data_1T3K # _entry.id 1T3K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1T3K pdb_00001t3k 10.2210/pdb1t3k/pdb RCSB RCSB022267 ? ? WWPDB D_1000022267 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 6195 _pdbx_database_related.details 'chemical shift assigment' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1T3K _pdbx_database_status.recvd_initial_deposition_date 2004-04-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Landrieu, I.' 1 'da Costa, M.' 2 'De Veylder, L.' 3 'Dewitte, F.' 4 'Vandepoele, K.' 5 'Hassan, S.' 6 'Wieruszeski, J.M.' 7 'Faure, J.D.' 8 'Inze, D.' 9 'Lippens, G.' 10 # _citation.id primary _citation.title 'A small CDC25 dual-specificity tyrosine-phosphatase isoform in Arabidopsis thaliana.' _citation.journal_abbrev Proc.Natl.Acad.Sci.Usa _citation.journal_volume 101 _citation.page_first 13380 _citation.page_last 13385 _citation.year 2004 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15329414 _citation.pdbx_database_id_DOI 10.1073/pnas.0405248101 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Landrieu, I.' 1 ? primary 'Da Costa, M.' 2 ? primary 'De Veylder, L.' 3 ? primary 'Dewitte, F.' 4 ? primary 'Vandepoele, K.' 5 ? primary 'Hassan, S.' 6 ? primary 'Wieruszeski, J.M.' 7 ? primary 'Faure, J.D.' 8 ? primary 'Van Montagu, M.' 9 ? primary 'Inze, D.' 10 ? primary 'Lippens, G.' 11 ? # _cell.entry_id 1T3K _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1T3K _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Dual-specificity tyrosine phosphatase' 16941.219 1 3.1.3.48 C72S ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Arath CDC25' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMAMARSISYITSTQLLPLHRRPNIAIIDVRDEERNYDGHIAGSLHYASGSFDDKISHLVQ NVKDKDTLVFHSALSQVRGPTCARRLVNYLDEKKEDTGIKNIMILERGFNGWEASGKPVCRCAEVPCKGDCA ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMAMARSISYITSTQLLPLHRRPNIAIIDVRDEERNYDGHIAGSLHYASGSFDDKISHLVQ NVKDKDTLVFHSALSQVRGPTCARRLVNYLDEKKEDTGIKNIMILERGFNGWEASGKPVCRCAEVPCKGDCA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ALA n 1 23 MET n 1 24 ALA n 1 25 ARG n 1 26 SER n 1 27 ILE n 1 28 SER n 1 29 TYR n 1 30 ILE n 1 31 THR n 1 32 SER n 1 33 THR n 1 34 GLN n 1 35 LEU n 1 36 LEU n 1 37 PRO n 1 38 LEU n 1 39 HIS n 1 40 ARG n 1 41 ARG n 1 42 PRO n 1 43 ASN n 1 44 ILE n 1 45 ALA n 1 46 ILE n 1 47 ILE n 1 48 ASP n 1 49 VAL n 1 50 ARG n 1 51 ASP n 1 52 GLU n 1 53 GLU n 1 54 ARG n 1 55 ASN n 1 56 TYR n 1 57 ASP n 1 58 GLY n 1 59 HIS n 1 60 ILE n 1 61 ALA n 1 62 GLY n 1 63 SER n 1 64 LEU n 1 65 HIS n 1 66 TYR n 1 67 ALA n 1 68 SER n 1 69 GLY n 1 70 SER n 1 71 PHE n 1 72 ASP n 1 73 ASP n 1 74 LYS n 1 75 ILE n 1 76 SER n 1 77 HIS n 1 78 LEU n 1 79 VAL n 1 80 GLN n 1 81 ASN n 1 82 VAL n 1 83 LYS n 1 84 ASP n 1 85 LYS n 1 86 ASP n 1 87 THR n 1 88 LEU n 1 89 VAL n 1 90 PHE n 1 91 HIS n 1 92 SER n 1 93 ALA n 1 94 LEU n 1 95 SER n 1 96 GLN n 1 97 VAL n 1 98 ARG n 1 99 GLY n 1 100 PRO n 1 101 THR n 1 102 CYS n 1 103 ALA n 1 104 ARG n 1 105 ARG n 1 106 LEU n 1 107 VAL n 1 108 ASN n 1 109 TYR n 1 110 LEU n 1 111 ASP n 1 112 GLU n 1 113 LYS n 1 114 LYS n 1 115 GLU n 1 116 ASP n 1 117 THR n 1 118 GLY n 1 119 ILE n 1 120 LYS n 1 121 ASN n 1 122 ILE n 1 123 MET n 1 124 ILE n 1 125 LEU n 1 126 GLU n 1 127 ARG n 1 128 GLY n 1 129 PHE n 1 130 ASN n 1 131 GLY n 1 132 TRP n 1 133 GLU n 1 134 ALA n 1 135 SER n 1 136 GLY n 1 137 LYS n 1 138 PRO n 1 139 VAL n 1 140 CYS n 1 141 ARG n 1 142 CYS n 1 143 ALA n 1 144 GLU n 1 145 VAL n 1 146 PRO n 1 147 CYS n 1 148 LYS n 1 149 GLY n 1 150 ASP n 1 151 CYS n 1 152 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'thale cress' _entity_src_gen.gene_src_genus Arabidopsis _entity_src_gen.pdbx_gene_src_gene CDC25 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)star' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CDC25_ARATH _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAMARSISYITSTQLLPLHRRPNIAIIDVRDEERNYDGHIAGSLHYASGSFDDKISHLVQNVKDKDTLVFHCALSQVRGP TCARRLVNYLDEKKEDTGIKNIMILERGFNGWEASGKPVCRCAEVPCKGDCA ; _struct_ref.pdbx_align_begin 15 _struct_ref.pdbx_db_accession Q8GY31 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1T3K _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 152 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8GY31 _struct_ref_seq.db_align_beg 15 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 146 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 132 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1T3K MET A 1 ? UNP Q8GY31 ? ? 'cloning artifact' -19 1 1 1T3K GLY A 2 ? UNP Q8GY31 ? ? 'cloning artifact' -18 2 1 1T3K SER A 3 ? UNP Q8GY31 ? ? 'cloning artifact' -17 3 1 1T3K SER A 4 ? UNP Q8GY31 ? ? 'cloning artifact' -16 4 1 1T3K HIS A 5 ? UNP Q8GY31 ? ? 'cloning artifact' -15 5 1 1T3K HIS A 6 ? UNP Q8GY31 ? ? 'cloning artifact' -14 6 1 1T3K HIS A 7 ? UNP Q8GY31 ? ? 'cloning artifact' -13 7 1 1T3K HIS A 8 ? UNP Q8GY31 ? ? 'cloning artifact' -12 8 1 1T3K HIS A 9 ? UNP Q8GY31 ? ? 'cloning artifact' -11 9 1 1T3K HIS A 10 ? UNP Q8GY31 ? ? 'cloning artifact' -10 10 1 1T3K SER A 11 ? UNP Q8GY31 ? ? 'cloning artifact' -9 11 1 1T3K SER A 12 ? UNP Q8GY31 ? ? 'cloning artifact' -8 12 1 1T3K GLY A 13 ? UNP Q8GY31 ? ? 'cloning artifact' -7 13 1 1T3K LEU A 14 ? UNP Q8GY31 ? ? 'cloning artifact' -6 14 1 1T3K VAL A 15 ? UNP Q8GY31 ? ? 'cloning artifact' -5 15 1 1T3K PRO A 16 ? UNP Q8GY31 ? ? 'cloning artifact' -4 16 1 1T3K ARG A 17 ? UNP Q8GY31 ? ? 'cloning artifact' -3 17 1 1T3K GLY A 18 ? UNP Q8GY31 ? ? 'cloning artifact' -2 18 1 1T3K SER A 19 ? UNP Q8GY31 ? ? 'cloning artifact' -1 19 1 1T3K HIS A 20 ? UNP Q8GY31 ? ? 