data_1T6R # _entry.id 1T6R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1T6R pdb_00001t6r 10.2210/pdb1t6r/pdb RCSB RCSB022382 ? ? WWPDB D_1000022382 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-05-24 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' pdbx_entry_details 11 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1T6R _pdbx_database_status.recvd_initial_deposition_date 2004-05-07 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1SBO 'Solution strucutre of TM1442, aputative anti sigma factor antagonist' unspecified TargetDB 283301 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Etezady-Esfarjani, T.' 1 'Placzek, W.' 2 'Herrmann, T.' 3 'Lesley, S.A.' 4 'Wuthrich, K.' 5 'Joint Center for Structural Genomics (JCSG)' 6 # _citation.id primary _citation.title ;Solution structures of the putative anti-sigma-factor antagonist TM1442 from Thermotoga maritima in the free and phosphorylated states. ; _citation.journal_abbrev Magn.Reson.Chem. _citation.journal_volume '44 Spec No' _citation.page_first S61 _citation.page_last S70 _citation.year 2006 _citation.journal_id_ASTM MRCHEG _citation.country UK _citation.journal_id_ISSN 0749-1581 _citation.journal_id_CSD 0731 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16826544 _citation.pdbx_database_id_DOI 10.1002/mrc.1831 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Etezady-Esfarjani, T.' 1 ? primary 'Placzek, W.J.' 2 ? primary 'Herrmann, T.' 3 ? primary 'Wuthrich, K.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Putative anti-sigma factor antagonist TM1442' _entity.formula_weight 12397.194 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MNNLKLDIVEQDDKAIVRVQGDIDAYNSSELKEQLRNFISTTSKKKIVLDLSSVSYMD(SEP)AGLGTLVVILKDAKING KEFILSSLKESISRILKLTHLDKIFKITDTVEEA ; _entity_poly.pdbx_seq_one_letter_code_can ;MNNLKLDIVEQDDKAIVRVQGDIDAYNSSELKEQLRNFISTTSKKKIVLDLSSVSYMDSAGLGTLVVILKDAKINGKEFI LSSLKESISRILKLTHLDKIFKITDTVEEA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier 283301 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 ASN n 1 4 LEU n 1 5 LYS n 1 6 LEU n 1 7 ASP n 1 8 ILE n 1 9 VAL n 1 10 GLU n 1 11 GLN n 1 12 ASP n 1 13 ASP n 1 14 LYS n 1 15 ALA n 1 16 ILE n 1 17 VAL n 1 18 ARG n 1 19 VAL n 1 20 GLN n 1 21 GLY n 1 22 ASP n 1 23 ILE n 1 24 ASP n 1 25 ALA n 1 26 TYR n 1 27 ASN n 1 28 SER n 1 29 SER n 1 30 GLU n 1 31 LEU n 1 32 LYS n 1 33 GLU n 1 34 GLN n 1 35 LEU n 1 36 ARG n 1 37 ASN n 1 38 PHE n 1 39 ILE n 1 40 SER n 1 41 THR n 1 42 THR n 1 43 SER n 1 44 LYS n 1 45 LYS n 1 46 LYS n 1 47 ILE n 1 48 VAL n 1 49 LEU n 1 50 ASP n 1 51 LEU n 1 52 SER n 1 53 SER n 1 54 VAL n 1 55 SER n 1 56 TYR n 1 57 MET n 1 58 ASP n 1 59 SEP n 1 60 ALA n 1 61 GLY n 1 62 LEU n 1 63 GLY n 1 64 THR n 1 65 LEU n 1 66 VAL n 1 67 VAL n 1 68 ILE n 1 69 LEU n 1 70 LYS n 1 71 ASP n 1 72 ALA n 1 73 LYS n 1 74 ILE n 1 75 ASN n 1 76 GLY n 1 77 LYS n 1 78 