUTOMATIC NOESY ASSIGNMENTS AS WELL AS DISTANCE AND HYDROGEN BOND RESTRAINTS WERE DETERMINED USING AUTOSTRUCTURE. DIHEDRAL ANGLE RESTRAINTS WERE DETERMINED USING HYPER AND TALOS. BACKBONE DIHEDRAL ANGLES FOR RESIDUES 1, 13-20, 26-27, 39-40, 47-51, 54, 63-66 AND 73-79 ARE NOT WELL-DEFINED [S(PHI) + S(PSI) < 1.8] IN THIS SOLUTION NMR STRUCTURE. ; # _pdbx_nmr_refine.entry_id 1SQR _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;THE STRUCTURES ARE BASED ON A TOTAL OF 1157 CONFORMATIONALLY-RESTRICTING NOE-DERIVED DISTANCE RESTRAINTS, 177 DIHEDRAL ANGLE RESTRAINTS, AND 32 HYDROGEN BOND RESTRAINTS. (14.4 CONSTRAINTS PER RESIDUE; 6.1 LONG-RANGE RESTRAINTS PER RESIDUE). STRUCTURE DETERMINATION WAS PERFORMED ITERATIVELY USING AUTOSTRUCTURE (XPLOR). THE UNSTRUCTURED 8 RESIDUE C-TERMINAL TAG (LEHHHHHH) WAS INCLUDED IN THE STRUCTURE CALCULATIONS BUT IS OMITTED FROM THIS DEPOSITION. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 'NIH 2.0.6' refinement 'Schwieters, et al.' 1 VNMR 6.1B collection Varian 2 NMRPipe 2.1 processing 'Delaglio, et al.' 3 Sparky 3.106 'data analysis' Goddard 4 PdbStat 3.32 'structure solution' 'Tejero and Montelione' 5 AutoStructure 2.0.0 refinement 'Huang and Montelione' 6 HYPER 3.2 'structure solution' 'Tejero and Montelione' 7 AutoAssign 1.9 'data analysis' 'Zimmerman, Moseley and Montelione' 8 TALOS 2.1 'structure solution' 'Cornilescu, Delaglio and Bax' 9 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 88 ? A LEU 88 2 1 Y 1 A GLU 89 ? A GLU 89 3 1 Y 1 A HIS 90 ? A HIS 90 4 1 Y 1 A HIS 91 ? A HIS 91 5 1 Y 1 A HIS 92 ? A HIS 92 6 1 Y 1 A HIS 93 ? A HIS 93 7 1 Y 1 A HIS 94 ? A HIS 94 8 1 Y 1 A HIS 95 ? A HIS 95 9 2 Y 1 A LEU 88 ? A LEU 88 10 2 Y 1 A GLU 89 ? A GLU 89 11 2 Y 1 A HIS 90 ? A HIS 90 12 2 Y 1 A HIS 91 ? A HIS 91 13 2 Y 1 A HIS 92 ? A HIS 92 14 2 Y 1 A HIS 93 ? A HIS 93 15 2 Y 1 A HIS 94 ? A HIS 94 16 2 Y 1 A HIS 95 ? A HIS 95 17 3 Y 1 A LEU 88 ? A LEU 88 18 3 Y 1 A GLU 89 ? A GLU 89 19 3 Y 1 A HIS 90 ? A HIS 90 20 3 Y 1 A HIS 91 ? A HIS 91 21 3 Y 1 A HIS 92 ? A HIS 92 22 3 Y 1 A HIS 93 ? A HIS 93 23 3 Y 1 A HIS 94 ? A HIS 94 24 3 Y 1 A HIS 95 ? A HIS 95 25 4 Y 1 A LEU 88 ? A LEU 88 26 4 Y 1 A GLU 89 ? A GLU 89 27 4 Y 1 A HIS 90 ? A HIS 90 28 4 Y 1 A HIS 91 ? A HIS 91 29 4 Y 1 A HIS 92 ? A HIS 92 30 4 Y 1 A HIS 93 ? A HIS 93 31 4 Y 1 A HIS 94 ? A HIS 94 32 4 Y 1 A HIS 95 ? A HIS 95 33 5 Y 1 A LEU 88 ? A LEU 88 34 5 Y 1 A GLU 89 ? A GLU 89 35 5 Y 1 A HIS 90 ? A HIS 90 36 5 Y 1 A HIS 91 ? A HIS 91 37 5 Y 1 A HIS 92 ? A HIS 92 38 5 Y 1 A HIS 93 ? A HIS 93 39 5 Y 1 A HIS 94 ? A HIS 94 40 5 Y 1 A HIS 95 ? A HIS 95 41 6 Y 1 A LEU 88 ? A LEU 88 42 6 Y 1 A GLU 89 ? A GLU 89 43 6 Y 1 A HIS 90 ? A HIS 90 44 6 Y 1 A HIS 91 ? A HIS 91 45 6 Y 1 A HIS 92 ? A HIS 92 46 6 Y 1 A HIS 93 ? A HIS 93 47 6 Y 1 A HIS 94 ? A HIS 94 48 6 Y 1 A HIS 95 ? A HIS 95 49 7 Y 1 A LEU 88 ? A LEU 88 50 7 Y 1 A GLU 89 ? A GLU 89 51 7 Y 1 A HIS 90 ? A HIS 90 52 7 Y 1 A HIS 91 ? A HIS 91 53 7 Y 1 A HIS 92 ? A HIS 92 54 7 Y 1 A HIS 93 ? A HIS 93 55 7 Y 1 A HIS 94 ? A HIS 94 56 7 Y 1 A HIS 95 ? A HIS 95 57 8 Y 1 A LEU 88 ? A LEU 88 58 8 Y 1 A GLU 89 ? A GLU 89 59 8 Y 1 A HIS 90 ? A HIS 90 60 8 Y 1 A HIS 91 ? A HIS 91 61 8 Y 1 A HIS 92 ? A HIS 92 62 8 Y 1 A HIS 93 ? A HIS 93 63 8 Y 1 A HIS 94 ? A HIS 94 64 8 Y 1 A HIS 95 ? A HIS 95 65 9 Y 1 A LEU 88 ? A LEU 88 66 9 Y 1 A GLU 89 ? A GLU 89 67 9 Y 1 A HIS 90 ? A HIS 90 68 9 Y 1 A HIS 91 ? A HIS 91 69 9 Y 1 A HIS 92 ? A HIS 92 70 9 Y 1 A HIS 93 ? A HIS 93 71 9 Y 1 A HIS 94 ? A HIS 94 72 9 Y 1 A HIS 95 ? A HIS 95 73 10 Y 1 A LEU 88 ? A LEU 88 74 10 Y 1 A GLU 89 ? A GLU 89 75 10 Y 1 A HIS 90 ? A HIS 90 76 10 Y 1 A HIS 91 ? A HIS 91 77 10 Y 1 A HIS 92 ? A HIS 92 78 10 Y 1 A HIS 93 ? A HIS 93 79 10 Y 1 A HIS 94 ? A HIS 94 80 10 Y 1 A HIS 95 ? A HIS 95 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 800 2 ? Varian INOVA 750 3 ? Varian INOVA 600 4 ? Varian UNITY 600 # _atom_sites.entry_id 1SQR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_