'cloning artifact' 0 20 1 1T3K SER A 92 ? UNP Q8GY31 CYS 86 'engineered mutation' 72 21 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_HNcaCO 2 1 1 '3D HNCO' 3 1 1 '3D CBCA(CO)NH' 4 1 1 '3D HNCA' 5 2 1 3D_15N-separated_NOESY 6 3 1 3D_13C-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '400 microM U-15N,13C Arath;CDC25' ;25 mM phosphate buffer, pH7.6 250 mM NaCl 5 mM b-mercapthoethanol 95% H2O, 5% D2O ; 2 '400 microM U-15N Arath;CDC25' ;25 mM phosphate buffer, pH7.6 250 mM NaCl 5 mM b-mercapthoethanol 95% H2O, 5% D2O ; 3 '400 microM 13C Arath;CDC25' ;25 mM phosphate buffer, pH7.6 250 mM NaCl 5 mM b-mercapthoethanol 100%D2O ; # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 600 2 ? Bruker AVANCE 800 # _pdbx_nmr_refine.entry_id 1T3K _pdbx_nmr_refine.method ;distance geometry simulated annealing ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1T3K _pdbx_nmr_details.text cryo-probehead # _pdbx_nmr_ensemble.entry_id 1T3K _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1T3K _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 3.1 collection Bruker 1 SNARF ? processing 'Frank Van Hoesel, Groningen, the Netherlands' 2 CNS 1.1 'structure solution' 'Brunger et al.' 3 CNS 1.1 refinement 'Brunger et al.' 4 # _exptl.entry_id 1T3K _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1T3K _struct.title 'NMR structure of a CDC25-like dual-specificity tyrosine phosphatase of Arabidopsis thaliana' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1T3K _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'CDC25, cell cycle, phosphorylation, plant, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 52 ? ASP A 57 ? GLU A 32 ASP A 37 1 ? 6 HELX_P HELX_P2 2 LYS A 74 ? ASN A 81 ? LYS A 54 ASN A 61 1 ? 8 HELX_P HELX_P3 3 ARG A 98 ? LYS A 113 ? ARG A 78 LYS A 93 1 ? 16 HELX_P HELX_P4 4 PHE A 129 ? GLY A 136 ? PHE A 109 GLY A 116 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 59 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 39 A ZN 201 1_555 ? ? ? ? ? ? ? 2.048 ? ? metalc2 metalc ? ? A CYS 140 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 120 A ZN 201 1_555 ? ? ? ? ? ? ? 2.255 ? ? metalc3 metalc ? ? A CYS 142 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 122 A ZN 201 1_555 ? ? ? ? ? ? ? 2.547 ? ? metalc4 metalc ? ? A CYS 147 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 127 A ZN 201 1_555 ? ? ? ? ? ? ? 2.357 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 28 ? ILE A 30 ? SER A 8 ILE A 10 A 2 ASN A 121 ? LEU A 125 ? ASN A 101 LEU A 105 A 3 THR A 87 ? PHE A 90 ? THR A 67 PHE A 70 A 4 ILE A 44 ? VAL A 49 ? ILE A 24 VAL A 29 A 5 LEU A 64 ? TYR A 66 ? LEU A 44 TYR A 46 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 30 ? N ILE A 10 O ILE A 124 ? O ILE A 104 A 2 3 O ASN A 121 ? O ASN A 101 N LEU A 88 ? N LEU A 68 A 3 4 O VAL A 89 ? O VAL A 69 N ALA A 45 ? N ALA A 25 A 4 5 N ILE A 46 ? N ILE A 26 O LEU A 64 ? O LEU A 44 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 59 ? HIS A 39 . ? 1_555 ? 2 AC1 4 CYS A 140 ? CYS A 120 . ? 1_555 ? 3 AC1 4 CYS A 142 ? CYS A 122 . ? 1_555 ? 4 AC1 4 CYS A 147 ? CYS A 127 . ? 1_555 ? # _database_PDB_matrix.entry_id 1T3K _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1T3K _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 ? ? ? A . n A 1 19 SER 19 -1 ? ? ? A . n A 1 20 HIS 20 0 ? ? ? A . n A 1 21 MET 21 1 1 MET MET A . n A 1 22 ALA 22 2 2 ALA ALA A . n A 1 23 MET 23 3 3 MET MET A . n A 1 24 ALA 24 4 4 ALA ALA A . n A 1 25 ARG 25 5 5 ARG ARG A . n A 1 26 SER 26 6 6 SER SER A . n A 1 27 ILE 27 7 7 ILE ILE A . n A 1 28 SER 28 8 8 SER SER A . n A 1 29 TYR 29 9 9 TYR TYR A . n A 1 30 ILE 30 10 10 ILE ILE A . n A 1 31 THR 31 11 11 THR THR A . n A 1 32 SER 32 12 12 SER SER A . n A 1 33 THR 33 13 13 THR THR A . n A 1 34 GLN 34 14 14 GLN GLN A . n A 1 35 LEU 35 15 15 LEU LEU A . n A 1 36 LEU 36 16 16 LEU LEU A . n A 1 37 PRO 37 17 17 PRO PRO A . n A 1 38 LEU 38 18 18 LEU LEU A . n A 1 39 HIS 39 19 19 HIS HIS A . n A 1 40 ARG 40 20 20 ARG ARG A . n A 1 41 ARG 41 21 21 ARG ARG A . n A 1 42 PRO 42 22 22 PRO PRO A . n A 1 43 ASN 43 23 23 ASN ASN A . n A 1 44 ILE 44 24 24 ILE ILE A . n A 1 45 ALA 45 25 25 ALA ALA A . n A 1 46 ILE 46 26 26 ILE ILE A . n A 1 47 ILE 47 27 27 ILE ILE A . n A 1 48 ASP 48 28 28 ASP ASP A . n A 1 49 VAL 49 29 29 VAL VAL A . n A 1 50 ARG 50 30 30 ARG ARG A . n A 1 51 ASP 51 31 31 ASP ASP A . n A 1 52 GLU 52 32 32 GLU GLU A . n A 1 53 GLU 53 33 33 GLU GLU A . n A 1 54 ARG 54 34 34 ARG ARG A . n A 1 55 ASN 55 35 35 ASN ASN A . n A 1 56 TYR 56 36 36 TYR TYR A . n A 1 57 ASP 57 37 37 ASP ASP A . n A 1 58 GLY 58 38 38 GLY GLY A . n A 1 59 HIS 59 39 39 HIS HIS A . n A 1 60 ILE 60 40 40 ILE ILE A . n A 1 61 ALA 61 41 41 ALA ALA A . n A 1 62 GLY 62 42 42 GLY GLY A . n A 1 63 SER 63 43 43 SER SER A . n A 1 64 LEU 64 44 44 LEU LEU A . n A 1 65 HIS 65 45 45 HIS HIS A . n A 1 66 TYR 66 46 46 TYR TYR A . n A 1 67 ALA 67 47 47 ALA ALA A . n A 1 68 SER 68 48 48 SER SER A . n A 1 69 GLY 69 49 49 GLY GLY A . n A 1 70 SER 70 50 50 SER SER A . n A 1 71 PHE 71 51 51 PHE PHE A . n A 1 72 ASP 72 52 52 ASP ASP A . n A 1 73 ASP 73 53 53 ASP ASP A . n A 1 74 LYS 74 54 54 LYS LYS A . n A 1 75 ILE 75 55 55 ILE ILE A . n A 1 76 SER 76 56 56 SER SER A . n A 1 77 HIS 77 57 57 HIS HIS A . n A 1 78 LEU 78 58 58 LEU LEU A . n A 1 79 VAL 79 59 59 VAL VAL A . n A 1 80 GLN 80 60 60 GLN GLN A . n A 1 81 ASN 81 61 61 ASN ASN A . n A 1 82 VAL 82 62 62 VAL VAL A . n A 1 83 LYS 83 63 63 LYS LYS A . n A 1 84 ASP 84 64 64 ASP ASP A . n A 1 85 LYS 85 65 65 LYS LYS A . n A 1 86 ASP 86 66 66 ASP ASP A . n A 1 87 THR 87 67 67 THR THR A . n A 1 88 LEU 88 68 68 LEU LEU A . n A 1 89 VAL 89 69 69 VAL VAL A . n A 1 90 PHE 90 70 70 PHE PHE A . n A 1 91 HIS 91 71 71 HIS HIS A . n A 1 92 SER 92 72 72 SER SER A . n A 1 93 ALA 93 73 73 ALA ALA A . n A 1 94 LEU 94 74 74 LEU LEU A . n A 1 95 SER 95 75 75 SER SER A . n A 1 96 GLN 96 76 76 GLN GLN A . n A 1 97 VAL 97 77 77 VAL VAL A . n A 1 98 ARG 98 78 78 ARG ARG A . n A 1 99 GLY 99 79 79 GLY GLY A . n A 1 100 PRO 100 80 80 PRO PRO A . n A 1 101 THR 101 81 81 THR THR A . n A 1 102 CYS 102 82 82 CYS CYS A . n A 1 103 ALA 103 83 83 ALA ALA A . n A 1 104 ARG 104 84 84 ARG ARG A . n A 1 105 ARG 105 85 85 ARG ARG A . n A 1 106 LEU 106 86 86 LEU LEU A . n A 1 107 VAL 107 87 87 VAL VAL A . n A 1 108 ASN 108 88 88 ASN ASN A . n A 1 109 TYR 109 89 89 TYR TYR A . n A 1 110 LEU 110 90 90 LEU LEU A . n A 1 111 ASP 111 91 91 ASP ASP A . n A 1 112 GLU 112 92 92 GLU GLU A . n A 1 113 LYS 113 93 93 LYS LYS A . n A 1 114 LYS 114 94 94 LYS LYS A . n A 1 115 GLU 115 95 95 GLU GLU A . n A 1 116 ASP 116 96 96 ASP ASP A . n A 1 117 THR 117 97 97 THR THR A . n A 1 118 GLY 118 98 98 GLY GLY A . n A 1 119 ILE 119 99 99 ILE ILE A . n A 1 120 LYS 120 100 100 LYS LYS A . n A 1 121 ASN 121 101 101 ASN ASN A . n A 1 122 ILE 122 102 102 ILE ILE A . n A 1 123 MET 123 103 103 MET MET A . n A 1 124 ILE 124 104 104 ILE ILE A . n A 1 125 LEU 125 105 105 LEU LEU A . n A 1 126 GLU 126 106 106 GLU GLU A . n A 1 127 ARG 127 107 107 ARG ARG A . n A 1 128 GLY 128 108 108 GLY GLY A . n A 1 129 PHE 129 109 109 PHE PHE A . n A 1 130 ASN 130 110 110 ASN ASN A . n A 1 131 GLY 131 111 111 GLY GLY A . n A 1 132 TRP 132 112 112 TRP TRP A . n A 1 133 GLU 133 113 113 GLU GLU A . n A 1 134 ALA 134 114 114 ALA ALA A . n A 1 135 SER 135 115 115 SER SER A . n A 1 136 GLY 136 116 116 GLY GLY A . n A 1 137 LYS 137 117 117 LYS LYS A . n A 1 138 PRO 138 118 118 PRO PRO A . n A 1 139 VAL 139 119 119 VAL VAL A . n A 1 140 CYS 140 120 120 CYS CYS A . n A 1 141 ARG 141 121 121 ARG ARG A . n A 1 142 CYS 142 122 122 CYS CYS A . n A 1 143 ALA 143 123 123 ALA ALA A . n A 1 144 GLU 144 124 124 GLU GLU A . n A 1 145 VAL 145 125 125 VAL VAL A . n A 1 146 PRO 146 126 126 PRO PRO A . n A 1 147 CYS 147 127 127 CYS CYS A . n A 1 148 LYS 148 128 128 LYS LYS A . n A 1 149 GLY 149 129 129 GLY GLY A . n A 1 150 ASP 150 130 130 ASP ASP A . n A 1 151 CYS 151 131 131 CYS CYS A . n A 1 152 ALA 152 132 132 ALA ALA A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 59 ? A HIS 39 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 140 ? A CYS 120 ? 