data_1T18
# 
_entry.id   1T18 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1T18         pdb_00001t18 10.2210/pdb1t18/pdb 
RCSB  RCSB022185   ?            ?                   
WWPDB D_1000022185 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1T19 . unspecified 
PDB 1T1A . unspecified 
PDB 1T1B . unspecified 
PDB 1T1C . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1T18 
_pdbx_database_status.recvd_initial_deposition_date   2004-04-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rajagopal, S.' 1 
'Anderson, S.'  2 
'Srajer, V.'    3 
'Schmidt, M.'   4 
'Pahl, R.'      5 
'Moffat, K.'    6 
# 
_citation.id                        primary 
_citation.title                     'A Structural Pathway for Signaling in the E46Q Mutant of Photoactive Yellow Protein' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            13 
_citation.page_first                55 
_citation.page_last                 63 
_citation.year                      2005 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15642261 
_citation.pdbx_database_id_DOI      10.1016/j.str.2004.10.016 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rajagopal, S.' 1 ? 
primary 'Anderson, S.'  2 ? 
primary 'Srajer, V.'    3 ? 
primary 'Schmidt, M.'   4 ? 
primary 'Pahl, R.'      5 ? 
primary 'Moffat, K.'    6 ? 
# 
_cell.entry_id           1T18 
_cell.length_a           66.917 
_cell.length_b           66.917 
_cell.length_c           41.002 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1T18 
_symmetry.space_group_name_H-M             'P 63' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                173 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Photoactive yellow protein' 13887.591 1 ? E46Q ? ? 
2 non-polymer syn 
;4'-HYDROXYCINNAMIC ACID
;
164.158   1 ? ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        PYP 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFK
EGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFK
EGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   HIS n 
1 4   VAL n 
1 5   ALA n 
1 6   PHE n 
1 7   GLY n 
1 8   SER n 
1 9   GLU n 
1 10  ASP n 
1 11  ILE n 
1 12  GLU n 
1 13  ASN n 
1 14  THR n 
1 15  LEU n 
1 16  ALA n 
1 17  LYS n 
1 18  MET n 
1 19  ASP n 
1 20  ASP n 
1 21  GLY n 
1 22  GLN n 
1 23  LEU n 
1 24  ASP n 
1 25  GLY n 
1 26  LEU n 
1 27  ALA n 
1 28  PHE n 
1 29  GLY n 
1 30  ALA n 
1 31  ILE n 
1 32  GLN n 
1 33  LEU n 
1 34  ASP n 
1 35  GLY n 
1 36  ASP n 
1 37  GLY n 
1 38  ASN n 
1 39  ILE n 
1 40  LEU n 
1 41  GLN n 
1 42  TYR n 
1 43  ASN n 
1 44  ALA n 
1 45  ALA n 
1 46  GLN n 
1 47  GLY n 
1 48  ASP n 
1 49  ILE n 
1 50  THR n 
1 51  GLY n 
1 52  ARG n 
1 53  ASP n 
1 54  PRO n 
1 55  LYS n 
1 56  GLN n 
1 57  VAL n 
1 58  ILE n 
1 59  GLY n 
1 60  LYS n 
1 61  ASN n 
1 62  PHE n 
1 63  PHE n 
1 64  LYS n 
1 65  ASP n 
1 66  VAL n 
1 67  ALA n 
1 68  PRO n 
1 69  CYS n 
1 70  THR n 
1 71  ASP n 
1 72  SER n 
1 73  PRO n 
1 74  GLU n 
1 75  PHE n 
1 76  TYR n 
1 77  GLY n 
1 78  LYS n 
1 79  PHE n 
1 80  LYS n 
1 81  GLU n 
1 82  GLY n 
1 83  VAL n 
1 84  ALA n 
1 85  SER n 
1 86  GLY n 
1 87  ASN n 
1 88  LEU n 
1 89  ASN n 
1 90  THR n 
1 91  MET n 
1 92  PHE n 
1 93  GLU n 
1 94  TYR n 
1 95  THR n 
1 96  PHE n 
1 97  ASP n 
1 98  TYR n 
1 99  GLN n 
1 100 MET n 
1 101 THR n 
1 102 PRO n 
1 103 THR n 
1 104 LYS n 
1 105 VAL n 
1 106 LYS n 
1 107 VAL n 
1 108 HIS n 
1 109 MET n 
1 110 LYS n 
1 111 LYS n 
1 112 ALA n 
1 113 LEU n 
1 114 SER n 
1 115 GLY n 
1 116 ASP n 
1 117 SER n 
1 118 TYR n 
1 119 TRP n 
1 120 VAL n 
1 121 PHE n 
1 122 VAL n 
1 123 LYS n 
1 124 ARG n 
1 125 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Halorhodospira 
_entity_src_gen.pdbx_gene_src_gene                 PYP 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Halorhodospira halophila' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1053 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PYP_ECTHA 
_struct_ref.pdbx_db_accession          P16113 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFK
EGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1T18 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 125 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P16113 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  125 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       125 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1T18 
_struct_ref_seq_dif.mon_id                       GLN 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      46 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P16113 
_struct_ref_seq_dif.db_mon_id                    GLU 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          46 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            46 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                   ?                    'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                  ?                    'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                ?                    'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ?                    'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                  ?                    'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                 ?                    'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ?                    'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                   ?                    'C2 H5 N O2'     75.067  
HC4 non-polymer         . 
;4'-HYDROXYCINNAMIC ACID
;
'PARA-COUMARIC ACID' 'C9 H8 O3'       164.158 
