data_1SW8 # _entry.id 1SW8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1SW8 pdb_00001sw8 10.2210/pdb1sw8/pdb RCSB RCSB022048 ? ? WWPDB D_1000022048 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-04-06 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_spectrometer 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 28 4 'Structure model' '_struct_ref_seq_dif.details' 29 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 30 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 31 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1SW8 _pdbx_database_status.recvd_initial_deposition_date 2004-03-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id CIRMMP35 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bertini, I.' 1 'Del Bianco, C.' 2 'Gelis, I.' 3 'Katsaros, N.' 4 'Luchinat, C.' 5 'Parigi, G.' 6 'Peana, M.' 7 'Provenzani, A.' 8 'Zoroddu, M.A.' 9 'Structural Proteomics in Europe (SPINE)' 10 # _citation.id primary _citation.title 'Experimentally exploring the conformational space sampled by domain reorientation in calmodulin' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 101 _citation.page_first 6841 _citation.page_last 6846 _citation.year 2004 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15100408 _citation.pdbx_database_id_DOI 10.1073/pnas.0308641101 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bertini, I.' 1 ? primary 'Del Bianco, C.' 2 ? primary 'Gelis, I.' 3 ? primary 'Katsaros, N.' 4 ? primary 'Luchinat, C.' 5 ? primary 'Parigi, G.' 6 ? primary 'Peana, M.' 7 ? primary 'Provenzani, A.' 8 ? primary 'Zoroddu, M.A.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Calmodulin 8800.708 1 ? N60D 'N-terminal domain' ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDT _entity_poly.pdbx_seq_one_letter_code_can ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDT _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier CIRMMP35 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 GLN n 1 4 LEU n 1 5 THR n 1 6 GLU n 1 7 GLU n 1 8 GLN n 1 9 ILE n 1 10 ALA n 1 11 GLU n 1 12 PHE n 1 13 LYS n 1 14 GLU n 1 15 ALA n 1 16 PHE n 1 17 SER n 1 18 LEU n 1 19 PHE n 1 20 ASP n 1 21 LYS n 1 22 ASP n 1 23 GLY n 1 24 ASP n 1 25 GLY n 1 26 THR n 1 27 ILE n 1 28 THR n 1 29 THR n 1 30 LYS n 1 31 GLU n 1 32 LEU n 1 33 GLY n 1 34 THR n 1 35 VAL n 1 36 MET n 1 37 ARG n 1 38 SER n 1 39 LEU n 1 40 GLY n 1 41 GLN n 1 42 ASN n 1 43 PRO n 1 44 THR n 1 45 GLU n 1 46 ALA n 1 47 GLU n 1 48 LEU n 1 49 GLN n 1 50 ASP n 1 51 MET n 1 52 ILE n 1 53 ASN n 1 54 GLU n 1 55 VAL n 1 56 ASP n 1 57 ALA n 1 58 ASP n 1 59 GLY n 1 60 ASP n 1 61 GLY n 1 62 THR n 1 63 ILE n 1 64 ASP n 1 65 PHE n 1 66 PRO n 1 67 GLU n 1 68 PHE n 1 69 LEU n 1 70 THR n 1 71 MET n 1 72 MET n 1 73 ALA n 1 74 ARG n 1 75 LYS n 1 76 MET n 1 77 LYS n 1 78 ASP n 1 79 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 THR 79 79 79 THR THR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 80 80 CA CA A . C 2 CA 1 81 81 CA CA A . # _cell.entry_id 1SW8 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1SW8 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1SW8 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1SW8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1SW8 _struct.title 'Solution structure of the N-terminal domain of Human N60D calmodulin refined with paramagnetism based strategy' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1SW8 _struct_keywords.pdbx_keywords 'Calcium-Binding Protein' _struct_keywords.text 'calcium, calmodulin, EF-hand, lanthanide, Structural Proteomics in Europe, SPINE, Structural Genomics, Calcium-Binding Protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CALM_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDT _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_accession P62158 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1SW8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 79 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P62158 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 80 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 79 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1SW8 _struct_ref_seq_dif.mon_id ASP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 60 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P62158 _struct_ref_seq_dif.db_mon_id ASN _struct_ref_seq_dif.pdbx_seq_db_seq_num 61 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 60 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 4 ? ASP A 20 ? LEU A 4 ASP A 20 1 ? 17 HELX_P HELX_P2 2 THR A 28 ? LEU A 39 ? THR A 28 LEU A 39 1 ? 12 HELX_P HELX_P3 3 THR A 44 ? ASP A 56 ? THR A 44 ASP A 56 1 ? 13 HELX_P HELX_P4 4 PHE A 65 ? THR A 79 ? PHE A 65 THR A 79 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 20 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 20 A CA 80 1_555 ? ? ? ? ? ? ? 2.296 ? ? metalc2 metalc ? ? A ASP 22 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 22 A CA 80 1_555 ? ? ? ? ? ? ? 2.294 ? ? metalc3 metalc ? ? A GLY 23 N ? ? ? 1_555 B CA . CA ? ? A GLY 23 A CA 80 1_555 ? ? ? ? ? ? ? 2.798 ? ? metalc4 metalc ? ? A ASP 24 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 24 A CA 80 1_555 ? ? ? ? ? ? ? 2.790 ? ? metalc5 metalc ? ? A ASP 24 N ? ? ? 1_555 B CA . CA ? ? A ASP 24 A CA 80 1_555 ? ? ? ? ? ? ? 2.868 ? ? metalc6 metalc ? ? A THR 26 O ? ? ? 1_555 B CA . CA ? ? A THR 26 A CA 80 1_555 ? ? ? ? ? ? ? 2.368 ? ? metalc7 metalc ? ? A GLU 31 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 31 A CA 80 1_555 ? ? ? ? ? ? ? 2.852 ? ? metalc8 metalc ? ? A GLU 31 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 31 A CA 80 1_555 ? ? ? ? ? ? ? 2.757 ? ? metalc9 metalc ? ? A ASP 56 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 56 A CA 81 1_555 ? ? ? ? ? ? ? 2.194 ? ? metalc10 metalc ? ? A ASP 58 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 58 A CA 81 1_555 ? ? ? ? ? ? ? 2.808 ? ? metalc11 metalc ? ? A ASP 60 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 60 A CA 81 1_555 ? ? ? ? ? ? ? 3.015 ? ? metalc12 metalc ? ? A ASP 60 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 60 A CA 81 1_555 ? ? ? ? ? ? ? 2.186 ? ? metalc13 metalc ? ? A THR 62 N ? ? ? 1_555 C CA . CA ? ? A THR 62 A CA 81 1_555 ? ? ? ? ? ? ? 3.175 ? ? metalc14 metalc ? ? A THR 62 O ? ? ? 1_555 C CA . CA ? ? A THR 62 A CA 81 1_555 ? ? ? ? ? ? ? 