1_555 128.6 ? 2 ND1 ? A HIS 59 ? A HIS 39 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 142 ? A CYS 122 ? 1_555 115.4 ? 3 SG ? A CYS 140 ? A CYS 120 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 142 ? A CYS 122 ? 1_555 86.8 ? 4 ND1 ? A HIS 59 ? A HIS 39 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 147 ? A CYS 127 ? 1_555 116.9 ? 5 SG ? A CYS 140 ? A CYS 120 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 147 ? A CYS 127 ? 1_555 110.8 ? 6 SG ? A CYS 142 ? A CYS 122 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 147 ? A CYS 127 ? 1_555 84.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-09-07 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 4 'Structure model' '_struct_ref_seq_dif.details' 18 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ASN 23 ? ? H A THR 67 ? ? 1.57 2 2 HB1 A ALA 41 ? ? H A ASP 130 ? ? 1.31 3 2 O A ASP 66 ? ? H A LYS 100 ? ? 1.40 4 2 O A ASP 31 ? ? H A ARG 34 ? ? 1.60 5 3 O A ARG 78 ? ? H A THR 81 ? ? 1.41 6 3 O A CYS 127 ? ? H A ALA 132 ? ? 1.58 7 3 O A ASP 66 ? ? H A LYS 100 ? ? 1.58 8 3 CA A ALA 41 ? ? O A ASP 130 ? ? 2.13 9 3 O A ARG 78 ? ? N A THR 81 ? ? 2.16 10 4 O A LEU 74 ? ? H A GLN 76 ? ? 1.49 11 4 O A ASP 66 ? ? H A LYS 100 ? ? 1.56 12 5 O A ASP 31 ? ? H A ARG 34 ? ? 1.60 13 6 O A ASP 66 ? ? H A LYS 100 ? ? 1.54 14 6 O A ASP 31 ? ? H A ARG 34 ? ? 1.58 15 6 O A ASN 23 ? ? H A THR 67 ? ? 1.59 16 7 O A ASP 28 ? ? NH1 A ARG 30 ? ? 1.42 17 7 O A ASN 23 ? ? HG1 A THR 67 ? ? 1.43 18 7 O A ASP 66 ? ? H A LYS 100 ? ? 1.45 19 7 O A LYS 63 ? ? H A LYS 65 ? ? 1.49 20 7 HE A ARG 30 ? ? O A LEU 44 ? ? 1.53 21 7 O A ASP 28 ? ? HH11 A ARG 30 ? ? 1.54 22 7 O A ASN 23 ? ? OG1 A THR 67 ? ? 1.69 23 7 O A ASP 28 ? ? CZ A ARG 30 ? ? 1.81 24 8 HA A ALA 41 ? ? O A ASP 130 ? ? 1.31 25 8 O A ASP 31 ? ? H A ARG 34 ? ? 1.52 26 8 O A LYS 117 ? ? H A VAL 119 ? ? 1.53 27 9 O A HIS 39 ? ? N A CYS 120 ? ? 2.18 28 9 O A LEU 74 ? ? N A GLN 76 ? ? 2.19 29 10 O A ASP 66 ? ? H A LYS 100 ? ? 1.38 30 11 O A ASP 66 ? ? H A LYS 100 ? ? 1.51 31 11 O A ASP 28 ? ? HB3 A HIS 45 ? ? 1.57 32 12 O A ASP 66 ? ? H A LYS 100 ? ? 1.58 33 12 O A LYS 117 ? ? H A VAL 119 ? ? 1.59 34 13 HB A ILE 10 ? ? HG2 A GLN 14 ? ? 1.18 35 13 O A ASP 66 ? ? H A LYS 100 ? ? 1.41 36 13 O A THR 11 ? ? HG3 A GLN 14 ? ? 1.51 37 14 HA A ALA 41 ? ? H A ASP 130 ? ? 0.97 38 14 O A ASP 66 ? ? H A LYS 100 ? ? 1.54 39 14 O A ASN 23 ? ? H A THR 67 ? ? 1.54 40 14 O A ASN 23 ? ? N A THR 67 ? ? 2.18 41 15 O A ILE 40 ? ? H A ASP 130 ? ? 1.53 42 15 O A ASP 66 ? ? H A LYS 100 ? ? 1.60 43 16 HA A ALA 41 ? ? H A ASP 130 ? ? 1.00 44 16 O A ASP 66 ? ? H A LYS 100 ? ? 1.41 45 16 O A TRP 112 ? ? H A LYS 117 ? ? 1.52 46 16 O A ARG 107 ? ? H A PHE 109 ? ? 1.55 47 16 O A GLY 111 ? ? H A SER 115 ? ? 1.58 48 16 CB A ALA 41 ? ? O A ASP 130 ? ? 2.18 49 17 HA A ALA 41 ? ? O A ASP 130 ? ? 1.43 50 17 O A GLY 111 ? ? H A SER 115 ? ? 1.56 51 18 HA A ALA 41 ? ? O A ASP 130 ? ? 1.41 52 18 O A ASP 66 ? ? H A LYS 100 ? ? 1.49 53 18 O A PHE 70 ? ? HD1 A HIS 71 ? ? 1.57 54 18 O A LYS 63 ? ? H A LYS 65 ? ? 1.60 55 19 H A GLY 42 ? ? O A LYS 128 ? ? 1.42 56 19 O A LYS 128 ? ? H A ASP 130 ? ? 1.58 57 20 O A VAL 125 ? ? H A CYS 127 ? ? 1.52 58 20 O A ASP 66 ? ? H A LYS 100 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? 60.04 80.90 2 1 MET A 3 ? ? -163.66 35.26 3 1 ALA A 4 ? ? -152.95 81.53 4 1 SER A 6 ? ? 61.18 154.46 5 1 LEU A 18 ? ? -96.99 -88.52 6 1 ARG A 21 ? ? 157.64 -174.10 7 1 PRO A 22 ? ? -46.13 -13.07 8 1 ASN A 23 ? ? -56.43 -9.20 9 1 ARG A 30 ? ? 178.25 -32.69 10 1 ASP A 31 ? ? 154.14 -21.19 11 1 GLU A 32 ? ? 75.19 -59.18 12 1 ILE A 40 ? ? -170.14 -174.92 13 1 SER A 43 ? ? 59.46 131.59 14 1 ALA A 47 ? ? -65.27 -160.40 15 1 SER A 48 ? ? -168.48 28.05 16 1 PHE A 51 ? ? 75.13 -13.10 17 1 ASP A 64 ? ? 66.97 -65.82 18 1 HIS A 71 ? ? 98.45 -70.04 19 1 SER A 72 ? ? 99.31 -12.24 20 1 ALA A 73 ? ? -113.40 -83.32 21 1 LEU A 74 ? ? -169.56 35.55 22 1 VAL A 77 ? ? 178.85 -29.35 23 1 LYS A 93 ? ? -109.40 -74.73 24 1 LYS A 94 ? ? 131.40 134.28 25 1 ASP A 96 ? ? -54.99 -93.96 26 1 THR A 97 ? ? 39.29 70.98 27 1 PHE A 109 ? ? -155.88 20.80 28 1 LYS A 117 ? ? 64.20 158.60 29 1 PRO A 118 ? ? -40.52 -94.19 30 1 CYS A 120 ? ? -31.35 140.17 31 1 ARG A 121 ? ? -112.53 -81.96 32 1 CYS A 122 ? ? 43.70 -161.82 33 1 ALA A 123 ? ? -159.08 31.63 34 1 LYS A 128 ? ? 60.80 176.88 35 2 ALA A 2 ? ? 65.50 83.10 36 2 ARG A 5 ? ? 72.78 152.98 37 2 ILE A 7 ? ? -51.99 -179.41 38 2 ARG A 20 ? ? 86.60 -27.39 39 2 ARG A 21 ? ? 60.75 123.62 40 2 ASN A 23 ? ? -67.16 67.96 41 2 ARG A 30 ? ? -168.81 -41.19 42 2 ASP A 31 ? ? 85.85 -154.66 43 2 ILE A 40 ? ? -43.74 90.23 44 2 SER A 43 ? ? -104.51 -95.07 45 2 TYR A 46 ? ? -154.52 -153.70 46 2 ALA A 47 ? ? -164.84 -169.56 47 2 SER A 50 ? ? -148.83 33.48 48 2 ASP A 52 ? ? -95.98 32.67 49 2 VAL A 62 ? ? 85.32 -30.14 50 2 LYS A 65 ? ? -114.35 72.78 51 2 HIS A 71 ? ? 142.73 -97.92 52 2 SER A 72 ? ? 61.64 -73.64 53 2 GLN A 76 ? ? -111.05 -79.24 54 2 LYS A 93 ? ? -143.27 57.67 55 2 LYS A 94 ? ? -58.43 108.62 56 2 GLU A 95 ? ? -160.39 115.23 57 2 ASP A 96 ? ? 44.78 92.49 58 2 THR A 97 ? ? -50.07 99.52 59 2 ARG A 107 ? ? 98.41 -29.26 60 2 SER A 115 ? ? -34.85 -29.98 61 2 PRO A 118 ? ? -50.49 -170.55 62 2 CYS A 120 ? ? 59.70 114.18 63 2 CYS A 122 ? ? 67.73 -173.77 64 2 ALA A 123 ? ? 118.52 2.71 65 2 GLU A 124 ? ? 85.22 -166.60 66 2 VAL A 125 ? ? 13.59 -74.67 67 2 LYS A 128 ? ? 75.54 132.29 68 3 ALA A 2 ? ? 64.98 178.73 69 3 MET A 3 ? ? -146.06 -156.20 70 3 ALA A 4 ? ? 