HIS 'L-peptide linking' y HISTIDINE                 ?                    'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                ?                    'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                   ?                    'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                    ?                    'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                ?                    'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE             ?                    'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                   ?                    'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                    ?                    'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                 ?                    'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                ?                    'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                  ?                    'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                    ?                    'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1T18 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   35.54 
_exptl_crystal.description           ? 
_exptl_crystal.density_Matthews      1.91 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_details    'ammonium sulfate, pH 7, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           288 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   L 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             LAUE 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 14-ID-B' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   14-ID-B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1T18 
_reflns.number_all                   ? 
_reflns.number_obs                   13957 
_reflns.percent_possible_obs         ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.6 
_reflns.d_resolution_low             30 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1T18 
_refine.ls_number_reflns_obs                     13889 
_refine.ls_number_reflns_all                     13889 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            1.60 
_refine.ls_percent_reflns_obs                    100 
_refine.ls_R_factor_obs                          0.229 
_refine.ls_R_factor_all                          0.229 
_refine.ls_R_factor_R_work                       0.2272 
_refine.ls_R_factor_R_free                       0.2468 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 13.4 
_refine.ls_number_reflns_R_free                  1306 
_refine.ls_number_parameters                     3953 
_refine.ls_number_restraints                     11012 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'AB INITIO' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1T18 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      125 
_refine_analyze.occupancy_sum_hydrogen          0.00 
_refine_analyze.occupancy_sum_non_hydrogen      987.00 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        976 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         11 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               987 
_refine_hist.d_res_high                       1.60 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.012  ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.025  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.0254 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.062  ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.077  ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.027  ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.060  ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.000  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1T18 
_pdbx_refine.R_factor_all_no_cutoff                      0.2291 
_pdbx_refine.R_factor_obs_no_cutoff                      0.2401 
_pdbx_refine.free_R_factor_no_cutoff                     0.2456 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     13.4 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            1682 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.229 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.2401 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.2456 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   13.3 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          1671 
_pdbx_refine.number_reflns_obs_4sig_cutoff               12533 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1T18 
_struct.title                     'Early intermediate IE1 from time-resolved crystallography of the E46Q mutant of PYP' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1T18 
_struct_keywords.pdbx_keywords   photoreceptor 
_struct_keywords.text            'photoactive yellow protein, PAS domain, photoreceptor' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 10 ? LEU A 15 ? ASP A 10 LEU A 15 1 ? 6  
HELX_P HELX_P2 2 ASP A 19 ? ASP A 24 ? ASP A 19 ASP A 24 1 ? 6  
HELX_P HELX_P3 3 ASN A 43 ? GLY A 51 ? ASN A 43 GLY A 51 1 ? 9  
HELX_P HELX_P4 4 ASP A 53 ? ILE A 58 ? ASP A 53 ILE A 58 1 ? 6  
HELX_P HELX_P5 5 ALA A 67 ? ASP A 71 ? ALA A 67 ASP A 71 5 ? 5  
HELX_P HELX_P6 6 PHE A 75 ? GLY A 86 ? PHE A 75 GLY A 86 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        one 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            69 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           HC4 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           C1 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             69 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            HC4 
_struct_conn.ptnr2_auth_seq_id             169 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.794 
_struct_conn.pdbx_value_order              ? 