GLU n 1 79 PHE n 1 80 ILE n 1 81 LEU n 1 82 SER n 1 83 SER n 1 84 LEU n 1 85 LYS n 1 86 GLU n 1 87 SER n 1 88 ILE n 1 89 SER n 1 90 ARG n 1 91 ILE n 1 92 LEU n 1 93 LYS n 1 94 LEU n 1 95 THR n 1 96 HIS n 1 97 LEU n 1 98 ASP n 1 99 LYS n 1 100 ILE n 1 101 PHE n 1 102 LYS n 1 103 ILE n 1 104 THR n 1 105 ASP n 1 106 THR n 1 107 VAL n 1 108 GLU n 1 109 GLU n 1 110 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermotoga _entity_src_gen.pdbx_gene_src_gene TM1442 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermotoga maritima' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2336 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type 'pET 25b(+), T7 RNA polymerase' _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET25b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 SEP 59 59 59 SEP SEP A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ALA 110 110 110 ALA ALA A . n # _cell.entry_id 1T6R _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1T6R _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1T6R _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1T6R _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1T6R _struct.title 'Solution structure of TM1442, a putative anti sigma factor antagonist in phosphorylated state' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1T6R _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;Phosphorylation, solution structure, Structural Genomics, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y1442_THEMA _struct_ref.pdbx_db_accession Q9X1F5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNNLKLDIVEQDDKAIVRVQGDIDAYNSSELKEQLRNFISTTSKKKIVLDLSSVSYMDSAGLGTLVVILKDAKINGKEFI LSSLKESISRILKLTHLDKIFKITDTVEEA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1T6R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 110 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9X1F5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 110 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 110 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1T6R _struct_ref_seq_dif.mon_id SEP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 59 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9X1F5 _struct_ref_seq_dif.db_mon_id SER _struct_ref_seq_dif.pdbx_seq_db_seq_num 59 _struct_ref_seq_dif.details 'modified residue' _struct_ref_seq_dif.pdbx_auth_seq_num 59 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 27 ? THR A 42 ? ASN A 27 THR A 42 1 ? 16 HELX_P HELX_P2 2 ASP A 58 ? ASN A 75 ? ASP A 58 ASN A 75 1 ? 18 HELX_P HELX_P3 3 LYS A 85 ? LEU A 94 ? LYS A 85 LEU A 94 1 ? 10 HELX_P HELX_P4 4 HIS A 96 ? PHE A 101 ? HIS A 96 PHE A 101 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASP 58 C ? ? ? 1_555 A SEP 59 N ? ? A ASP 58 A SEP 59 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale2 covale both ? A SEP 59 C ? ? ? 1_555 A ALA 60 N ? ? A SEP 59 A ALA 60 1_555 ? ? ? ? ? ? ? 