81.88 104.82 71 3 ARG A 5 ? ? -179.80 56.90 72 3 SER A 6 ? ? 64.65 142.33 73 3 ILE A 7 ? ? 44.34 -179.46 74 3 HIS A 19 ? ? -80.05 44.52 75 3 ARG A 20 ? ? -73.76 38.47 76 3 PRO A 22 ? ? -38.10 -29.28 77 3 ARG A 30 ? ? -148.50 -75.83 78 3 ASP A 31 ? ? 143.27 -130.91 79 3 ASP A 37 ? ? -98.52 34.55 80 3 HIS A 39 ? ? -150.51 -138.22 81 3 ILE A 40 ? ? 176.50 106.85 82 3 SER A 43 ? ? 53.44 169.33 83 3 TYR A 46 ? ? -177.26 -160.09 84 3 ALA A 47 ? ? -150.38 -155.48 85 3 ASN A 61 ? ? -100.53 -73.56 86 3 VAL A 62 ? ? 39.90 36.67 87 3 LYS A 65 ? ? -79.77 -83.97 88 3 HIS A 71 ? ? 127.78 -84.79 89 3 SER A 72 ? ? 109.09 15.74 90 3 ALA A 73 ? ? 53.89 90.87 91 3 LEU A 74 ? ? 77.36 33.89 92 3 GLN A 76 ? ? 161.73 34.00 93 3 VAL A 77 ? ? 73.88 -2.03 94 3 LYS A 93 ? ? -153.20 35.92 95 3 LYS A 94 ? ? 49.62 89.02 96 3 GLU A 95 ? ? 174.23 -168.11 97 3 ASP A 96 ? ? 151.55 -24.78 98 3 THR A 97 ? ? -52.15 -173.61 99 3 PHE A 109 ? ? -151.84 29.45 100 3 LYS A 117 ? ? 38.72 39.23 101 3 PRO A 118 ? ? -82.02 45.20 102 3 CYS A 120 ? ? 41.30 154.99 103 3 ARG A 121 ? ? 176.14 38.56 104 3 ALA A 123 ? ? 178.04 -33.25 105 3 VAL A 125 ? ? 51.19 -174.42 106 3 PRO A 126 ? ? -85.48 43.83 107 3 CYS A 127 ? ? 36.44 66.68 108 3 LYS A 128 ? ? 69.87 -162.57 109 3 CYS A 131 ? ? 34.19 80.74 110 4 ALA A 2 ? ? -175.53 46.87 111 4 MET A 3 ? ? -174.05 106.76 112 4 ALA A 4 ? ? -176.54 40.39 113 4 LEU A 18 ? ? 57.59 77.69 114 4 ARG A 20 ? ? 85.71 3.22 115 4 ASP A 31 ? ? 154.51 -41.37 116 4 ASP A 37 ? ? -35.97 -35.97 117 4 SER A 43 ? ? -55.67 -165.26 118 4 ALA A 47 ? ? -98.47 -151.53 119 4 SER A 48 ? ? -156.04 32.37 120 4 SER A 50 ? ? -160.81 32.73 121 4 VAL A 62 ? ? 52.59 3.94 122 4 LYS A 63 ? ? 34.24 36.41 123 4 LYS A 65 ? ? -160.39 -62.00 124 4 HIS A 71 ? ? 130.37 -90.57 125 4 SER A 72 ? ? 96.85 113.96 126 4 ALA A 73 ? ? 46.60 -91.28 127 4 LEU A 74 ? ? -166.67 74.80 128 4 SER A 75 ? ? -60.82 61.64 129 4 VAL A 77 ? ? 51.54 17.52 130 4 GLU A 92 ? ? -82.95 -70.29 131 4 LYS A 94 ? ? 63.43 134.70 132 4 GLU A 95 ? ? 50.71 111.75 133 4 ASP A 96 ? ? -115.19 -78.06 134 4 THR A 97 ? ? 65.47 -72.09 135 4 ARG A 107 ? ? -106.64 -60.31 136 4 PHE A 109 ? ? -155.52 3.15 137 4 LYS A 117 ? ? -25.23 -57.81 138 4 PRO A 118 ? ? -20.60 72.80 139 4 CYS A 120 ? ? -55.15 89.54 140 4 CYS A 122 ? ? 36.79 -150.12 141 4 ALA A 123 ? ? 173.81 39.34 142 4 CYS A 127 ? ? 46.60 -140.83 143 5 ALA A 4 ? ? -95.56 43.93 144 5 LEU A 18 ? ? -64.16 -73.27 145 5 HIS A 19 ? ? -173.91 -34.73 146 5 ARG A 20 ? ? 58.72 18.45 147 5 PRO A 22 ? ? -67.18 63.82 148 5 ASN A 23 ? ? -160.88 36.62 149 5 ARG A 30 ? ? 85.35 147.65 150 5 ASP A 37 ? ? 86.33 -12.18 151 5 SER A 43 ? ? -111.21 -121.29 152 5 TYR A 46 ? ? -176.27 -174.71 153 5 SER A 48 ? ? 90.67 64.18 154 5 PHE A 51 ? ? 66.65 -12.94 155 5 ASP A 64 ? ? 70.28 -64.57 156 5 HIS A 71 ? ? 151.36 -77.74 157 5 SER A 72 ? ? 94.96 84.12 158 5 ALA A 73 ? ? 63.77 -72.44 159 5 LEU A 74 ? ? 178.22 85.77 160 5 SER A 75 ? ? -64.88 34.53 161 5 LYS A 94 ? ? 51.47 94.84 162 5 THR A 97 ? ? 64.19 131.08 163 5 PRO A 118 ? ? -41.23 91.69 164 5 CYS A 120 ? ? -25.14 121.33 165 5 ARG A 121 ? ? -117.01 61.83 166 5 CYS A 122 ? ? -142.87 -129.35 167 5 ALA A 123 ? ? -163.35 -33.95 168 5 GLU A 124 ? ? -139.53 -145.10 169 5 VAL A 125 ? ? 53.43 174.61 170 5 PRO A 126 ? ? -59.17 74.66 171 5 CYS A 127 ? ? -40.40 -84.84 172 5 LYS A 128 ? ? -138.10 -43.42 173 6 MET A 3 ? ? -166.04 52.08 174 6 ALA A 4 ? ? -175.81 96.08 175 6 ARG A 5 ? ? -166.62 -164.69 176 6 ILE A 7 ? ? 33.59 37.50 177 6 PRO A 17 ? ? -97.23 33.73 178 6 HIS A 19 ? ? 168.67 -33.62 179 6 ARG A 20 ? ? 65.32 67.44 180 6 ARG A 30 ? ? -178.00 35.16 181 6 ASP A 31 ? ? 48.59 -164.26 182 6 GLU A 32 ? ? -34.94 -34.23 183 6 ASP A 37 ? ? 39.17 33.36 184 6 HIS A 39 ? ? -90.55 -155.86 185 6 ILE A 40 ? ? 36.36 30.41 186 6 SER A 43 ? ? 42.91 -156.07 187 6 ALA A 47 ? ? -110.36 -168.08 188 6 SER A 48 ? ? -156.87 40.88 189 6 PHE A 51 ? ? 75.21 -23.05 190 6 GLN A 60 ? ? -71.41 -74.91 191 6 ASN A 61 ? ? 35.45 43.32 192 6 ASP A 64 ? ? 80.37 -60.39 193 6 LYS A 65 ? ? -61.06 97.92 194 6 HIS A 71 ? ? 105.85 -75.79 195 6 SER A 72 ? ? 74.21 53.84 196 6 ALA A 73 ? ? 83.38 -44.17 197 6 LEU A 74 ? ? 167.94 58.52 198 6 GLN A 76 ? ? 174.69 26.65 199 6 VAL A 77 ? ? 70.48 -11.76 200 6 GLU A 95 ? ? -55.39 -169.61 201 6 ASP A 96 ? ? 68.37 94.51 202 6 ARG A 107 ? ? -162.81 33.09 203 6 PHE A 109 ? ? 78.08 -1.19 204 6 SER A 115 ? ? -171.80 52.74 205 6 PRO A 118 ? ? -38.85 145.22 206 6 CYS A 120 ? ? 9.62 -83.73 207 6 ARG A 121 ? ? 121.23 8.74 208 6 CYS A 122 ? ? -112.29 -167.17 209 6 ALA A 123 ? ? -167.06 53.43 210 6 GLU A 124 ? ? -174.15 -171.68 211 6 PRO A 126 ? ? -53.54 1.02 212 6 CYS A 127 ? ? -57.87 -145.50 213 6 LYS A 128 ? ? -129.10 -57.19 214 7 ALA A 2 ? ? -136.76 -157.67 215 7 ALA A 4 ? ? -150.22 29.56 216 7 SER A 6 ? ? 68.56 -62.97 217 7 ILE A 7 ? ? -96.24 -159.22 218 7 ARG A 20 ? ? -96.23 34.20 219 7 ASN A 23 ? ? -177.88 63.26 220 7 ARG A 30 ? ? -114.22 -108.30 221 7 ASP A 31 ? ? 152.54 -89.98 222 7 ASP A 37 ? ? 99.20 -35.00 223 7 ILE A 40 ? ? 40.05 27.83 224 7 SER A 43 ? ? 59.28 137.66 225 7 SER A 50 ? ? -147.56 40.90 226 7 ASN A 61 ? ? 42.25 21.39 227 7 VAL A 62 ? ? 78.26 -18.02 228 7 LYS A 63 ? ? -178.11 71.73 229 7 ASP A 64 ? ? 46.69 -62.30 230 7 LYS A 65 ? ? -31.44 98.38 231 7 HIS A 71 ? ? 134.20 -95.40 232 7 SER A 72 ? ? 45.98 -85.08 233 7 GLN A 76 ? ? -97.66 -81.27 234 7 VAL A 77 ? ? -140.76 -1.06 235 7 LYS A 93 ? ? -128.42 -52.92 236 7 GLU A 95 ? ? -143.22 28.98 237 7 ASP A 96 ? ? -169.74 77.67 238 7 ARG A 107 ? ? -151.98 -43.86 239 7 SER A 115 ? ? -82.71 35.87 240 7 CYS A 120 ? ? -13.24 -104.79 241 7 ARG A 121 ? ? 167.68 -51.05 242 7 CYS A 122 ? ? -58.57 -134.50 243 7 ALA A 123 ? ? -177.28 36.93 244 7 PRO A 126 ? ? -34.69 -28.53 245 7 CYS A 127 ? ? -56.36 -151.71 246 7 LYS A 128 ? ? -124.94 -50.29 247 8 ARG A 5 ? ? 44.59 -167.71 248 8 SER A 6 ? ? -54.67 -177.22 249 8 ILE A 7 ? ? 44.84 113.48 250 8 LEU A 18 ? ? 78.63 85.38 251 8 ARG A 20 ? ? 75.77 75.61 252 8 ASN A 23 ? ? -54.07 87.33 253 8 ARG A 30 ? ? 54.12 170.76 254 8 ILE A 40 ? ? -67.35 75.24 255 8 SER A 43 ? ? 164.12 107.36 256 8 SER A 50 ? ? 95.82 20.92 257 8 GLN A 60 ? ? -77.74 -72.55 258 8 ASN A 61 ? ? 44.52 11.10 259 8 VAL A 62 ? ? 30.93 38.09 260 8 LYS A 65 ? ? -155.74 80.92 261 8 HIS A 71 ? ? 154.99 -65.97 262 8 SER A 72 ? ? 104.81 -161.63 263 8 LEU A 74 ? ? 174.45 76.53 264 8 SER A 75 ? ? -45.11 -19.71 265 8 VAL A 77 ? ? 155.08 -20.08 266 8 LYS A 93 ? ? 