_struct_conn.pdbx_role                     ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 39  ? TYR A 42  ? ILE A 39  TYR A 42  
A 2 GLY A 29  ? ASP A 34  ? GLY A 29  ASP A 34  
A 3 SER A 117 ? ARG A 124 ? SER A 117 ARG A 124 
A 4 THR A 103 ? LYS A 111 ? THR A 103 LYS A 111 
A 5 ASN A 89  ? PHE A 96  ? ASN A 89  PHE A 96  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 40  ? O LEU A 40  N GLN A 32  ? N GLN A 32  
A 2 3 N LEU A 33  ? N LEU A 33  O TYR A 118 ? O TYR A 118 
A 3 4 O PHE A 121 ? O PHE A 121 N HIS A 108 ? N HIS A 108 
A 4 5 O VAL A 107 ? O VAL A 107 N PHE A 92  ? N PHE A 92  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    HC4 
_struct_site.pdbx_auth_seq_id     169 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    9 
_struct_site.details              'BINDING SITE FOR RESIDUE HC4 A 169' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 9 TYR A 42 ? TYR A 42 . ? 1_555 ? 
2 AC1 9 THR A 50 ? THR A 50 . ? 1_555 ? 
3 AC1 9 ARG A 52 ? ARG A 52 . ? 1_555 ? 
4 AC1 9 VAL A 66 ? VAL A 66 . ? 1_555 ? 
5 AC1 9 ALA A 67 ? ALA A 67 . ? 1_555 ? 
6 AC1 9 CYS A 69 ? CYS A 69 . ? 1_555 ? 
7 AC1 9 THR A 70 ? THR A 70 . ? 1_555 ? 
8 AC1 9 PHE A 96 ? PHE A 96 . ? 1_555 ? 
9 AC1 9 TYR A 98 ? TYR A 98 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1T18 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    1T18 
_atom_sites.fract_transf_matrix[1][1]   0.014944 
_atom_sites.fract_transf_matrix[1][2]   0.008628 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017256 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.024389 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   HIS 3   3   3   HIS HIS A . n 
A 1 4   VAL 4   4   4   VAL VAL A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   PHE 6   6   6   PHE PHE A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   SER 8   8   8   SER SER A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  GLU 12  12  12  GLU GLU A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  THR 14  14  14  THR THR A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  MET 18  18  18  MET MET A . n 
A 1 19  ASP 19  19  19  ASP ASP A . n 
A 1 20  ASP 20  20  20  ASP ASP A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  ASP 24  24  24  ASP ASP A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  ASN 38  38  38  ASN ASN A . n 
A 1 39  ILE 39  39  39  ILE ILE A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  GLN 41  41  41  GLN GLN A . n 
A 1 42  TYR 42  42  42  TYR TYR A . n 
A 1 43  ASN 43  43  43  ASN ASN A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  GLN 46  46  46  GLN GLN A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  GLN 56  56  56  GLN GLN A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  PHE 63  63  63  PHE PHE A . n 
A 1 64  LYS 64  64  64  LYS LYS A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  PRO 68  68  68  PRO PRO A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  PRO 73  73  73  PRO PRO A . n 
A 1 74  GLU 74  74  74  GLU GLU A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  VAL 83  83  83  VAL VAL A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  MET 91  91  91  MET MET A . n 
A 1 92  PHE 92  92  92  PHE PHE A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  TYR 94  94  94  TYR TYR A . n 
A 1 95  THR 95  95  95  THR THR A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 MET 100 100 100 MET MET A . n 
A 1 101 THR 101 101 101 THR THR A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 HIS 108 108 108 HIS HIS A . n 
A 1 109 MET 109 109 109 MET MET A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 TYR 118 118 118 TYR TYR A . n 
A 1 119 TRP 119 119 119 TRP TRP A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 PHE 121 121 121 PHE PHE A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 ARG 124 124 124 ARG ARG A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          HC4 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     169 
_pdbx_nonpoly_scheme.auth_seq_num    69 
_pdbx_nonpoly_scheme.pdb_mon_id      HC4 
_pdbx_nonpoly_scheme.auth_mon_id     CYS 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-01-18 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2015-09-09 
5 'Structure model' 1 4 2017-10-11 
6 'Structure model' 1 5 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Other                       
4 5 'Structure model' 'Refinement description'    
5 6 'Structure model' 'Database references'       
6 6 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' software           
2 6 'Structure model' database_2         
3 6 'Structure model' struct_conn        
4 6 'Structure model' struct_ref_seq_dif 
5 6 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_software.name'                      
2 6 'Structure model' '_database_2.pdbx_DOI'                
3 6 'Structure model' '_database_2.pdbx_database_accession' 
4 6 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
5 6 'Structure model' '_struct_ref_seq_dif.details'         
6 6 'Structure model' '_struct_site.pdbx_auth_asym_id'      
7 6 'Structure model' '_struct_site.pdbx_auth_comp_id'      
8 6 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHELX     'model building' . ? 1 
SHELXL-97 refinement       . ? 2 
LaueView  'data scaling'   . ? 3 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            C 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            VAL 
_pdbx_validate_rmsd_bond.auth_seq_id_1             125 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OXT 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            VAL 
_pdbx_validate_rmsd_bond.auth_seq_id_2             125 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.558 
_pdbx_validate_rmsd_bond.bond_target_value         1.229 
_pdbx_validate_rmsd_bond.bond_deviation            0.329 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.019 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 2 CB A ASP 65  ? ? CG A ASP 65  ? ? OD1 A ASP 65  ? ? 111.31 118.30 -6.99  0.90 N 
2 2 CB A ASP 65  ? ? CG A ASP 65  ? ? OD2 A ASP 65  ? ? 124.72 118.30 6.42   0.90 N 
3 2 CB A TYR 76  ? ? CG A TYR 76  ? ? CD2 A TYR 76  ? ? 117.29 121.00 -3.71  0.60 N 
4 2 CB A TYR 94  ? ? CG A TYR 94  ? ? CD2 A TYR 94  ? ? 124.85 121.00 3.85   0.60 N 
5 2 CB A TYR 94  ? ? CG A TYR 94  ? ? CD1 A TYR 94  ? ? 117.28 121.00 -3.72  0.60 N 
6 2 CG A MET 109 ? ? SD A MET 109 ? ? CE  A MET 109 ? ? 89.94  100.20 -10.26 1.60 N 
7 2 N  A GLY 115 ? ? CA A GLY 115 ? ? C   A GLY 115 ? ? 128.21 113.10 15.11  2.50 N 
8 2 NE A ARG 124 ? ? CZ A ARG 124 ? ? NH1 A ARG 124 ? ? 125.53 120.30 5.23   0.50 N 
9 2 NE A ARG 124 ? ? CZ A ARG 124 ? ? NH2 A ARG 124 ? ? 112.23 120.30 -8.07  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 75  ? ? -123.79 -74.18 
2 1 ASP A 97  ? ? -140.69 20.41  
3 1 ASP A 116 ? ? -98.59  55.19  
4 2 PHE A 75  ? ? -130.94 -76.15 
5 2 ASN A 89  ? ? -160.49 97.44  
6 2 ASP A 97  ? ? -143.89 17.21  
7 2 ASP A 116 ? ? -119.63 58.77  
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        
;4'-HYDROXYCINNAMIC ACID
;
_pdbx_entity_nonpoly.comp_id     HC4 
#