2.240 ? ? metalc15 metalc ? ? A GLU 67 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 67 A CA 81 1_555 ? ? ? ? ? ? ? 2.856 ? ? metalc16 metalc ? ? A GLU 67 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 67 A CA 81 1_555 ? ? ? ? ? ? ? 3.010 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 163.9 ? 2 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 N ? A GLY 23 ? A GLY 23 ? 1_555 99.2 ? 3 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 N ? A GLY 23 ? A GLY 23 ? 1_555 90.8 ? 4 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 109.5 ? 5 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 54.4 ? 6 N ? A GLY 23 ? A GLY 23 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 123.4 ? 7 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 N ? A ASP 24 ? A ASP 24 ? 1_555 98.9 ? 8 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 N ? A ASP 24 ? A ASP 24 ? 1_555 75.6 ? 9 N ? A GLY 23 ? A GLY 23 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 N ? A ASP 24 ? A ASP 24 ? 1_555 58.6 ? 10 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 N ? A ASP 24 ? A ASP 24 ? 1_555 69.3 ? 11 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 O ? A THR 26 ? A THR 26 ? 1_555 73.8 ? 12 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 O ? A THR 26 ? A THR 26 ? 1_555 97.0 ? 13 N ? A GLY 23 ? A GLY 23 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 O ? A THR 26 ? A THR 26 ? 1_555 171.7 ? 14 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 O ? A THR 26 ? A THR 26 ? 1_555 64.1 ? 15 N ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 O ? A THR 26 ? A THR 26 ? 1_555 126.2 ? 16 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 71.0 ? 17 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 120.0 ? 18 N ? A GLY 23 ? A GLY 23 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 99.1 ? 19 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 135.8 ? 20 N ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 154.5 ? 21 O ? A THR 26 ? A THR 26 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 74.5 ? 22 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 107.7 ? 23 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 77.3 ? 24 N ? A GLY 23 ? A GLY 23 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 120.2 ? 25 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 96.2 ? 26 N ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 152.9 ? 27 O ? A THR 26 ? A THR 26 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 59.3 ? 28 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 80 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 46.8 ? 29 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 55.5 ? 30 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 OD1 ? A ASP 60 ? A ASP 60 ? 1_555 80.0 ? 31 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 OD1 ? A ASP 60 ? A ASP 60 ? 1_555 106.3 ? 32 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 OD2 ? A ASP 60 ? A ASP 60 ? 1_555 66.0 ? 33 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 OD2 ? A ASP 60 ? A ASP 60 ? 1_555 60.8 ? 34 OD1 ? A ASP 60 ? A ASP 60 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 OD2 ? A ASP 60 ? A ASP 60 ? 1_555 47.5 ? 35 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 N ? A THR 62 ? A THR 62 ? 1_555 77.3 ? 36 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 N ? A THR 62 ? A THR 62 ? 1_555 131.5 ? 37 OD1 ? A ASP 60 ? A ASP 60 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 N ? A THR 62 ? A THR 62 ? 1_555 49.2 ? 38 OD2 ? A ASP 60 ? A ASP 60 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 N ? A THR 62 ? A THR 62 ? 1_555 92.0 ? 39 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 88.4 ? 40 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 125.3 ? 41 OD1 ? A ASP 60 ? A ASP 60 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 105.7 ? 42 OD2 ? A ASP 60 ? A ASP 60 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 144.0 ? 43 N ? A THR 62 ? A THR 62 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 56.5 ? 44 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 106.0 ? 45 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 91.4 ? 46 OD1 ? A ASP 60 ? A ASP 60 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 161.3 ? 47 OD2 ? A ASP 60 ? A ASP 60 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 151.1 ? 48 N ? A THR 62 ? A THR 62 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 114.0 ? 49 O ? A THR 62 ? A THR 62 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 57.7 ? 50 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 71.2 ? 51 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 48.6 ? 52 OD1 ? A ASP 60 ? A ASP 60 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 149.6 ? 53 OD2 ? A ASP 60 ? A ASP 60 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 109.2 ? 54 N ? A THR 62 ? A THR 62 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 129.5 ? 55 O ? A THR 62 ? A THR 62 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 83.7 ? 56 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 81 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 44.5 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 26 ? ILE A 27 ? THR A 26 ILE A 27 A 2 ILE A 63 ? ASP A 64 ? ILE A 63 ASP A 64 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 27 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 27 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 63 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 63 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 80 ? 6 'BINDING SITE FOR RESIDUE CA A 80' AC2 Software A CA 81 ? 6 'BINDING SITE FOR RESIDUE CA A 81' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 20 ? ASP A 20 . ? 1_555 ? 2 AC1 6 ASP A 22 ? ASP A 22 . ? 1_555 ? 3 AC1 6 GLY A 23 ? GLY A 23 . ? 1_555 ? 4 AC1 6 ASP A 24 ? ASP A 24 . ? 1_555 ? 5 AC1 6 THR A 26 ? THR A 26 . ? 1_555 ? 6 AC1 6 GLU A 31 ? GLU A 31 . ? 1_555 ? 7 AC2 6 ASP A 56 ? ASP A 56 . ? 1_555 ? 8 AC2 6 ASP A 58 ? ASP A 58 . ? 1_555 ? 9 AC2 6 ASP A 60 ? ASP A 60 . ? 1_555 ? 10 AC2 6 THR A 62 ? THR A 62 . ? 1_555 ? 11 AC2 6 ASP A 64 ? ASP A 64 . ? 1_555 ? 12 AC2 6 GLU A 67 ? GLU A 67 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASP 22 ? ? CA A CA 80 ? ? 0.99 2 1 O A GLN 8 ? ? H A PHE 12 ? ? 1.54 3 1 O A GLU 11 ? ? H A ALA 15 ? ? 1.57 4 2 HB2 A ASP 22 ? ? CA A CA 80 ? ? 1.19 5 2 OD1 A ASP 60 ? ? HG1 A THR 62 ? ? 