92.45 51.83 267 8 GLU A 95 ? ? 49.57 -177.33 268 8 THR A 97 ? ? 64.60 -156.11 269 8 ARG A 107 ? ? -91.02 -69.27 270 8 PHE A 109 ? ? -164.95 27.54 271 8 LYS A 117 ? ? 32.17 53.75 272 8 PRO A 118 ? ? -66.93 48.75 273 8 CYS A 120 ? ? 35.48 -96.61 274 8 CYS A 122 ? ? -103.60 -147.90 275 8 ALA A 123 ? ? -174.28 -30.99 276 8 LYS A 128 ? ? 80.47 118.95 277 8 CYS A 131 ? ? 167.43 51.96 278 9 MET A 3 ? ? -174.74 -179.70 279 9 ALA A 4 ? ? 59.95 76.15 280 9 SER A 6 ? ? 63.29 139.90 281 9 HIS A 19 ? ? 83.72 -19.70 282 9 VAL A 29 ? ? -90.06 59.02 283 9 ASP A 37 ? ? 94.02 -40.74 284 9 HIS A 39 ? ? -173.09 94.98 285 9 ILE A 40 ? ? -114.06 -71.59 286 9 SER A 43 ? ? 51.47 178.17 287 9 SER A 48 ? ? -153.08 23.52 288 9 PHE A 51 ? ? 49.15 20.51 289 9 ASP A 52 ? ? -153.54 16.06 290 9 ASN A 61 ? ? -145.29 55.56 291 9 LYS A 63 ? ? 69.46 77.12 292 9 HIS A 71 ? ? 75.12 -75.39 293 9 SER A 72 ? ? 119.66 -40.75 294 9 ALA A 73 ? ? -118.28 -142.32 295 9 SER A 75 ? ? -38.93 73.62 296 9 VAL A 77 ? ? 50.45 18.85 297 9 LYS A 94 ? ? -31.57 147.41 298 9 GLU A 95 ? ? 76.34 32.84 299 9 ASP A 96 ? ? -99.64 -69.61 300 9 THR A 97 ? ? 52.37 -168.01 301 9 PHE A 109 ? ? -158.72 26.75 302 9 LYS A 117 ? ? 2.96 -68.57 303 9 PRO A 118 ? ? -13.66 74.75 304 9 ARG A 121 ? ? -160.08 57.53 305 9 ALA A 123 ? ? -153.73 29.16 306 9 GLU A 124 ? ? -87.06 -107.81 307 9 VAL A 125 ? ? 177.07 -40.67 308 9 CYS A 127 ? ? -33.65 -36.68 309 9 LYS A 128 ? ? 119.87 -172.02 310 10 MET A 3 ? ? 71.79 166.48 311 10 ARG A 5 ? ? -110.33 -168.47 312 10 SER A 6 ? ? 62.81 144.39 313 10 ILE A 7 ? ? 54.31 163.42 314 10 LEU A 18 ? ? -132.45 -75.59 315 10 HIS A 19 ? ? 97.88 3.92 316 10 ARG A 20 ? ? 64.23 72.94 317 10 ARG A 21 ? ? -37.55 -77.74 318 10 ASN A 23 ? ? 27.13 46.36 319 10 ARG A 30 ? ? 95.49 -18.33 320 10 ASP A 31 ? ? 70.87 -58.12 321 10 SER A 43 ? ? 66.94 139.74 322 10 ALA A 47 ? ? -92.19 -83.83 323 10 SER A 48 ? ? 167.23 -23.51 324 10 SER A 50 ? ? 128.86 -8.95 325 10 PHE A 51 ? ? 78.85 -22.14 326 10 LYS A 63 ? ? -79.69 -77.37 327 10 ASP A 64 ? ? 82.09 26.19 328 10 LYS A 65 ? ? -138.19 -56.98 329 10 SER A 72 ? ? 167.85 -38.99 330 10 ALA A 73 ? ? -143.89 -85.32 331 10 LEU A 74 ? ? -164.63 23.86 332 10 VAL A 77 ? ? -173.63 -71.14 333 10 LYS A 93 ? ? -170.66 -61.99 334 10 LYS A 94 ? ? 157.16 159.03 335 10 ASP A 96 ? ? 173.89 -178.42 336 10 ARG A 107 ? ? -166.89 70.86 337 10 LYS A 117 ? ? -17.80 -60.18 338 10 PRO A 118 ? ? -58.55 81.13 339 10 CYS A 120 ? ? 20.88 -148.85 340 10 ARG A 121 ? ? 169.91 49.88 341 10 ALA A 123 ? ? -154.90 -46.74 342 10 GLU A 124 ? ? -177.00 139.06 343 10 VAL A 125 ? ? 42.77 23.97 344 10 CYS A 127 ? ? -54.36 -175.66 345 11 ALA A 2 ? ? 63.29 124.63 346 11 SER A 6 ? ? -58.64 -78.03 347 11 SER A 12 ? ? -39.83 -70.26 348 11 HIS A 19 ? ? 174.38 78.69 349 11 ASN A 23 ? ? -66.48 65.11 350 11 ASP A 31 ? ? -45.83 172.50 351 11 TYR A 46 ? ? -36.19 -162.51 352 11 PHE A 51 ? ? 47.63 21.30 353 11 ASP A 52 ? ? -156.38 19.81 354 11 ASN A 61 ? ? -92.12 -61.17 355 11 ASP A 64 ? ? 51.08 -66.31 356 11 LYS A 65 ? ? -51.33 69.66 357 11 HIS A 71 ? ? 142.27 -83.19 358 11 SER A 72 ? ? 63.02 91.75 359 11 SER A 75 ? ? 42.09 25.58 360 11 VAL A 77 ? ? 86.50 -13.08 361 11 LYS A 94 ? ? 49.45 25.95 362 11 GLU A 95 ? ? 172.14 110.80 363 11 ASP A 96 ? ? 169.19 -176.45 364 11 THR A 97 ? ? -137.43 -72.38 365 11 ARG A 107 ? ? -110.80 -70.17 366 11 PHE A 109 ? ? 82.45 -12.01 367 11 SER A 115 ? ? -38.75 -31.21 368 11 CYS A 120 ? ? -2.96 107.18 369 11 ARG A 121 ? ? -66.48 82.68 370 11 CYS A 122 ? ? -48.14 172.16 371 11 ALA A 123 ? ? 153.45 44.18 372 11 GLU A 124 ? ? 62.62 153.97 373 11 PRO A 126 ? ? -111.63 -70.45 374 11 CYS A 127 ? ? -37.38 155.80 375 11 LYS A 128 ? ? -130.05 -47.06 376 12 ILE A 7 ? ? 47.17 111.60 377 12 LEU A 18 ? ? -99.38 49.71 378 12 HIS A 19 ? ? -67.32 25.71 379 12 ARG A 20 ? ? -90.66 39.00 380 12 ARG A 30 ? ? 174.73 -29.70 381 12 ASP A 31 ? ? 79.53 -52.02 382 12 ASP A 37 ? ? 83.79 -24.09 383 12 ILE A 40 ? ? -170.65 61.47 384 12 SER A 43 ? ? -91.43 -98.90 385 12 TYR A 46 ? ? 171.17 -145.60 386 12 ALA A 47 ? ? -143.28 -68.71 387 12 SER A 48 ? ? 168.98 -29.35 388 12 SER A 50 ? ? 154.37 -26.30 389 12 PHE A 51 ? ? 75.37 -22.86 390 12 ASN A 61 ? ? -75.84 -76.27 391 12 VAL A 62 ? ? 37.29 34.16 392 12 ASP A 64 ? ? 66.99 -63.28 393 12 LYS A 65 ? ? -68.34 76.22 394 12 HIS A 71 ? ? 161.45 -154.76 395 12 SER A 72 ? ? 98.45 25.90 396 12 ALA A 73 ? ? -130.62 -90.94 397 12 LEU A 74 ? ? -176.87 24.21 398 12 SER A 75 ? ? 30.93 48.57 399 12 VAL A 77 ? ? 179.86 -31.44 400 12 GLU A 95 ? ? -168.90 119.48 401 12 ASP A 96 ? ? 59.69 178.80 402 12 ARG A 107 ? ? 77.46 -53.43 403 12 PHE A 109 ? ? -99.88 -75.60 404 12 CYS A 122 ? ? -118.40 -142.52 405 12 ALA A 123 ? ? -171.61 28.90 406 12 GLU A 124 ? ? -178.87 -172.74 407 12 VAL A 125 ? ? 53.47 -175.46 408 12 PRO A 126 ? ? -49.63 -9.78 409 12 CYS A 127 ? ? 62.86 -62.22 410 12 LYS A 128 ? ? -131.99 -68.36 411 13 ALA A 2 ? ? 61.28 167.67 412 13 ALA A 4 ? ? -122.23 -159.74 413 13 ARG A 5 ? ? 74.29 122.31 414 13 ILE A 7 ? ? -64.71 68.99 415 13 HIS A 19 ? ? 91.94 -40.87 416 13 ARG A 20 ? ? 80.71 -19.22 417 13 ASN A 23 ? ? 39.92 62.94 418 13 ARG A 30 ? ? -176.69 20.53 419 13 ASP A 31 ? ? 51.51 178.77 420 13 GLU A 32 ? ? 66.84 -61.28 421 13 HIS A 39 ? ? -157.14 19.57 422 13 SER A 43 ? ? 57.15 -173.18 423 13 TYR A 46 ? ? -163.05 -164.40 424 13 ALA A 47 ? ? -125.32 -163.52 425 13 ASP A 64 ? ? 71.12 -57.98 426 13 HIS A 71 ? ? 132.61 -102.76 427 13 SER A 72 ? ? 37.99 33.49 428 13 ALA A 73 ? ? -155.62 -46.27 429 13 LEU A 74 ? ? -123.89 -57.32 430 13 GLN A 76 ? ? -92.21 -76.51 431 13 VAL A 77 ? ? -152.61 -3.45 432 13 LYS A 93 ? ? 171.61 67.89 433 13 GLU A 95 ? ? -112.19 -160.46 434 13 ASP A 96 ? ? -69.24 73.12 435 13 THR A 97 ? ? 41.96 95.50 436 13 PHE A 109 ? ? -152.66 19.63 437 13 LYS A 117 ? ? -23.40 -60.84 438 13 PRO A 118 ? ? -21.30 74.87 439 13 CYS A 120 ? ? 14.79 -82.51 440 13 ARG A 121 ? ? 91.43 -35.17 441 13 CYS A 122 ? ? 73.96 171.40 442 13 ALA A 123 ? ? 162.37 -31.03 443 13 GLU A 124 ? ? 156.28 -49.02 444 14 ARG A 5 ? ? -178.97 -172.95 445 14 SER A 6 ? ? -86.50 -80.67 446 14 LEU A 18 ? ? 56.84 13.64 447 14 ARG A 21 ? ? 93.00 84.73 448 14 ASN A 23 ? ? 38.89 61.72 449 14 ARG A 30 ? ? 179.22 -64.30 450 14 ASP A 31 ? ? 168.09 147.03 451 14 GLU A 32 ? ? -25.84 -55.65 452 14 HIS A 39 ? ? 174.52 51.04 453 14 ILE A 40 ? ? -40.39 160.52 454 14 SER A 43 ? ? 14.27 114.39 455 14 ALA A 47 ? ? -110.99 -161.15 456 14 ASP A 64 ? ? 