1.340 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id SEP _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 59 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id SEP _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 59 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id SER _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id SEP _pdbx_modification_feature.type Phosphorylation _pdbx_modification_feature.category 'Named protein modification' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 5 ? VAL A 9 ? LYS A 5 VAL A 9 A 2 ALA A 15 ? GLN A 20 ? ALA A 15 GLN A 20 A 3 ILE A 47 ? ASP A 50 ? ILE A 47 ASP A 50 A 4 ILE A 80 ? SER A 82 ? ILE A 80 SER A 82 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 5 ? N LYS A 5 O GLN A 20 ? O GLN A 20 A 2 3 N ALA A 15 ? N ALA A 15 O VAL A 48 ? O VAL A 48 A 3 4 N LEU A 49 ? N LEU A 49 O SER A 82 ? O SER A 82 # _pdbx_entry_details.entry_id 1T6R _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 OE2 A GLU 10 ? ? HG1 A THR 42 ? ? 1.54 2 6 OE2 A GLU 10 ? ? HG1 A THR 42 ? ? 1.54 3 8 OE2 A GLU 10 ? ? HG1 A THR 42 ? ? 1.58 4 9 OE2 A GLU 10 ? ? HG1 A THR 42 ? ? 1.53 5 9 OD1 A ASP 50 ? ? HG A SER 83 ? ? 1.60 6 10 OE2 A GLU 10 ? ? HG1 A THR 42 ? ? 1.57 7 11 OD1 A ASP 50 ? ? HG A SER 52 ? ? 1.50 8 12 OD1 A ASP 50 ? ? HG A SER 83 ? ? 1.54 9 12 OE2 A GLU 10 ? ? HG1 A THR 42 ? ? 1.58 10 14 OD1 A ASP 50 ? ? HG A SER 52 ? ? 1.54 11 16 OE2 A GLU 10 ? ? HG1 A THR 42 ? ? 1.52 12 18 OE2 A GLU 10 ? ? HG1 A THR 42 ? ? 1.51 13 19 OE2 A GLU 10 ? ? HG1 A THR 42 ? ? 1.59 14 19 OD2 A ASP 50 ? ? HG A SER 82 ? ? 1.60 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 4 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH2 A ARG 36 ? ? 117.09 120.30 -3.21 0.50 N 2 5 NE A ARG 90 ? ? CZ A ARG 90 ? ? NH2 A ARG 90 ? ? 116.74 120.30 -3.56 0.50 N 3 7 CB A LEU 94 ? ? CA A LEU 94 ? ? C A LEU 94 ? ? 121.73 110.20 11.53 1.90 N 4 8 NE A ARG 18 ? ? CZ A ARG 18 ? ? NH2 A ARG 18 ? ? 116.28 120.30 -4.02 0.50 N 5 9 CB A LEU 81 ? ? CG A LEU 81 ? ? CD1 A LEU 81 ? ? 122.05 111.00 11.05 1.70 N 6 15 CB A TYR 56 ? ? CG A TYR 56 ? ? CD2 A TYR 56 ? ? 117.21 121.00 -3.79 0.60 N 7 18 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH2 A ARG 36 ? ? 117.25 120.30 -3.05 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 7 ? ? -113.41 66.43 2 1 ASP A 24 ? ? -119.19 -166.83 3 1 ASN A 27 ? ? -133.07 -40.26 4 1 SER A 52 ? ? -59.44 -5.87 5 1 SER A 55 ? ? -142.61 -46.56 6 1 SER A 87 ? ? -56.67 -77.05 7 1 LYS A 102 ? ? 47.16 -161.86 8 2 ASN A 3 ? ? -147.74 -67.50 9 2 GLU A 10 ? ? -127.72 -118.27 10 2 GLN A 11 ? ? 54.39 -176.48 11 2 ASP A 12 ? ? 33.95 -99.24 12 2 ASP A 13 ? ? -146.16 -1.89 13 2 LYS A 102 ? ? 47.81 -155.98 14 3 GLU A 10 ? ? -141.98 31.04 15 3 ASP A 12 ? ? -113.84 -83.12 16 3 ASP A 13 ? ? -161.28 -2.42 17 3 THR A 41 ? ? -144.94 43.12 18 3 SER A 43 ? ? 