1.57 6 2 O A LYS 30 ? ? HG1 A THR 34 ? ? 1.57 7 2 O A PHE 16 ? ? H A ASP 20 ? ? 1.59 8 3 HB2 A ASP 22 ? ? CA A CA 80 ? ? 1.09 9 3 H A ALA 57 ? ? OE2 A GLU 67 ? ? 1.54 10 3 OD1 A ASP 64 ? ? H A PHE 65 ? ? 1.56 11 3 O A PHE 12 ? ? H A PHE 16 ? ? 1.56 12 3 O A GLN 8 ? ? H A PHE 12 ? ? 1.57 13 3 O A GLU 11 ? ? H A ALA 15 ? ? 1.59 14 4 HB2 A ASP 22 ? ? CA A CA 80 ? ? 1.15 15 4 O A PHE 12 ? ? H A PHE 16 ? ? 1.52 16 4 O A GLN 8 ? ? H A PHE 12 ? ? 1.54 17 4 O A THR 5 ? ? H A ILE 9 ? ? 1.54 18 4 H A ASP 22 ? ? OE1 A GLU 31 ? ? 1.55 19 4 O A GLU 11 ? ? H A ALA 15 ? ? 1.55 20 4 O A ASP 64 ? ? H A PHE 68 ? ? 1.56 21 5 HB2 A ASP 22 ? ? CA A CA 80 ? ? 1.01 22 5 H A ASP 22 ? ? OE2 A GLU 31 ? ? 1.54 23 5 O A PHE 12 ? ? H A PHE 16 ? ? 1.56 24 5 O A LEU 4 ? ? H A GLN 8 ? ? 1.56 25 6 HB2 A ASP 22 ? ? CA A CA 80 ? ? 1.03 26 6 O A ILE 9 ? ? H A LYS 13 ? ? 1.46 27 6 O A PHE 12 ? ? H A PHE 16 ? ? 1.52 28 6 O A GLN 41 ? ? HD21 A ASN 42 ? ? 1.53 29 6 O A THR 5 ? ? H A ILE 9 ? ? 1.56 30 7 O A PHE 12 ? ? H A PHE 16 ? ? 1.53 31 7 O A THR 5 ? ? H A ILE 9 ? ? 1.54 32 7 HB3 A ASP 22 ? ? CA A CA 80 ? ? 1.54 33 7 O A PHE 16 ? ? H A ASP 20 ? ? 1.54 34 7 O A GLN 8 ? ? H A PHE 12 ? ? 1.59 35 8 HB2 A ASP 22 ? ? CA A CA 80 ? ? 1.10 36 8 O A PHE 16 ? ? H A ASP 20 ? ? 1.50 37 8 HB3 A ASP 22 ? ? CA A CA 80 ? ? 1.51 38 8 O A ASP 64 ? ? H A PHE 68 ? ? 1.58 39 8 O A GLU 11 ? ? H A ALA 15 ? ? 1.58 40 8 CB A ASP 22 ? ? CA A CA 80 ? ? 1.60 41 9 HB2 A ASP 22 ? ? CA A CA 80 ? ? 1.25 42 9 O A ASP 64 ? ? H A PHE 68 ? ? 1.57 43 10 HB2 A ASP 22 ? ? CA A CA 80 ? ? 1.33 44 10 O A ASP 64 ? ? H A PHE 68 ? ? 1.53 45 10 H A THR 28 ? ? OE2 A GLU 31 ? ? 1.55 46 10 O A PHE 12 ? ? H A PHE 16 ? ? 1.57 47 11 HB2 A ASP 22 ? ? CA A CA 80 ? ? 1.31 48 11 O A THR 5 ? ? H A ILE 9 ? ? 1.54 49 11 O A GLU 11 ? ? H A ALA 15 ? ? 1.58 50 12 HB2 A ASP 22 ? ? CA A CA 80 ? ? 0.75 51 12 O A ASP 64 ? ? H A PHE 68 ? ? 1.54 52 12 O A THR 5 ? ? H A ILE 9 ? ? 1.59 53 13 O A PHE 12 ? ? H A PHE 16 ? ? 1.50 54 13 HB3 A ASP 22 ? ? CA A CA 80 ? ? 1.53 55 13 O A PHE 16 ? ? H A ASP 20 ? ? 1.59 56 13 O A ASP 64 ? ? H A PHE 68 ? ? 1.59 57 13 O A GLN 41 ? ? HD21 A ASN 42 ? ? 1.59 58 14 HB3 A ASP 22 ? ? CA A CA 80 ? ? 1.35 59 14 O A ASP 64 ? ? H A PHE 68 ? ? 1.49 60 14 O A PHE 16 ? ? H A ASP 20 ? ? 1.54 61 14 O A PHE 12 ? ? H A PHE 16 ? ? 1.57 62 14 O A LEU 4 ? ? H A GLN 8 ? ? 1.59 63 15 HB2 A ASP 22 ? ? CA A CA 80 ? ? 1.25 64 15 O A THR 5 ? ? H A ILE 9 ? ? 1.51 65 16 HB2 A ASP 22 ? ? CA A CA 80 ? ? 0.96 66 16 O A ASP 64 ? ? H A PHE 68 ? ? 1.53 67 16 O A THR 5 ? ? H A ILE 9 ? ? 1.55 68 16 O A PHE 12 ? ? H A PHE 16 ? ? 1.57 69 16 O A GLN 8 ? ? H A PHE 12 ? ? 1.60 70 17 O A GLN 8 ? ? H A PHE 12 ? ? 1.56 71 17 O A THR 70 ? ? H A ARG 74 ? ? 1.59 72 18 OD1 A ASP 22 ? ? CA A CA 80 ? ? 1.02 73 18 O A ILE 9 ? ? H A LYS 13 ? ? 1.50 74 18 O A PHE 12 ? ? H A PHE 16 ? ? 1.51 75 18 O A PHE 16 ? ? H A ASP 20 ? ? 1.54 76 18 O A ASP 64 ? ? H A PHE 68 ? ? 1.58 77 18 O A THR 5 ? ? H A ILE 9 ? ? 1.59 78 19 OD1 A ASP 22 ? ? CA A CA 80 ? ? 1.06 79 19 O A PHE 12 ? ? H A PHE 16 ? ? 1.51 80 19 O A PHE 16 ? ? H A ASP 20 ? ? 1.58 81 19 H A ASP 64 ? ? OE1 A GLU 67 ? ? 1.60 82 20 HB2 A ASP 22 ? ? CA A CA 80 ? ? 1.19 83 20 OD2 A ASP 56 ? ? H A GLY 61 ? ? 1.51 84 20 O A THR 5 ? ? H A ILE 9 ? ? 1.52 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? 88.45 -39.16 2 1 GLN A 3 ? ? -140.69 33.20 3 1 LEU A 4 ? ? 40.43 28.38 4 1 PHE A 16 ? ? -37.60 -39.18 5 1 GLN A 41 ? ? -49.95 178.14 6 1 ASN A 42 ? ? -154.39 64.83 7 1 ASP A 56 ? ? -43.88 108.35 8 1 ASP A 58 ? ? -39.50 -35.78 9 1 ASP A 60 ? ? 176.88 -49.56 10 2 LEU A 4 ? ? -175.61 -38.86 11 2 THR A 5 ? ? -37.47 -32.45 12 2 GLN A 41 ? ? -52.59 -174.25 13 2 ASN A 42 ? ? -163.65 60.60 14 2 ASP A 56 ? ? -53.12 109.79 15 2 ASP A 60 ? ? 176.26 -50.66 16 3 GLN A 3 ? ? -125.69 -57.42 17 3 LEU A 4 ? ? -176.68 -34.21 18 3 THR A 5 ? ? -37.58 -31.65 19 3 LEU A 39 ? ? -81.89 -70.78 20 3 ASN A 42 ? ? -166.39 61.67 21 3 ASP A 56 ? ? -49.74 109.28 22 3 ASP A 60 ? ? 168.30 -60.81 23 4 GLN A 3 ? ? -140.06 -72.71 24 4 LEU A 4 ? ? -173.35 32.13 25 4 ILE A 9 ? ? -39.42 -39.25 26 4 GLN A 41 ? ? -61.06 -172.21 27 4 ASN A 42 ? ? -167.51 60.71 28 4 ASP A 56 ? ? -51.79 107.94 29 4 ASP A 60 ? ? 176.22 -67.18 30 5 ASP A 2 ? ? 55.05 19.88 31 5 PHE A 16 ? ? -36.55 -32.18 32 5 ASP A 20 ? ? -96.59 39.65 33 5 ILE A 27 ? ? -104.25 77.84 34 5 ASP A 56 ? ? -50.48 108.19 35 5 ASP A 58 ? ? -39.86 -35.00 36 5 ASP A 60 ? ? -167.64 -50.72 37 6 GLN A 3 ? ? -141.59 20.64 38 6 LEU A 4 ? ? 69.69 -61.95 39 6 THR A 28 ? ? -46.06 150.76 40 6 ASN A 42 ? ? -156.41 62.31 41 6 ASP A 56 ? ? -54.07 106.38 42 6 ASP A 58 ? ? -38.93 -33.51 43 6 ASP A 60 ? ? -164.20 -55.43 44 7 LEU A 4 ? ? -127.45 -60.45 45 7 ASP A 22 ? ? -43.59 -75.56 46 7 THR A 28 ? ? -47.57 153.88 47 7 LEU A 39 ? ? -89.79 35.51 48 7 GLN A 41 ? ? -49.05 178.31 49 7 ASN A 42 ? ? -165.08 57.09 50 7 ASP A 56 ? ? -50.22 108.84 51 7 ASP A 60 ? ? 170.59 -54.91 52 8 LEU A 4 ? ? -172.32 -40.76 53 8 THR A 5 ? ? -39.72 -30.24 54 8 LEU A 39 ? ? -87.09 46.76 55 8 ASN A 42 ? ? -172.55 64.01 56 8 ASP A 56 ? ? -55.22 109.05 57 8 ASP A 60 ? ? -162.53 -63.44 58 9 GLN A 3 ? ? -178.94 35.95 59 9 PHE A 16 ? ? -38.05 -39.84 60 9 ASP A 20 ? ? -99.96 46.04 61 9 GLN A 41 ? ? -45.73 172.82 62 9 ASN A 42 ? ? -145.84 59.86 63 9 ASP A 56 ? ? -49.10 107.92 64 9 ASP A 60 ? ? 173.13 -51.77 65 10 LEU A 4 ? ? -174.76 -51.61 66 10 PHE A 16 ? ? -37.44 -35.05 67 10 ASP A 20 ? ? -92.96 56.14 68 10 THR A 29 ? ? -37.22 -38.65 69 10 GLN A 41 ? ? -43.49 167.99 70 10 ASP A 60 ? ? -179.98 -64.32 71 10 ASP A 64 ? ? -172.73 -178.93 72 11 ASP A 2 ? ? 59.95 18.00 73 11 PHE A 19 ? ? -38.01 -38.94 74 11 ASP A 56 ? ? -51.20 109.65 75 11 ASP A 58 ? ? -39.33 -35.39 76 11 ASP A 60 ? ? -168.61 -54.73 77 12 LEU A 4 ? ? 162.60 -45.06 78 12 THR A 29 ? ? -38.08 -36.49 79 12 GLN A 41 ? ? -48.65 176.62 80 12 ASN A 42 ? ? -153.89 61.96 81 12 ASP A 56 ? ? -52.58 106.60 82 12 ASP A 58 ? ? -38.09 -34.62 83 12 ASP A 60 ? ? -151.06 -54.92 84 13 LEU A 4 ? ? 87.56 -52.15 85 13 ASN A 42 ? ? -157.47 63.22 86 13 ASP A 58 ? ? -35.80 -35.37 87 13 ASP A 60 ? ? -155.79 -54.71 88 14 GLN A 3 ? ? -122.61 -52.76 89 14 LEU A 4 ? ? -175.28 -39.55 90 14 THR A 5 ? ? -36.98 -35.20 91 14 ASP A 56 ? ? -46.44 105.92 92 14 ASP A 60 ? ? 163.37 -58.42 93 15 GLN A 3 ? ? -137.10 -51.21 94 15 LEU A 4 ? ? 178.69 -35.79 95 15 THR A 5 ? ? -38.29 -29.26 96 15 ASP A 20 ? ? -105.42 53.42 97 15 ASP A 56 ? ? -50.42 107.75 98 15 ALA A 57 ? ? -105.02 -61.00 99 15 ASP A 60 ? ? 167.60 -70.61 100 16 ASP A 2 ? ? 72.42 -54.71 101 16 THR A 29 ? ? -37.20 -36.71 102 16 LEU A 39 ? ? -89.94 41.71 103 16 GLN A 41 ? ? -50.25 -178.86 104 16 ASN A 42 ? ? -165.82 60.84 105 16 ASP A 60 ? ? -177.11 -60.12 106 17 ASP A 2 ? ? 78.29 -50.86 107 17 GLN A 3 ? ? -130.50 -39.44 108 17 ASP A 22 ? ? -146.66 -51.21 109 17 GLN A 41 ? ? -132.40 -43.91 110 17 ASP A 56 ? ? -57.43 109.85 111 17 ASP A 60 ? ? 172.03 -52.24 112 18 GLN A 3 ? ? -141.00 -78.38 113 18 LEU A 4 ? ? -166.36 29.04 114 18 GLN A 41 ? ? -130.28 -49.17 115 18 ASP A 56 ? ? -55.54 108.32 116 18 ASP A 60 ? ? 170.24 -65.22 117 19 GLN A 3 ? ? -164.06 -56.77 118 19 LEU A 4 ? ? 176.32 -50.20 119 19 GLN A 41 ? ? -69.09 -173.28 120 19 ASN A 42 ? ? -168.18 58.06 121 19 ASP A 56 ? ? -47.36 100.93 122 19 ASP A 60 ? ? 163.03 -75.28 123 19 THR A 62 ? ? -58.83 172.20 124 20 ASP A 2 ? ? 162.39 -19.69 125 20 GLN A 3 ? ? 78.79 44.43 126 20 LEU A 4 ? ? 175.23 -35.03 127 20 ASP A 60 ? ? -170.32 -56.50 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Proteomics in Europe' _pdbx_SG_project.initial_of_center SPINE # _pdbx_nmr_ensemble.entry_id 1SW8 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1SW8 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1 mM Calmodulin U-15N, 20 mM MES, 400 mM KCl, 90% H20, 10% D20' '90%H20, 10% D20' 2 '1 mM Calmodulin U-15N-13C, 20 mM MES, 400 mM KCl, 90% H20, 10% D20' '90%H20, 10% D20' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '400 mM KCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 2 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY 3 1 1 '2D NOESY' # _pdbx_nmr_details.entry_id 1SW8 _pdbx_nmr_details.text 'The structure was calculated using dimagnetic, dihedral angle restraints and pseudocontact shifts' # _pdbx_nmr_refine.entry_id 1SW8 _pdbx_nmr_refine.method 'distance geometry, simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details 'refinement with pseudocontact shifts' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'XWINNMR 3.1' 3.1 collection ? 1 'XWINNMR 3.1' 3.1 processing ? 2 XEASY 1.3 'data analysis' ? 3 DYANA ? 'structure solution' ? 4 DYANA ? refinement ? 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 ILE N N N N 124 ILE CA C N S 125 ILE C C N N 126 ILE O O N N 127 ILE CB C N S 128 ILE CG1 C N N 129 ILE CG2 C N N 130 ILE CD1 C N N 131 ILE OXT O N N 132 ILE H H N N 133 ILE H2 H N N 134 ILE HA H N N 135 ILE HB H N N 136 ILE HG12 H N N 137 ILE HG13 H N N 138 ILE HG21 H N N 139 ILE HG22 H N N 140 ILE HG23 H N N 141 ILE HD11 H N N 142 ILE HD12 H N N 143 ILE HD13 H N N 144 ILE HXT H N N 145 LEU N N N N 146 LEU CA C N S 147 LEU C C N N 148 LEU O O N N 149 LEU CB C N N 150 LEU CG C N N 151 LEU CD1 C N N 152 LEU CD2 C N N 153 LEU OXT O N N 154 LEU H H N N 155 LEU H2 H N N 156 LEU HA H N N 157 LEU HB2 H N N 158 LEU HB3 H N N 159 LEU HG H N N 160 LEU HD11 H N N 161 LEU HD12 H N N 162 LEU HD13 H N N 163 LEU HD21 H N N 164 LEU HD22 H N N 165 LEU HD23 H N N 166 LEU HXT H N N 167 LYS N N N N 168 LYS CA C N S 169 LYS C C N N 170 LYS O O N N 171 LYS CB C N N 172 LYS CG C N N 173 LYS CD C N N 174 LYS CE C N N 175 LYS NZ N N N 176 LYS OXT O N N 177 LYS H H N N 178 LYS H2 H N N 179 LYS HA H N N 180 LYS HB2 H N N 181 LYS HB3 H N N 182 LYS HG2 H N N 183 LYS HG3 H N N 184 LYS HD2 H N N 185 LYS HD3 H N N 186 LYS HE2 H N N 187 LYS HE3 H N N 188 LYS HZ1 H N N 189 LYS HZ2 H N N 190 LYS HZ3 H N N 191 LYS HXT H N N 192 MET N N N N 193 MET CA C N S 194 MET C C N N 195 MET O O N N 196 MET CB C N N 197 MET CG C N N 198 MET SD S N N 199 MET CE C N N 200 MET OXT O N N 201 MET H H N N 202 MET H2 H N N 203 MET HA H N N 204 MET HB2 H N N 205 MET HB3 H N N 206 MET HG2 H N N 207 MET HG3 H N N 208 MET HE1 H N N 209 MET HE2 H N N 210 MET HE3 H N N 211 MET HXT H N N 212 PHE N N N N 213 PHE CA C N S 214 PHE C C N N 215 PHE O O N N 216 PHE CB C N N 217 PHE CG C Y N 218 PHE CD1 C Y N 219 PHE CD2 C Y N 220 PHE CE1 C Y N 221 PHE CE2 C Y N 222 PHE CZ C Y N 223 PHE OXT O N N 224 PHE H H N N 225 PHE H2 H N N 226 PHE HA H N N 227 PHE HB2 H N N 228 PHE HB3 H N N 229 PHE HD1 H N N 230 PHE HD2 H N N 231 PHE HE1 H N N 232 PHE HE2 H N N 233 PHE HZ H N N 234 PHE HXT H N N 235 PRO N N N N 236 PRO CA C N S 237 PRO C C N N 238 PRO O O N N 239 PRO CB C N N 240 PRO CG C N N 241 PRO CD C N N 242 PRO OXT O N N 243 PRO H H N N 244 PRO HA H N N 245 PRO HB2 H N N 246 PRO HB3 H N N 247 PRO HG2 H N N 248 PRO HG3 H N N 249 PRO HD2 H N N 250 PRO HD3 H N N 251 PRO HXT H N N 252 SER N N N N 253 SER CA C N S 254 SER C C N N 255 SER O O N N 256 SER CB C N N 257 SER OG O N N 258 SER OXT O N N 259 SER H H N N 260 SER H2 H N N 261 SER HA H N N 262 SER HB2 H N N 263 SER HB3 H N N 264 SER HG H N N 265 SER HXT H N N 266 THR N N N N 267 THR CA C N S 268 THR C C N N 269 THR O O N N 270 THR CB C N R 271 THR OG1 O N N 272 THR CG2 C N N 273 THR OXT O N N 274 THR H H N N 275 THR H2 H N N 276 THR HA H N N 277 THR HB H N N 278 THR HG1 H N N 279 THR HG21 H N N 280 THR HG22 H N N 281 THR HG23 H N N 282 THR HXT H N N 283 VAL N N N N 284 VAL CA C N S 285 VAL C C N N 286 VAL O O N N 287 VAL CB C N N 288 VAL CG1 C N N 289 VAL CG2 C N N 290 VAL OXT O N N 291 VAL H H N N 292 VAL H2 H N N 293 VAL HA H N N 294 VAL HB H N N 295 VAL HG11 H N N 296 VAL HG12 H N N 297 VAL HG13 H N N 298 VAL HG21 H N N 299 VAL HG22 H N N 300 VAL HG23 H N N 301 VAL HXT H N N 302 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 THR N CA sing N N 254 THR N H sing N N 255 THR N H2 sing N N 256 THR CA C sing N N 257 THR CA CB sing N N 258 THR CA HA sing N N 259 THR C O doub N N 260 THR C OXT sing N N 261 THR CB OG1 sing N N 262 THR CB CG2 sing N N 263 THR CB HB sing N N 264 THR OG1 HG1 sing N N 265 THR CG2 HG21 sing N N 266 THR CG2 HG22 sing N N 267 THR CG2 HG23 sing N N 268 THR OXT HXT sing N N 269 VAL N CA sing N N 270 VAL N H sing N N 271 VAL N H2 sing N N 272 VAL CA C sing N N 273 VAL CA CB sing N N 274 VAL CA HA sing N N 275 VAL C O doub N N 276 VAL C OXT sing N N 277 VAL CB CG1 sing N N 278 VAL CB CG2 sing N N 279 VAL CB HB sing N N 280 VAL CG1 HG11 sing N N 281 VAL CG1 HG12 sing N N 282 VAL CG1 HG13 sing N N 283 VAL CG2 HG21 sing N N 284 VAL CG2 HG22 sing N N 285 VAL CG2 HG23 sing N N 286 VAL OXT HXT sing N N 287 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 700 2 ? Bruker AVANCE 800 # _atom_sites.entry_id 1SW8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_