67.24 -66.57 457 14 HIS A 71 ? ? 125.65 -95.41 458 14 SER A 72 ? ? 37.44 64.96 459 14 ALA A 73 ? ? -168.46 -48.92 460 14 LEU A 74 ? ? -131.26 -42.78 461 14 VAL A 77 ? ? 92.29 -17.27 462 14 LYS A 94 ? ? 33.26 94.98 463 14 GLU A 95 ? ? 60.01 -155.14 464 14 ASP A 96 ? ? 87.29 88.87 465 14 PHE A 109 ? ? 37.78 30.83 466 14 LYS A 117 ? ? 106.14 -73.47 467 14 PRO A 118 ? ? -65.93 88.51 468 14 CYS A 120 ? ? 38.66 -85.55 469 14 CYS A 122 ? ? -44.71 172.10 470 14 ALA A 123 ? ? 176.88 35.47 471 14 CYS A 127 ? ? 72.44 -17.46 472 14 LYS A 128 ? ? 52.17 -174.69 473 15 MET A 3 ? ? -164.50 100.26 474 15 LEU A 18 ? ? -84.23 30.80 475 15 HIS A 19 ? ? -98.48 42.26 476 15 ARG A 21 ? ? 135.07 138.83 477 15 PRO A 22 ? ? -60.20 72.82 478 15 ARG A 30 ? ? 169.66 -50.89 479 15 ASP A 31 ? ? 177.53 -152.23 480 15 ASP A 37 ? ? 37.53 42.58 481 15 ILE A 40 ? ? -46.72 -77.14 482 15 SER A 43 ? ? -104.65 -89.38 483 15 TYR A 46 ? ? 178.37 -178.83 484 15 ASN A 61 ? ? -95.24 -66.11 485 15 ASP A 64 ? ? 70.25 -65.70 486 15 LYS A 65 ? ? -65.88 90.22 487 15 HIS A 71 ? ? 126.04 -78.84 488 15 SER A 72 ? ? 72.69 -80.07 489 15 LEU A 74 ? ? 77.93 82.24 490 15 SER A 75 ? ? -48.16 -16.93 491 15 GLN A 76 ? ? 77.66 -22.46 492 15 VAL A 77 ? ? 175.85 -10.03 493 15 LYS A 94 ? ? 66.54 102.81 494 15 GLU A 95 ? ? 179.69 -156.61 495 15 THR A 97 ? ? 78.40 -18.84 496 15 PHE A 109 ? ? -142.53 19.53 497 15 SER A 115 ? ? -156.82 44.38 498 15 LYS A 117 ? ? 166.14 156.18 499 15 CYS A 120 ? ? 38.26 -79.53 500 15 ARG A 121 ? ? 87.63 -11.49 501 15 CYS A 122 ? ? 48.46 177.63 502 15 ALA A 123 ? ? 143.86 41.86 503 15 GLU A 124 ? ? 59.09 154.28 504 15 PRO A 126 ? ? -108.90 -70.43 505 15 LYS A 128 ? ? -141.49 -23.06 506 16 ALA A 2 ? ? 59.54 -170.74 507 16 MET A 3 ? ? 63.76 128.53 508 16 ALA A 4 ? ? 63.69 113.41 509 16 ARG A 5 ? ? 178.27 71.22 510 16 SER A 6 ? ? 61.61 -82.34 511 16 SER A 12 ? ? -21.45 -79.50 512 16 LEU A 18 ? ? 169.79 84.49 513 16 HIS A 19 ? ? -142.35 59.76 514 16 ASN A 23 ? ? -60.23 78.17 515 16 ARG A 30 ? ? -161.70 -71.13 516 16 ASP A 31 ? ? 150.84 -64.63 517 16 SER A 43 ? ? 80.94 131.08 518 16 TYR A 46 ? ? -178.11 -165.15 519 16 VAL A 62 ? ? 45.21 28.27 520 16 LYS A 63 ? ? -165.83 70.87 521 16 LYS A 65 ? ? 58.71 88.70 522 16 HIS A 71 ? ? 107.38 -119.67 523 16 ALA A 73 ? ? 172.97 -19.39 524 16 VAL A 77 ? ? -176.79 -28.48 525 16 LYS A 93 ? ? -156.56 -40.67 526 16 LYS A 94 ? ? 75.87 -156.45 527 16 GLU A 95 ? ? 79.40 -173.68 528 16 ASP A 96 ? ? -56.45 -169.66 529 16 GLU A 106 ? ? -65.96 84.19 530 16 PHE A 109 ? ? 40.06 28.67 531 16 SER A 115 ? ? -131.96 -32.52 532 16 LYS A 117 ? ? 98.32 -68.19 533 16 PRO A 118 ? ? -42.99 88.95 534 16 CYS A 120 ? ? 14.84 -127.56 535 16 ARG A 121 ? ? 171.08 35.14 536 16 CYS A 122 ? ? 179.57 -144.62 537 16 ALA A 123 ? ? -177.07 39.61 538 16 LYS A 128 ? ? -59.02 -164.30 539 16 CYS A 131 ? ? -179.65 39.01 540 17 SER A 6 ? ? 69.48 -66.63 541 17 SER A 12 ? ? -41.02 -77.77 542 17 PRO A 17 ? ? -92.04 -76.69 543 17 HIS A 19 ? ? 69.41 74.05 544 17 ARG A 20 ? ? -31.25 -36.98 545 17 PRO A 22 ? ? -57.47 -136.14 546 17 ARG A 30 ? ? -61.67 -113.77 547 17 ASP A 31 ? ? 161.12 -54.94 548 17 HIS A 39 ? ? -90.46 -75.18 549 17 ILE A 40 ? ? 29.70 50.76 550 17 SER A 43 ? ? -98.68 -66.50 551 17 SER A 48 ? ? -83.15 -149.50 552 17 SER A 50 ? ? -167.80 24.69 553 17 ASN A 61 ? ? -88.50 38.30 554 17 VAL A 62 ? ? -49.87 -17.03 555 17 LYS A 63 ? ? 175.57 82.10 556 17 ASP A 64 ? ? -142.35 49.66 557 17 LYS A 65 ? ? 54.16 86.55 558 17 HIS A 71 ? ? 173.14 -60.13 559 17 SER A 72 ? ? 125.07 -101.54 560 17 ALA A 73 ? ? -144.27 16.99 561 17 SER A 75 ? ? 59.13 12.12 562 17 GLN A 76 ? ? -141.12 10.47 563 17 VAL A 77 ? ? -164.69 -42.26 564 17 LYS A 94 ? ? 60.14 -178.91 565 17 THR A 97 ? ? 176.97 37.61 566 17 GLU A 106 ? ? -57.56 -82.08 567 17 PHE A 109 ? ? 53.85 18.89 568 17 SER A 115 ? ? -38.21 -29.12 569 17 CYS A 120 ? ? 36.25 -97.40 570 17 ARG A 121 ? ? 62.26 -76.42 571 17 CYS A 122 ? ? 35.81 -163.08 572 17 ALA A 123 ? ? 174.83 -29.18 573 17 GLU A 124 ? ? -158.55 -159.85 574 17 VAL A 125 ? ? 55.70 166.66 575 17 PRO A 126 ? ? -64.31 71.19 576 17 CYS A 127 ? ? -4.03 -67.87 577 17 LYS A 128 ? ? 179.65 -165.15 578 18 ALA A 2 ? ? 60.76 61.06 579 18 MET A 3 ? ? -172.27 149.74 580 18 ALA A 4 ? ? 61.71 -162.98 581 18 ARG A 5 ? ? 63.92 166.76 582 18 LEU A 18 ? ? 38.79 27.69 583 18 HIS A 19 ? ? 72.39 -17.43 584 18 ARG A 30 ? ? -132.68 -85.93 585 18 ASP A 31 ? ? 160.67 -67.24 586 18 GLU A 32 ? ? 174.61 -36.01 587 18 ILE A 40 ? ? -150.87 21.14 588 18 SER A 43 ? ? -117.31 -82.38 589 18 ALA A 47 ? ? -105.46 -164.42 590 18 SER A 50 ? ? -142.95 -36.92 591 18 ASP A 52 ? ? -148.15 -38.28 592 18 LYS A 63 ? ? 82.17 67.78 593 18 ASP A 64 ? ? 61.40 -63.61 594 18 LYS A 65 ? ? -58.57 103.44 595 18 SER A 72 ? ? 137.39 -73.50 596 18 ALA A 73 ? ? -153.52 9.48 597 18 GLN A 76 ? ? 178.44 56.10 598 18 VAL A 77 ? ? 174.78 -86.25 599 18 LYS A 94 ? ? 76.93 30.14 600 18 ASP A 96 ? ? 59.69 165.20 601 18 PHE A 109 ? ? -152.34 4.08 602 18 LYS A 117 ? ? 58.61 16.65 603 18 PRO A 118 ? ? -64.30 75.70 604 18 CYS A 120 ? ? -18.36 127.33 605 18 ARG A 121 ? ? -49.66 86.43 606 18 ALA A 123 ? ? -164.98 -31.20 607 18 GLU A 124 ? ? -167.42 -106.76 608 18 CYS A 127 ? ? -62.46 78.00 609 18 LYS A 128 ? ? 167.30 128.56 610 18 CYS A 131 ? ? -178.62 -33.14 611 19 MET A 3 ? ? 61.22 109.14 612 19 SER A 6 ? ? 62.33 -84.89 613 19 SER A 12 ? ? -40.82 -71.49 614 19 PRO A 22 ? ? -73.81 -153.08 615 19 ARG A 30 ? ? -155.47 -72.15 616 19 ASP A 31 ? ? 161.09 -75.92 617 19 HIS A 39 ? ? 170.33 59.78 618 19 SER A 43 ? ? 61.93 110.53 619 19 ASN A 61 ? ? -142.92 42.90 620 19 LYS A 63 ? ? 52.10 16.22 621 19 ASP A 64 ? ? 64.03 -67.18 622 19 HIS A 71 ? ? 143.55 -134.81 623 19 ALA A 73 ? ? -179.36 33.72 624 19 LEU A 74 ? ? -130.67 -85.92 625 19 SER A 75 ? ? 147.90 21.19 626 19 GLN A 76 ? ? 77.80 -24.15 627 19 LYS A 93 ? ? 167.09 32.64 628 19 LYS A 94 ? ? 173.38 131.62 629 19 ASP A 96 ? ? -172.04 -175.38 630 19 THR A 97 ? ? -120.16 -57.02 631 19 GLU A 106 ? ? -46.95 -119.14 632 19 PRO A 118 ? ? -59.70 177.43 633 19 CYS A 120 ? ? 55.60 -85.04 634 19 CYS A 122 ? ? -89.63 -159.74 635 19 ALA A 123 ? ? 164.65 30.91 636 19 GLU A 124 ? ? 175.28 -168.82 637 19 PRO A 126 ? ? -36.69 -27.05 638 19 CYS A 127 ? ? -61.88 80.42 639 20 ALA A 4 ? ? 64.03 128.17 640 20 ARG A 5 ? ? -119.20 70.55 641 20 SER A 6 ? ? -104.35 -79.23 642 20 SER A 12 ? ? -38.37 -77.56 643 20 ARG A 21 ? ? 