60.35 -22.61 19 3 SER A 55 ? ? -121.59 -51.02 20 3 HIS A 96 ? ? 38.78 42.27 21 3 ILE A 100 ? ? -105.72 -67.73 22 3 LYS A 102 ? ? 51.76 -167.53 23 4 ASN A 3 ? ? 52.90 -175.01 24 4 GLN A 11 ? ? -131.51 -87.21 25 4 ASP A 12 ? ? -69.28 83.48 26 4 ASP A 13 ? ? 40.87 -5.57 27 4 ASP A 24 ? ? 168.44 179.95 28 4 ASN A 27 ? ? -137.17 -32.57 29 4 LEU A 84 ? ? -53.58 109.36 30 4 LYS A 85 ? ? -69.33 96.93 31 4 GLU A 86 ? ? 23.97 -79.44 32 4 LYS A 102 ? ? 49.35 -166.05 33 5 ASN A 3 ? ? 62.82 -82.15 34 5 ASN A 27 ? ? -138.24 -44.94 35 5 THR A 41 ? ? -92.39 -60.51 36 5 SER A 55 ? ? -141.92 -39.87 37 5 LEU A 81 ? ? -89.40 -139.43 38 5 SER A 82 ? ? 164.84 167.44 39 5 SER A 83 ? ? 61.34 61.37 40 5 LYS A 102 ? ? 47.23 -168.51 41 5 VAL A 107 ? ? -37.51 -39.08 42 6 ASP A 13 ? ? -68.87 4.81 43 6 ARG A 18 ? ? -69.18 95.05 44 6 ASP A 22 ? ? -144.14 15.22 45 6 ILE A 23 ? ? 40.74 70.99 46 6 ASN A 27 ? ? -143.67 -41.61 47 6 SER A 55 ? ? -130.31 -40.19 48 6 TYR A 56 ? ? -75.48 -78.86 49 6 MET A 57 ? ? 52.91 125.32 50 6 ILE A 100 ? ? -111.13 -70.97 51 6 LYS A 102 ? ? 45.20 -153.40 52 7 GLN A 11 ? ? 38.25 -81.54 53 7 ALA A 25 ? ? -59.66 -7.48 54 7 ASN A 27 ? ? -148.52 -28.81 55 7 LEU A 84 ? ? -58.25 97.78 56 7 GLU A 86 ? ? 24.42 -76.91 57 7 LYS A 102 ? ? 47.02 -159.56 58 8 GLU A 10 ? ? -129.65 -136.02 59 8 GLN A 11 ? ? 50.57 -2.99 60 8 ASP A 13 ? ? 59.73 -16.71 61 8 ASN A 27 ? ? -133.71 -48.30 62 8 SER A 55 ? ? -121.42 -50.29 63 8 LYS A 102 ? ? 48.75 -160.99 64 9 GLN A 11 ? ? -135.25 -48.84 65 9 ASP A 13 ? ? 54.57 10.01 66 9 ILE A 23 ? ? -140.56 40.91 67 9 ASN A 27 ? ? -148.84 -41.23 68 9 THR A 42 ? ? -133.50 -39.65 69 9 SER A 43 ? ? 51.63 -1.76 70 9 SER A 55 ? ? -150.13 -41.00 71 9 SER A 87 ? ? -73.28 -79.71 72 9 LYS A 102 ? ? 46.47 -159.60 73 10 ASN A 3 ? ? 54.69 -72.10 74 10 GLN A 11 ? ? -141.26 -37.10 75 10 ALA A 25 ? ? -61.58 0.11 76 10 ASN A 27 ? ? -138.20 -36.84 77 10 SER A 83 ? ? 74.28 30.40 78 10 LEU A 84 ? ? -53.53 105.60 79 10 SER A 87 ? ? -68.24 -71.15 80 10 LYS A 102 ? ? 51.42 -168.73 81 11 ASN A 2 ? ? 45.37 75.18 82 11 ASN A 3 ? ? -145.70 -65.70 83 11 ASP A 12 ? ? 40.22 -94.00 84 11 ASP A 13 ? ? -155.38 41.94 85 11 ASP A 24 ? ? -173.02 -175.61 86 11 ASN A 27 ? ? -134.61 -49.67 87 11 GLU A 30 ? ? -100.56 -60.49 88 11 LEU A 31 ? ? -29.31 -42.70 89 11 SER A 52 ? ? -58.73 -3.66 90 11 TYR A 56 ? ? -77.10 -95.80 91 11 MET A 57 ? ? 78.56 102.07 92 11 SER A 87 ? ? -57.53 -77.25 93 11 LYS A 102 ? ? 46.64 -157.69 94 12 ASP A 12 ? ? 144.38 -106.49 95 12 ASP A 13 ? ? -155.48 25.45 96 12 ASN A 27 ? ? -139.70 -37.46 97 12 SER A 55 ? ? -141.32 -41.09 98 12 SER A 87 ? ? -57.39 -80.56 99 12 HIS A 96 ? ? 45.90 29.92 100 12 ILE A 100 ? ? -92.66 -67.57 101 12 LYS A 102 ? ? 52.16 -169.50 102 13 ALA A 25 ? ? -43.14 -16.63 103 13 ASN A 27 ? ? -137.96 -34.22 104 13 SER A 29 ? ? -54.18 -76.00 105 13 SER A 43 ? ? 66.12 -54.70 106 13 LEU A 81 ? ? -84.35 -144.31 107 13 SER A 82 ? ? 166.72 160.56 108 13 SER A 83 ? ? 65.17 64.41 109 13 SER A 87 ? ? -77.73 -71.25 110 13 LYS A 102 ? ? 50.70 -166.64 111 14 GLN A 11 ? ? 25.29 -66.88 112 14 ASP A 12 ? ? -153.02 -62.66 113 14 ASN A 27 ? ? -150.19 -52.84 114 14 GLU A 86 ? ? 27.02 -77.06 115 14 LEU A 94 ? ? -61.93 -71.20 116 14 LYS A 102 ? ? 48.33 -159.44 117 15 GLU A 10 ? ? -129.36 -91.61 118 15 GLN A 11 ? ? 25.79 66.14 119 15 ASP A 12 ? ? 179.21 -106.75 120 15 ASP A 13 ? ? -150.42 48.13 121 15 ASP A 24 ? ? -78.25 -167.70 122 15 ALA A 25 ? ? -58.83 -6.40 123 15 ASN A 27 ? ? -142.26 -36.38 124 15 SER A 55 ? ? -155.58 -34.59 125 15 PHE A 79 ? ? -161.87 106.08 126 15 SER A 87 ? ? -51.33 -71.61 127 15 LYS A 102 ? ? 49.99 -171.46 128 16 ASN A 2 ? ? 58.59 -62.05 129 16 ASN A 3 ? ? 76.11 -64.12 130 16 GLU A 10 ? ? -142.51 57.85 131 16 GLN A 11 ? ? -86.56 -75.88 132 16 ASP A 12 ? ? -74.20 46.83 133 16 ASP A 13 ? ? 59.11 -12.88 134 16 ASP A 22 ? ? -146.24 16.34 135 16 ILE A 23 ? ? 25.75 61.71 136 16 ASN A 27 ? ? -153.16 -40.36 137 16 SER A 43 ? ? 50.90 -12.42 138 16 VAL A 54 ? ? -66.38 -177.54 139 16 SER A 55 ? ? -147.42 -30.97 140 16 SER A 87 ? ? -70.75 -71.00 141 16 HIS A 96 ? ? 46.71 27.53 142 16 LYS A 102 ? ? 49.60 -167.19 143 17 ASN A 2 ? ? 26.64 63.50 144 17 GLN A 11 ? ? -58.92 -175.39 145 17 SER A 87 ? ? -69.29 -74.37 146 17 ILE A 100 ? ? -106.75 -61.18 147 17 LYS A 102 ? ? 46.93 -153.70 148 18 GLN A 11 ? ? -131.55 -96.44 149 18 ASP A 12 ? ? -49.03 78.07 150 18 ASP A 13 ? ? 24.68 44.13 151 18 ALA A 25 ? ? -55.89 -7.26 152 18 ASN A 27 ? ? -152.89 -38.26 153 18 THR A 41 ? ? -91.40 -95.60 154 18 THR A 42 ? ? 40.16 -164.61 155 18 SER A 43 ? ? -153.46 11.35 156 18 SER A 55 ? ? -147.63 -34.78 157 18 PHE A 79 ? ? -172.98 124.12 158 18 GLU A 86 ? ? 36.73 -77.85 159 18 LYS A 93 ? ? -59.67 -6.80 160 18 ILE A 100 ? ? -106.46 -70.07 161 18 LYS A 102 ? ? 44.20 -157.46 162 19 GLN A 11 ? ? -133.74 -43.51 163 19 ASP A 13 ? ? 50.22 -16.63 164 19 ALA A 25 ? ? -58.09 -7.90 165 19 ASN A 27 ? ? -146.53 -48.22 166 19 SER A 28 ? ? -58.42 -7.32 167 19 SER A 43 ? ? 65.19 -28.92 168 19 MET A 57 ? ? -162.04 102.44 169 19 LEU A 84 ? ? -59.17 108.53 170 19 LYS A 102 ? ? 49.16 -161.14 171 20 ASN A 3 ? ? -146.17 21.99 172 20 ASP A 13 ? ? 54.05 8.03 173 20 ASP A 22 ? ? -55.25 105.57 174 20 ASN A 27 ? ? -154.59 -33.11 175 20 SER A 55 ? ? -159.28 -41.81 176 20 LYS A 102 ? ? 50.97 -162.03 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 7 GLN A 11 ? ? ASP A 12 ? ? 147.10 2 12 SER A 53 ? ? VAL A 54 ? ? 149.65 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 36 ? ? 0.098 'SIDE CHAIN' 2 2 ARG A 36 ? ? 0.137 'SIDE CHAIN' 3 5 ARG A 36 ? ? 0.080 'SIDE CHAIN' 4 5 TYR A 56 ? ? 0.076 'SIDE CHAIN' 5 7 TYR A 26 ? ? 0.077 'SIDE CHAIN' 6 8 ARG A 18 ? ? 0.093 'SIDE CHAIN' 7 8 ARG A 36 ? ? 0.113 'SIDE CHAIN' 8 9 TYR A 56 ? ? 0.089 'SIDE CHAIN' 9 9 PHE A 79 ? ? 0.089 'SIDE CHAIN' 10 11 ARG A 36 ? ? 0.147 'SIDE CHAIN' 11 12 ARG A 18 ? ? 0.127 'SIDE CHAIN' 12 12 ARG A 36 ? ? 0.113 'SIDE CHAIN' 13 15 ARG A 36 ? ? 0.140 'SIDE CHAIN' 14 15 ARG A 90 ? ? 0.085 'SIDE CHAIN' 15 16 ARG A 18 ? ? 0.111 'SIDE CHAIN' 16 16 PHE A 79 ? ? 0.088 'SIDE CHAIN' 17 17 TYR A 26 ? ? 0.073 'SIDE CHAIN' 18 18 ARG A 18 ? ? 0.083 'SIDE CHAIN' 19 20 ARG A 18 ? ? 0.108 'SIDE CHAIN' 20 20 TYR A 26 ? ? 0.075 'SIDE CHAIN' # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 17 _pdbx_validate_main_chain_plane.auth_comp_id SEP _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 59 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -10.11 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Joint Center for Structural Genomics' _pdbx_SG_project.initial_of_center JCSG # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id SEP _pdbx_struct_mod_residue.label_seq_id 59 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id SEP _pdbx_struct_mod_residue.auth_seq_id 59 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details PHOSPHOSERINE # _pdbx_nmr_ensemble.entry_id 1T6R _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1T6R _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '2mM TM1442, 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '1.5mM 15N-TM1442, 90% H2O, 10% D2O' '90% H2O/10% D2O' 3 '1.5mM 15N,13C-TM1442, 90% H2O, 10% D2O' '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 313 ambient 7.0 '20 mM sodiumphosphate' ? K 2 313 ambient 7.0 '20 mM sodiumphosphate' ? K 3 313 ambient 7.0 '20 mM sodiumphosphate' ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 2 2 3D_15N-separated_NOESY 3 3 3 3D_13C-separated_NOESY # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 3.5 collection ? 1 DYANA 6.0 'data analysis' ? 2 XEASY 1.0 'data analysis' ? 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 SEP N N N N 256 SEP CA C N S 257 SEP CB C N N 258 SEP OG O N N 259 SEP C C N N 260 SEP O O N N 261 SEP OXT O N N 262 SEP P P N N 263 SEP O1P O N N 264 SEP O2P O N N 265 SEP O3P O N N 266 SEP H H N N 267 SEP H2 H N N 268 SEP HA H N N 269 SEP HB2 H N N 270 SEP HB3 H N N 271 SEP HXT H N N 272 SEP HOP2 H N N 273 SEP HOP3 H N N 274 SER N N N N 275 SER CA C N S 276 SER C C N N 277 SER O O N N 278 SER CB C N N 279 SER OG O N N 280 SER OXT O N N 281 SER H H N N 282 SER H2 H N N 283 SER HA H N N 284 SER HB2 H N N 285 SER HB3 H N N 286 SER HG H N N 287 SER HXT H N N 288 THR N N N N 289 THR CA C N S 290 THR C C N N 291 THR O O N N 292 THR CB C N R 293 THR OG1 O N N 294 THR CG2 C N N 295 THR OXT O N N 296 THR H H N N 297 THR H2 H N N 298 THR HA H N N 299 THR HB H N N 300 THR HG1 H N N 301 THR HG21 H N N 302 THR HG22 H N N 303 THR HG23 H N N 304 THR HXT H N N 305 TYR N N N N 306 TYR CA C N S 307 TYR C C N N 308 TYR O O N N 309 TYR CB C N N 310 TYR CG C Y N 311 TYR CD1 C Y N 312 TYR CD2 C Y N 313 TYR CE1 C Y N 314 TYR CE2 C Y N 315 TYR CZ C Y N 316 TYR OH O N N 317 TYR OXT O N N 318 TYR H H N N 319 TYR H2 H N N 320 TYR HA H N N 321 TYR HB2 H N N 322 TYR HB3 H N N 323 TYR HD1 H N N 324 TYR HD2 H N N 325 TYR HE1 H N N 326 TYR HE2 H N N 327 TYR HH H N N 328 TYR HXT H N N 329 VAL N N N N 330 VAL CA C N S 331 VAL C C N N 332 VAL O O N N 333 VAL CB C N N 334 VAL CG1 C N N 335 VAL CG2 C N N 336 VAL OXT O N N 337 VAL H H N N 338 VAL H2 H N N 339 VAL HA H N N 340 VAL HB H N N 341 VAL HG11 H N N 342 VAL HG12 H N N 343 VAL HG13 H N N 344 VAL HG21 H N N 345 VAL HG22 H N N 346 VAL HG23 H N N 347 VAL HXT H N N 348 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 SEP N CA sing N N 245 SEP N H sing N N 246 SEP N H2 sing N N 247 SEP CA CB sing N N 248 SEP CA C sing N N 249 SEP CA HA sing N N 250 SEP CB OG sing N N 251 SEP CB HB2 sing N N 252 SEP CB HB3 sing N N 253 SEP OG P sing N N 254 SEP C O doub N N 255 SEP C OXT sing N N 256 SEP OXT HXT sing N N 257 SEP P O1P doub N N 258 SEP P O2P sing N N 259 SEP P O3P sing N N 260 SEP O2P HOP2 sing N N 261 SEP O3P HOP3 sing N N 262 SER N CA sing N N 263 SER N H sing N N 264 SER N H2 sing N N 265 SER CA C sing N N 266 SER CA CB sing N N 267 SER CA HA sing N N 268 SER C O doub N N 269 SER C OXT sing N N 270 SER CB OG sing N N 271 SER CB HB2 sing N N 272 SER CB HB3 sing N N 273 SER OG HG sing N N 274 SER OXT HXT sing N N 275 THR N CA sing N N 276 THR N H sing N N 277 THR N H2 sing N N 278 THR CA C sing N N 279 THR CA CB sing N N 280 THR CA HA sing N N 281 THR C O doub N N 282 THR C OXT sing N N 283 THR CB OG1 sing N N 284 THR CB CG2 sing N N 285 THR CB HB sing N N 286 THR OG1 HG1 sing N N 287 THR CG2 HG21 sing N N 288 THR CG2 HG22 sing N N 289 THR CG2 HG23 sing N N 290 THR OXT HXT sing N N 291 TYR N CA sing N N 292 TYR N H sing N N 293 TYR N H2 sing N N 294 TYR CA C sing N N 295 TYR CA CB sing N N 296 TYR CA HA sing N N 297 TYR C O doub N N 298 TYR C OXT sing N N 299 TYR CB CG sing N N 300 TYR CB HB2 sing N N 301 TYR CB HB3 sing N N 302 TYR CG CD1 doub Y N 303 TYR CG CD2 sing Y N 304 TYR CD1 CE1 sing Y N 305 TYR CD1 HD1 sing N N 306 TYR CD2 CE2 doub Y N 307 TYR CD2 HD2 sing N N 308 TYR CE1 CZ doub Y N 309 TYR CE1 HE1 sing N N 310 TYR CE2 CZ sing Y N 311 TYR CE2 HE2 sing N N 312 TYR CZ OH sing N N 313 TYR OH HH sing N N 314 TYR OXT HXT sing N N 315 VAL N CA sing N N 316 VAL N H sing N N 317 VAL N H2 sing N N 318 VAL CA C sing N N 319 VAL CA CB sing N N 320 VAL CA HA sing N N 321 VAL C O doub N N 322 VAL C OXT sing N N 323 VAL CB CG1 sing N N 324 VAL CB CG2 sing N N 325 VAL CB HB sing N N 326 VAL CG1 HG11 sing N N 327 VAL CG1 HG12 sing N N 328 VAL CG1 HG13 sing N N 329 VAL CG2 HG21 sing N N 330 VAL CG2 HG22 sing N N 331 VAL CG2 HG23 sing N N 332 VAL OXT HXT sing N N 333 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 600 2 ? Bruker AVANCE 900 # _atom_sites.entry_id 1T6R _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_