61.74 -178.30 644 20 PRO A 22 ? ? -57.18 -129.23 645 20 ASN A 23 ? ? 49.14 24.93 646 20 ARG A 30 ? ? -113.20 -94.92 647 20 ASP A 31 ? ? 159.65 -71.00 648 20 ASP A 37 ? ? 97.73 -14.41 649 20 HIS A 39 ? ? -161.37 8.09 650 20 ILE A 40 ? ? -80.48 30.60 651 20 SER A 43 ? ? -41.88 166.52 652 20 ASP A 64 ? ? 70.88 -65.98 653 20 HIS A 71 ? ? 150.57 -88.66 654 20 SER A 72 ? ? 5.77 70.46 655 20 ALA A 73 ? ? -174.81 -43.53 656 20 LEU A 74 ? ? -133.46 -38.91 657 20 SER A 75 ? ? 48.81 28.99 658 20 VAL A 77 ? ? -179.21 -19.83 659 20 LYS A 93 ? ? -173.76 48.84 660 20 LYS A 94 ? ? 179.11 -164.83 661 20 ASP A 96 ? ? -51.62 108.80 662 20 ARG A 107 ? ? -87.00 45.55 663 20 LYS A 117 ? ? 52.93 -175.76 664 20 PRO A 118 ? ? -42.91 166.42 665 20 CYS A 120 ? ? 33.78 -86.34 666 20 ARG A 121 ? ? 99.93 -35.78 667 20 CYS A 122 ? ? 70.77 -173.39 668 20 ALA A 123 ? ? -177.71 -39.83 669 20 GLU A 124 ? ? 155.84 -50.50 670 20 VAL A 125 ? ? -44.83 160.07 671 20 PRO A 126 ? ? -59.06 62.60 672 20 CYS A 127 ? ? 27.90 -112.57 673 20 LYS A 128 ? ? -138.27 -56.43 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A GLY -2 ? A GLY 18 19 1 Y 1 A SER -1 ? A SER 19 20 1 Y 1 A HIS 0 ? A HIS 20 21 2 Y 1 A MET -19 ? A MET 1 22 2 Y 1 A GLY -18 ? A GLY 2 23 2 Y 1 A SER -17 ? A SER 3 24 2 Y 1 A SER -16 ? A SER 4 25 2 Y 1 A HIS -15 ? A HIS 5 26 2 Y 1 A HIS -14 ? A HIS 6 27 2 Y 1 A HIS -13 ? A HIS 7 28 2 Y 1 A HIS -12 ? A HIS 8 29 2 Y 1 A HIS -11 ? A HIS 9 30 2 Y 1 A HIS -10 ? A HIS 10 31 2 Y 1 A SER -9 ? A SER 11 32 2 Y 1 A SER -8 ? A SER 12 33 2 Y 1 A GLY -7 ? A GLY 13 34 2 Y 1 A LEU -6 ? A LEU 14 35 2 Y 1 A VAL -5 ? A VAL 15 36 2 Y 1 A PRO -4 ? A PRO 16 37 2 Y 1 A ARG -3 ? A ARG 17 38 2 Y 1 A GLY -2 ? A GLY 18 39 2 Y 1 A SER -1 ? A SER 19 40 2 Y 1 A HIS 0 ? A HIS 20 41 3 Y 1 A MET -19 ? A MET 1 42 3 Y 1 A GLY -18 ? A GLY 2 43 3 Y 1 A SER -17 ? A SER 3 44 3 Y 1 A SER -16 ? A SER 4 45 3 Y 1 A HIS -15 ? A HIS 5 46 3 Y 1 A HIS -14 ? A HIS 6 47 3 Y 1 A HIS -13 ? A HIS 7 48 3 Y 1 A HIS -12 ? A HIS 8 49 3 Y 1 A HIS -11 ? A HIS 9 50 3 Y 1 A HIS -10 ? A HIS 10 51 3 Y 1 A SER -9 ? A SER 11 52 3 Y 1 A SER -8 ? A SER 12 53 3 Y 1 A GLY -7 ? A GLY 13 54 3 Y 1 A LEU -6 ? A LEU 14 55 3 Y 1 A VAL -5 ? A VAL 15 56 3 Y 1 A PRO -4 ? A PRO 16 57 3 Y 1 A ARG -3 ? A ARG 17 58 3 Y 1 A GLY -2 ? A GLY 18 59 3 Y 1 A SER -1 ? A SER 19 60 3 Y 1 A HIS 0 ? A HIS 20 61 4 Y 1 A MET -19 ? A MET 1 62 4 Y 1 A GLY -18 ? A GLY 2 63 4 Y 1 A SER -17 ? A SER 3 64 4 Y 1 A SER -16 ? A SER 4 65 4 Y 1 A HIS -15 ? A HIS 5 66 4 Y 1 A HIS -14 ? A HIS 6 67 4 Y 1 A HIS -13 ? A HIS 7 68 4 Y 1 A HIS -12 ? A HIS 8 69 4 Y 1 A HIS -11 ? A HIS 9 70 4 Y 1 A HIS -10 ? A HIS 10 71 4 Y 1 A SER -9 ? A SER 11 72 4 Y 1 A SER -8 ? A SER 12 73 4 Y 1 A GLY -7 ? A GLY 13 74 4 Y 1 A LEU -6 ? A LEU 14 75 4 Y 1 A VAL -5 ? A VAL 15 76 4 Y 1 A PRO -4 ? A PRO 16 77 4 Y 1 A ARG -3 ? A ARG 17 78 4 Y 1 A GLY -2 ? A GLY 18 79 4 Y 1 A SER -1 ? A SER 19 80 4 Y 1 A HIS 0 ? A HIS 20 81 5 Y 1 A MET -19 ? A MET 1 82 5 Y 1 A GLY -18 ? A GLY 2 83 5 Y 1 A SER -17 ? A SER 3 84 5 Y 1 A SER -16 ? A SER 4 85 5 Y 1 A HIS -15 ? A HIS 5 86 5 Y 1 A HIS -14 ? A HIS 6 87 5 Y 1 A HIS -13 ? A HIS 7 88 5 Y 1 A HIS -12 ? A HIS 8 89 5 Y 1 A HIS -11 ? A HIS 9 90 5 Y 1 A HIS -10 ? A HIS 10 91 5 Y 1 A SER -9 ? A SER 11 92 5 Y 1 A SER -8 ? A SER 12 93 5 Y 1 A GLY -7 ? A GLY 13 94 5 Y 1 A LEU -6 ? A LEU 14 95 5 Y 1 A VAL -5 ? A VAL 15 96 5 Y 1 A PRO -4 ? A PRO 16 97 5 Y 1 A ARG -3 ? A ARG 17 98 5 Y 1 A GLY -2 ? A GLY 18 99 5 Y 1 A SER -1 ? A SER 19 100 5 Y 1 A HIS 0 ? A HIS 20 101 6 Y 1 A MET -19 ? A MET 1 102 6 Y 1 A GLY -18 ? A GLY 2 103 6 Y 1 A SER -17 ? A SER 3 104 6 Y 1 A SER -16 ? A SER 4 105 6 Y 1 A HIS -15 ? A HIS 5 106 6 Y 1 A HIS -14 ? A HIS 6 107 6 Y 1 A HIS -13 ? A HIS 7 108 6 Y 1 A HIS -12 ? A HIS 8 109 6 Y 1 A HIS -11 ? A HIS 9 110 6 Y 1 A HIS -10 ? A HIS 10 111 6 Y 1 A SER -9 ? A SER 11 112 6 Y 1 A SER -8 ? A SER 12 113 6 Y 1 A GLY -7 ? A GLY 13 114 6 Y 1 A LEU -6 ? A LEU 14 115 6 Y 1 A VAL -5 ? A VAL 15 116 6 Y 1 A PRO -4 ? A PRO 16 117 6 Y 1 A ARG -3 ? A ARG 17 118 6 Y 1 A GLY -2 ? A GLY 18 119 6 Y 1 A SER -1 ? A SER 19 120 6 Y 1 A HIS 0 ? A HIS 20 121 7 Y 1 A MET -19 ? A MET 1 122 7 Y 1 A GLY -18 ? A GLY 2 123 7 Y 1 A SER -17 ? A SER 3 124 7 Y 1 A SER -16 ? A SER 4 125 7 Y 1 A HIS -15 ? A HIS 5 126 7 Y 1 A HIS -14 ? A HIS 6 127 7 Y 1 A HIS -13 ? A HIS 7 128 7 Y 1 A HIS -12 ? A HIS 8 129 7 Y 1 A HIS -11 ? A HIS 9 130 7 Y 1 A HIS -10 ? A HIS 10 131 7 Y 1 A SER -9 ? A SER 11 132 7 Y 1 A SER -8 ? A SER 12 133 7 Y 1 A GLY -7 ? A GLY 13 134 7 Y 1 A LEU -6 ? A LEU 14 135 7 Y 1 A VAL -5 ? A VAL 15 136 7 Y 1 A PRO -4 ? A PRO 16 137 7 Y 1 A ARG -3 ? A ARG 17 138 7 Y 1 A GLY -2 ? A GLY 18 139 7 Y 1 A SER -1 ? A SER 19 140 7 Y 1 A HIS 0 ? A HIS 20 141 8 Y 1 A MET -19 ? A MET 1 142 8 Y 1 A GLY -18 ? A GLY 2 143 8 Y 1 A SER -17 ? A SER 3 144 8 Y 1 A SER -16 ? A SER 4 145 8 Y 1 A HIS -15 ? A HIS 5 146 8 Y 1 A HIS -14 ? A HIS 6 147 8 Y 1 A HIS -13 ? A HIS 7 148 8 Y 1 A HIS -12 ? A HIS 8 149 8 Y 1 A HIS -11 ? A HIS 9 150 8 Y 1 A HIS -10 ? A HIS 10 151 8 Y 1 A SER -9 ? A SER 11 152 8 Y 1 A SER -8 ? A SER 12 153 8 Y 1 A GLY -7 ? A GLY 13 154 8 Y 1 A LEU -6 ? A LEU 14 155 8 Y 1 A VAL -5 ? A VAL 15 156 8 Y 1 A PRO -4 ? A PRO 16 157 8 Y 1 A ARG -3 ? A ARG 17 158 8 Y 1 A GLY -2 ? A GLY 18 159 8 Y 1 A SER -1 ? A SER 19 160 8 Y 1 A HIS 0 ? A HIS 20 161 9 Y 1 A MET -19 ? A MET 1 162 9 Y 1 A GLY -18 ? A GLY 2 163 9 Y 1 A SER -17 ? A SER 3 164 9 Y 1 A SER -16 ? A SER 4 165 9 Y 1 A HIS -15 ? A HIS 5 166 9 Y 1 A HIS -14 ? A HIS 6 167 9 Y 1 A HIS -13 ? A HIS 7 168 9 Y 1 A HIS -12 ? A HIS 8 169 9 Y 1 A HIS -11 ? A HIS 9 170 9 Y 1 A HIS -10 ? A HIS 10 171 9 Y 1 A SER -9 ? A SER 11 172 9 Y 1 A SER -8 ? A SER 12 173 9 Y 1 A GLY -7 ? A GLY 13 174 9 Y 1 A LEU -6 ? A LEU 14 175 9 Y 1 A VAL -5 ? A VAL 15 176 9 Y 1 A PRO -4 ? A PRO 16 177 9 Y 1 A ARG -3 ? A ARG 17 178 9 Y 1 A GLY -2 ? A GLY 18 179 9 Y 1 A SER -1 ? A SER 19 180 9 Y 1 A HIS 0 ? A HIS 20 181 10 Y 1 A MET -19 ? A MET 1 182 10 Y 1 A GLY -18 ? A GLY 2 183 10 Y 1 A SER -17 ? A SER 3 184 10 Y 1 A SER -16 ? A SER 4 185 10 Y 1 A HIS -15 ? A HIS 5 186 10 Y 1 A HIS -14 ? A HIS 6 187 10 Y 1 A HIS -13 ? A HIS 7 188 10 Y 1 A HIS -12 ? A HIS 8 189 10 Y 1 A HIS -11 ? A HIS 9 190 10 Y 1 A HIS -10 ? A HIS 10 191 10 Y 1 A SER -9 ? A SER 11 192 10 Y 1 A SER -8 ? A SER 12 193 10 Y 1 A GLY -7 ? A GLY 13 194 10 Y 1 A LEU -6 ? A LEU 14 195 10 Y 1 A VAL -5 ? A VAL 15 196 10 Y 1 A PRO -4 ? A PRO 16 197 10 Y 1 A ARG -3 ? A ARG 17 198 10 Y 1 A GLY -2 ? A GLY 18 199 10 Y 1 A SER -1 ? A SER 19 200 10 Y 1 A HIS 0 ? A HIS 20 201 11 Y 1 A MET -19 ? A MET 1 202 11 Y 1 A GLY -18 ? A GLY 2 203 11 Y 1 A SER -17 ? A SER 3 204 11 Y 1 A SER -16 ? A SER 4 205 11 Y 1 A HIS -15 ? A HIS 5 206 11 Y 1 A HIS -14 ? A HIS 6 207 11 Y 1 A HIS -13 ? A HIS 7 208 11 Y 1 A HIS -12 ? A HIS 8 209 11 Y 1 A HIS -11 ? A HIS 9 210 11 Y 1 A HIS -10 ? A HIS 10 211 11 Y 1 A SER -9 ? A SER 11 212 11 Y 1 A SER -8 ? A SER 12 213 11 Y 1 A GLY -7 ? A GLY 13 214 11 Y 1 A LEU -6 ? A LEU 14 215 11 Y 1 A VAL -5 ? A VAL 15 216 11 Y 1 A PRO -4 ? A PRO 16 217 11 Y 1 A ARG -3 ? A ARG 17 218 11 Y 1 A GLY -2 ? A GLY 18 219 11 Y 1 A SER -1 ? A SER 19 220 11 Y 1 A HIS 0 ? A HIS 20 221 12 Y 1 A MET -19 ? A MET 1 222 12 Y 1 A GLY -18 ? A GLY 2 223 12 Y 1 A SER -17 ? A SER 3 224 12 Y 1 A SER -16 ? A SER 4 225 12 Y 1 A HIS -15 ? A HIS 5 226 12 Y 1 A HIS -14 ? A HIS 6 227 12 Y 1 A HIS -13 ? A HIS 7 228 12 Y 1 A HIS -12 ? A HIS 8 229 12 Y 1 A HIS -11 ? A HIS 9 230 12 Y 1 A HIS -10 ? A HIS 10 231 12 Y 1 A SER -9 ? A SER 11 232 12 Y 1 A SER -8 ? A SER 12 233 12 Y 1 A GLY -7 ? A GLY 13 234 12 Y 1 A LEU -6 ? A LEU 14 235 12 Y 1 A VAL -5 ? A VAL 15 236 12 Y 1 A PRO -4 ? A PRO 16 237 12 Y 1 A ARG -3 ? A ARG 17 238 12 Y 1 A GLY -2 ? A GLY 18 239 12 Y 1 A SER -1 ? A SER 19 240 12 Y 1 A HIS 0 ? A HIS 20 241 13 Y 1 A MET -19 ? A MET 1 242 13 Y 1 A GLY -18 ? A GLY 2 243 13 Y 1 A SER -17 ? A SER 3 244 13 Y 1 A SER -16 ? A SER 4 245 13 Y 1 A HIS -15 ? A HIS 5 246 13 Y 1 A HIS -14 ? A HIS 6 247 13 Y 1 A HIS -13 ? A HIS 7 248 13 Y 1 A HIS -12 ? A HIS 8 249 13 Y 1 A HIS -11 ? A HIS 9 250 13 Y 1 A HIS -10 ? A HIS 10 251 13 Y 1 A SER -9 ? A SER 11 252 13 Y 1 A SER -8 ? A SER 12 253 13 Y 1 A GLY -7 ? A GLY 13 254 13 Y 1 A LEU -6 ? A LEU 14 255 13 Y 1 A VAL -5 ? A VAL 15 256 13 Y 1 A PRO -4 ? A PRO 16 257 13 Y 1 A ARG -3 ? A ARG 17 258 13 Y 1 A GLY -2 ? A GLY 18 259 13 Y 1 A SER -1 ? A SER 19 260 13 Y 1 A HIS 0 ? A HIS 20 261 14 Y 1 A MET -19 ? A MET 1 262 14 Y 1 A GLY -18 ? A GLY 2 263 14 Y 1 A SER -17 ? A SER 3 264 14 Y 1 A SER -16 ? A SER 4 265 14 Y 1 A HIS -15 ? A HIS 5 266 14 Y 1 A HIS -14 ? A HIS 6 267 14 Y 1 A HIS -13 ? A HIS 7 268 14 Y 1 A HIS -12 ? A HIS 8 269 14 Y 1 A HIS -11 ? A HIS 9 270 14 Y 1 A HIS -10 ? A HIS 10 271 14 Y 1 A SER -9 ? A SER 11 272 14 Y 1 A SER -8 ? A SER 12 273 14 Y 1 A GLY -7 ? A GLY 13 274 14 Y 1 A LEU -6 ? A LEU 14 275 14 Y 1 A VAL -5 ? A VAL 15 276 14 Y 1 A PRO -4 ? A PRO 16 277 14 Y 1 A ARG -3 ? A ARG 17 278 14 Y 1 A GLY -2 ? A GLY 18 279 14 Y 1 A SER -1 ? A SER 19 280 14 Y 1 A HIS 0 ? A HIS 20 281 15 Y 1 A MET -19 ? A MET 1 282 15 Y 1 A GLY -18 ? A GLY 2 283 15 Y 1 A SER -17 ? A SER 3 284 15 Y 1 A SER -16 ? A SER 4 285 15 Y 1 A HIS -15 ? A HIS 5 286 15 Y 1 A HIS -14 ? A HIS 6 287 15 Y 1 A HIS -13 ? A HIS 7 288 15 Y 1 A HIS -12 ? A HIS 8 289 15 Y 1 A HIS -11 ? A HIS 9 290 15 Y 1 A HIS -10 ? A HIS 10 291 15 Y 1 A SER -9 ? A SER 11 292 15 Y 1 A SER -8 ? A SER 12 293 15 Y 1 A GLY -7 ? A GLY 13 294 15 Y 1 A LEU -6 ? A LEU 14 295 15 Y 1 A VAL -5 ? A VAL 15 296 15 Y 1 A PRO -4 ? A PRO 16 297 15 Y 1 A ARG -3 ? A ARG 17 298 15 Y 1 A GLY -2 ? A GLY 18 299 15 Y 1 A SER -1 ? A SER 19 300 15 Y 1 A HIS 0 ? A HIS 20 301 16 Y 1 A MET -19 ? A MET 1 302 16 Y 1 A GLY -18 ? A GLY 2 303 16 Y 1 A SER -17 ? A SER 3 304 16 Y 1 A SER -16 ? A SER 4 305 16 Y 1 A HIS -15 ? A HIS 5 306 16 Y 1 A HIS -14 ? A HIS 6 307 16 Y 1 A HIS -13 ? A HIS 7 308 16 Y 1 A HIS -12 ? A HIS 8 309 16 Y 1 A HIS -11 ? A HIS 9 310 16 Y 1 A HIS -10 ? A HIS 10 311 16 Y 1 A SER -9 ? A SER 11 312 16 Y 1 A SER -8 ? A SER 12 313 16 Y 1 A GLY -7 ? A GLY 13 314 16 Y 1 A LEU -6 ? A LEU 14 315 16 Y 1 A VAL -5 ? A VAL 15 316 16 Y 1 A PRO -4 ? A PRO 16 317 16 Y 1 A ARG -3 ? A ARG 17 318 16 Y 1 A GLY -2 ? A GLY 18 319 16 Y 1 A SER -1 ? A SER 19 320 16 Y 1 A HIS 0 ? A HIS 20 321 17 Y 1 A MET -19 ? A MET 1 322 17 Y 1 A GLY -18 ? A GLY 2 323 17 Y 1 A SER -17 ? A SER 3 324 17 Y 1 A SER -16 ? A SER 4 325 17 Y 1 A HIS -15 ? A HIS 5 326 17 Y 1 A HIS -14 ? A HIS 6 327 17 Y 1 A HIS -13 ? A HIS 7 328 17 Y 1 A HIS -12 ? A HIS 8 329 17 Y 1 A HIS -11 ? A HIS 9 330 17 Y 1 A HIS -10 ? A HIS 10 331 17 Y 1 A SER -9 ? A SER 11 332 17 Y 1 A SER -8 ? A SER 12 333 17 Y 1 A GLY -7 ? A GLY 13 334 17 Y 1 A LEU -6 ? A LEU 14 335 17 Y 1 A VAL -5 ? A VAL 15 336 17 Y 1 A PRO -4 ? A PRO 16 337 17 Y 1 A ARG -3 ? A ARG 17 338 17 Y 1 A GLY -2 ? A GLY 18 339 17 Y 1 A SER -1 ? A SER 19 340 17 Y 1 A HIS 0 ? A HIS 20 341 18 Y 1 A MET -19 ? A MET 1 342 18 Y 1 A GLY -18 ? A GLY 2 343 18 Y 1 A SER -17 ? A SER 3 344 18 Y 1 A SER -16 ? A SER 4 345 18 Y 1 A HIS -15 ? A HIS 5 346 18 Y 1 A HIS -14 ? A HIS 6 347 18 Y 1 A HIS -13 ? A HIS 7 348 18 Y 1 A HIS -12 ? A HIS 8 349 18 Y 1 A HIS -11 ? A HIS 9 350 18 Y 1 A HIS -10 ? A HIS 10 351 18 Y 1 A SER -9 ? A SER 11 352 18 Y 1 A SER -8 ? A SER 12 353 18 Y 1 A GLY -7 ? A GLY 13 354 18 Y 1 A LEU -6 ? A LEU 14 355 18 Y 1 A VAL -5 ? A VAL 15 356 18 Y 1 A PRO -4 ? A PRO 16 357 18 Y 1 A ARG -3 ? A ARG 17 358 18 Y 1 A GLY -2 ? A GLY 18 359 18 Y 1 A SER -1 ? A SER 19 360 18 Y 1 A HIS 0 ? A HIS 20 361 19 Y 1 A MET -19 ? A MET 1 362 19 Y 1 A GLY -18 ? A GLY 2 363 19 Y 1 A SER -17 ? A SER 3 364 19 Y 1 A SER -16 ? A SER 4 365 19 Y 1 A HIS -15 ? A HIS 5 366 19 Y 1 A HIS -14 ? A HIS 6 367 19 Y 1 A HIS -13 ? A HIS 7 368 19 Y 1 A HIS -12 ? A HIS 8 369 19 Y 1 A HIS -11 ? A HIS 9 370 19 Y 1 A HIS -10 ? A HIS 10 371 19 Y 1 A SER -9 ? A SER 11 372 19 Y 1 A SER -8 ? A SER 12 373 19 Y 1 A GLY -7 ? A GLY 13 374 19 Y 1 A LEU -6 ? A LEU 14 375 19 Y 1 A VAL -5 ? A VAL 15 376 19 Y 1 A PRO -4 ? A PRO 16 377 19 Y 1 A ARG -3 ? A ARG 17 378 19 Y 1 A GLY -2 ? A GLY 18 379 19 Y 1 A SER -1 ? A SER 19 380 19 Y 1 A HIS 0 ? A HIS 20 381 20 Y 1 A MET -19 ? A MET 1 382 20 Y 1 A GLY -18 ? A GLY 2 383 20 Y 1 A SER -17 ? A SER 3 384 20 Y 1 A SER -16 ? A SER 4 385 20 Y 1 A HIS -15 ? A HIS 5 386 20 Y 1 A HIS -14 ? A HIS 6 387 20 Y 1 A HIS -13 ? A HIS 7 388 20 Y 1 A HIS -12 ? A HIS 8 389 20 Y 1 A HIS -11 ? A HIS 9 390 20 Y 1 A HIS -10 ? A HIS 10 391 20 Y 1 A SER -9 ? A SER 11 392 20 Y 1 A SER -8 ? A SER 12 393 20 Y 1 A GLY -7 ? A GLY 13 394 20 Y 1 A LEU -6 ? A LEU 14 395 20 Y 1 A VAL -5 ? A VAL 15 396 20 Y 1 A PRO -4 ? A PRO 16 397 20 Y 1 A ARG -3 ? A ARG 17 398 20 Y 1 A GLY -2 ? A GLY 18 399 20 Y 1 A SER -1 ? A SER 19 400 20 Y 1 A HIS 0 ? A HIS 20 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #