data_1TL4 # _entry.id 1TL4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1TL4 pdb_00001tl4 10.2210/pdb1tl4/pdb RCSB RCSB022740 ? ? WWPDB D_1000022740 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-10-26 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_site 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.value' 10 4 'Structure model' '_struct_conn.pdbx_dist_value' 11 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 17 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 23 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 24 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 25 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1TL4 _pdbx_database_status.recvd_initial_deposition_date 2004-06-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1TL5 'Solution structure of apoHAH1' unspecified TargetDB CIRMMP27 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Anastassopoulou, I.' 1 'Banci, L.' 2 'Bertini, I.' 3 'Cantini, F.' 4 'Katsari, E.' 5 'Rosato, A.' 6 'Structural Proteomics in Europe (SPINE)' 7 # _citation.id primary _citation.title 'Solution Structure of the Apo and Copper(I)-Loaded Human Metallochaperone HAH1.' _citation.journal_abbrev Biochemistry _citation.journal_volume 43 _citation.page_first 13046 _citation.page_last 13053 _citation.year 2004 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15476398 _citation.pdbx_database_id_DOI 10.1021/bi0487591 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Anastassopoulou, I.' 1 ? primary 'Banci, L.' 2 ? primary 'Bertini, I.' 3 ? primary 'Cantini, F.' 4 ? primary 'Katsari, E.' 5 ? primary 'Rosato, A.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Copper transport protein ATOX1' 7412.646 1 ? ? ? ? 2 non-polymer syn 'COPPER (I) ION' 63.546 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Metal transport protein ATX1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE _entity_poly.pdbx_seq_one_letter_code_can MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier CIRMMP27 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'COPPER (I) ION' _pdbx_entity_nonpoly.comp_id CU1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 LYS n 1 4 HIS n 1 5 GLU n 1 6 PHE n 1 7 SER n 1 8 VAL n 1 9 ASP n 1 10 MET n 1 11 THR n 1 12 CYS n 1 13 GLY n 1 14 GLY n 1 15 CYS n 1 16 ALA n 1 17 GLU n 1 18 ALA n 1 19 VAL n 1 20 SER n 1 21 ARG n 1 22 VAL n 1 23 LEU n 1 24 ASN n 1 25 LYS n 1 26 LEU n 1 27 GLY n 1 28 GLY n 1 29 VAL n 1 30 LYS n 1 31 TYR n 1 32 ASP n 1 33 ILE n 1 34 ASP n 1 35 LEU n 1 36 PRO n 1 37 ASN n 1 38 LYS n 1 39 LYS n 1 40 VAL n 1 41 CYS n 1 42 ILE n 1 43 GLU n 1 44 SER n 1 45 GLU n 1 46 HIS n 1 47 SER n 1 48 MET n 1 49 ASP n 1 50 THR n 1 51 LEU n 1 52 LEU n 1 53 ALA n 1 54 THR n 1 55 LEU n 1 56 LYS n 1 57 LYS n 1 58 THR n 1 59 GLY n 1 60 LYS n 1 61 THR n 1 62 VAL n 1 63 SER n 1 64 TYR n 1 65 LEU n 1 66 GLY n 1 67 LEU n 1 68 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'ATOX1, HAH1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET20b+ _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU1 non-polymer . 'COPPER (I) ION' ? 'Cu 1' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLU 68 68 68 GLU GLU A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CU1 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 69 _pdbx_nonpoly_scheme.auth_seq_num 69 _pdbx_nonpoly_scheme.pdb_mon_id CU1 _pdbx_nonpoly_scheme.auth_mon_id CU _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.entry_id 1TL4 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1TL4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1TL4 _struct.title 'Solution structure of Cu(I) HAH1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1TL4 _struct_keywords.pdbx_keywords 'METAL TRANSPORT' _struct_keywords.text 'copper protein, copper chaperone, Menkes, Wilson, Structural Proteomics in Europe, SPINE, Structural Genomics, METAL TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATOX1_HUMAN _struct_ref.pdbx_db_accession O00244 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1TL4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 68 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O00244 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 68 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 68 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 13 ? GLY A 27 ? GLY A 13 GLY A 27 1 ? 15 HELX_P HELX_P2 2 SER A 47 ? LYS A 56 ? SER A 47 LYS A 56 1 ? 10 HELX_P HELX_P3 3 LYS A 57 ? GLY A 59 ? LYS A 57 GLY A 59 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 12 O ? ? ? 1_555 B CU1 . CU ? ? A CYS 12 A CU1 69 1_555 ? ? ? ? ? ? ? 2.692 ? ? metalc2 metalc ? ? A CYS 12 SG ? ? ? 1_555 B CU1 . CU ? ? A CYS 12 A CU1 69 1_555 ? ? ? ? ? ? ? 2.154 ? ? metalc3 metalc ? ? A CYS 15 SG ? ? ? 1_555 B CU1 . CU ? ? A CYS 15 A CU1 69 1_555 ? ? ? ? ? ? ? 2.162 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A CYS 12 ? A CYS 12 ? 1_555 CU ? B CU1 . ? A CU1 69 ? 1_555 SG ? A CYS 12 ? A CYS 12 ? 1_555 95.6 ? 2 O ? A CYS 12 ? A CYS 12 ? 1_555 CU ? B CU1 . ? A CU1 69 ? 1_555 SG ? A CYS 15 ? A CYS 15 ? 1_555 98.7 ? 3 SG ? A CYS 12 ? A CYS 12 ? 1_555 CU ? B CU1 . ? A CU1 69 ? 1_555 SG ? A CYS 15 ? A CYS 15 ? 1_555 152.5 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 30 ? ASP A 34 ? LYS A 30 ASP A 34 A 2 LYS A 39 ? GLU A 43 ? LYS A 39 GLU A 43 A 3 LYS A 3 ? SER A 7 ? LYS A 3 SER A 7 A 4 SER A 63 ? GLU A 68 ? SER A 63 GLU A 68 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 30 ? N LYS A 30 O GLU A 43 ? O GLU A 43 A 2 3 O ILE A 42 ? O ILE A 42 N HIS A 4 ? N HIS A 4 A 3 4 N LYS A 3 ? N LYS A 3 O GLU A 68 ? O GLU A 68 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CU1 _struct_site.pdbx_auth_seq_id 69 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE CU1 A 69' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 CYS A 12 ? CYS A 12 . ? 1_555 ? 2 AC1 2 CYS A 15 ? CYS A 15 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2 ? ? -112.49 62.02 2 3 ASP A 9 ? ? -67.15 79.15 3 3 THR A 61 ? ? -66.07 78.11 4 4 ASP A 9 ? ? -112.34 75.32 5 4 HIS A 46 ? ? -26.41 96.40 6 4 SER A 47 ? ? -39.30 138.86 7 4 LYS A 60 ? ? -124.72 -157.16 8 4 THR A 61 ? ? -74.72 43.91 9 5 THR A 61 ? ? -62.50 84.09 10 6 LYS A 56 ? ? -38.91 -35.21 11 7 PRO A 2 ? ? -94.71 56.44 12 7 HIS A 46 ? ? -58.05 94.33 13 7 THR A 61 ? ? -72.44 47.70 14 8 PRO A 2 ? ? -99.68 44.89 15 8 ASP A 9 ? ? -68.49 74.39 16 8 THR A 61 ? ? -73.21 48.26 17 9 PRO A 2 ? ? -112.12 70.48 18 9 MET A 10 ? ? -116.98 53.95 19 10 MET A 10 ? ? -113.16 68.16 20 10 LYS A 38 ? ? 60.76 66.14 21 10 LYS A 60 ? ? -102.46 -160.05 22 10 THR A 61 ? ? -75.44 44.41 23 11 PRO A 2 ? ? -64.23 70.38 24 12 PRO A 2 ? ? -55.03 96.49 25 12 ASP A 9 ? ? -64.72 79.93 26 13 PRO A 2 ? ? -46.74 99.78 27 13 LYS A 60 ? ? -118.24 -160.62 28 13 THR A 61 ? ? -73.79 46.86 29 14 PRO A 2 ? ? -33.85 86.48 30 14 THR A 11 ? ? -155.96 27.49 31 15 PRO A 2 ? ? -101.82 70.15 32 15 ASP A 9 ? ? -67.41 77.47 33 15 THR A 11 ? ? -149.23 -48.71 34 16 LYS A 38 ? ? 70.77 67.73 35 16 LYS A 60 ? ? -99.94 -154.97 36 16 THR A 61 ? ? -75.68 47.53 37 17 LYS A 38 ? ? 61.04 61.44 38 18 LYS A 38 ? ? 73.19 73.64 39 18 GLU A 45 ? ? -65.46 75.73 40 18 SER A 63 ? ? -69.10 -175.83 41 19 ASP A 9 ? ? -57.99 87.78 42 19 MET A 10 ? ? -107.69 78.36 43 20 ASP A 9 ? ? -56.05 63.13 44 20 LYS A 38 ? ? 72.19 63.22 45 20 THR A 61 ? ? -76.79 48.70 46 21 PRO A 2 ? ? -28.11 78.08 47 21 ASP A 9 ? ? -117.55 73.09 48 21 THR A 61 ? ? -72.25 49.61 49 22 ASP A 9 ? ? -64.81 76.16 50 22 THR A 61 ? ? -68.48 75.36 51 23 ASP A 9 ? ? -115.04 58.07 52 23 LYS A 38 ? ? 39.74 72.55 53 23 GLU A 45 ? ? -111.82 65.11 54 23 THR A 61 ? ? -72.33 48.71 55 24 ASP A 9 ? ? -63.22 52.89 56 24 LYS A 60 ? ? -124.67 -169.95 57 24 THR A 61 ? ? -79.09 45.42 58 25 PRO A 2 ? ? -102.98 -108.04 59 25 THR A 61 ? ? -67.95 76.16 60 26 LYS A 38 ? ? 61.74 71.95 61 27 ASP A 9 ? ? -45.32 105.70 62 27 THR A 61 ? ? -67.53 78.14 63 28 VAL A 29 ? ? -28.83 132.07 64 28 LYS A 38 ? ? 35.55 75.96 65 28 LYS A 60 ? ? -121.59 -167.78 66 29 PRO A 2 ? ? -39.60 85.17 67 29 THR A 11 ? ? -148.21 -47.48 68 29 LYS A 60 ? ? -112.31 -166.17 69 30 VAL A 29 ? ? -21.83 124.99 70 30 LYS A 38 ? ? 53.69 71.41 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 VAL A 29 ? ? LYS A 30 ? ? 148.00 2 2 MET A 1 ? ? PRO A 2 ? ? 136.34 3 6 MET A 1 ? ? PRO A 2 ? ? 142.55 4 9 LEU A 67 ? ? GLU A 68 ? ? 148.65 5 10 VAL A 29 ? ? LYS A 30 ? ? 143.44 6 11 VAL A 29 ? ? LYS A 30 ? ? 149.59 7 12 MET A 1 ? ? PRO A 2 ? ? -144.79 8 14 MET A 1 ? ? PRO A 2 ? ? -146.29 9 14 VAL A 29 ? ? LYS A 30 ? ? 145.42 10 15 MET A 1 ? ? PRO A 2 ? ? 148.92 11 15 VAL A 29 ? ? LYS A 30 ? ? 143.09 12 16 VAL A 8 ? ? ASP A 9 ? ? 144.51 13 18 ASP A 32 ? ? ILE A 33 ? ? -149.58 14 21 VAL A 29 ? ? LYS A 30 ? ? 145.69 15 23 ASP A 32 ? ? ILE A 33 ? ? -145.05 16 24 ASP A 32 ? ? ILE A 33 ? ? -136.97 17 27 LEU A 65 ? ? GLY A 66 ? ? -145.85 18 27 LEU A 67 ? ? GLU A 68 ? ? 148.53 19 29 MET A 1 ? ? PRO A 2 ? ? -147.18 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 HIS A 46 ? ? 0.090 'SIDE CHAIN' 2 1 TYR A 64 ? ? 0.145 'SIDE CHAIN' 3 2 PHE A 6 ? ? 0.134 'SIDE CHAIN' 4 2 HIS A 46 ? ? 0.090 'SIDE CHAIN' 5 2 TYR A 64 ? ? 0.114 'SIDE CHAIN' 6 4 TYR A 31 ? ? 0.090 'SIDE CHAIN' 7 7 TYR A 64 ? ? 0.064 'SIDE CHAIN' 8 10 PHE A 6 ? ? 0.151 'SIDE CHAIN' 9 11 TYR A 31 ? ? 0.069 'SIDE CHAIN' 10 12 PHE A 6 ? ? 0.096 'SIDE CHAIN' 11 12 HIS A 46 ? ? 0.120 'SIDE CHAIN' 12 12 TYR A 64 ? ? 0.132 'SIDE CHAIN' 13 14 PHE A 6 ? ? 0.082 'SIDE CHAIN' 14 16 TYR A 64 ? ? 0.065 'SIDE CHAIN' 15 17 TYR A 31 ? ? 0.086 'SIDE CHAIN' 16 17 TYR A 64 ? ? 0.178 'SIDE CHAIN' 17 18 TYR A 31 ? ? 0.067 'SIDE CHAIN' 18 18 TYR A 64 ? ? 0.125 'SIDE CHAIN' 19 26 TYR A 64 ? ? 0.127 'SIDE CHAIN' 20 28 TYR A 31 ? ? 0.090 'SIDE CHAIN' 21 30 TYR A 31 ? ? 0.096 'SIDE CHAIN' 22 30 TYR A 64 ? ? 0.079 'SIDE CHAIN' # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Proteomics in Europe' _pdbx_SG_project.initial_of_center SPINE # _pdbx_nmr_ensemble.entry_id 1TL4 _pdbx_nmr_ensemble.conformers_calculated_total_number 400 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1.0 mM Cu(I)HAH1 U-15N; 10 mM sodium acetate' '90% H2O/10% D2O' 2 '2 mM Cu(I)HAH1 U-95% 13C,U-98% 15N; 4 mM DTT; 100 mM phosphate buffer' '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 ambient 6 '10 mM sodium acetate' ? K 2 298 ambient 7 '100 mM phosphate buffer' ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 2 2 CBCANH 2 2 2 CBCACONH 3 2 2 HNCO 4 2 2 'HN(CA)CO' 5 2 2 '(H)CCH_TOCSY' 6 2 2 HNHA 7 1 1 3D_15N-separated_NOESY 8 1 1 '2D NOESY' 9 1 1 '2D TOCSY' 10 2 2 3D_13C-separated_NOESY # _pdbx_nmr_refine.entry_id 1TL4 _pdbx_nmr_refine.method 'torsion angle dynamics coupled with simulated annealing followed by restrained energy minimization' _pdbx_nmr_refine.details 'the structures were based on a total of 1219 meaningful distance constraints, 99 dihedral angle restraints.' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR ? collection ? 1 XEASY 1.3 'data analysis' ? 2 DIANA 1.5 'structure solution' ? 3 CYANA 1.0 'structure solution' ? 4 Amber 5.0 refinement ? 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CU1 CU CU N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLU N N N N 89 GLU CA C N S 90 GLU C C N N 91 GLU O O N N 92 GLU CB C N N 93 GLU CG C N N 94 GLU CD C N N 95 GLU OE1 O N N 96 GLU OE2 O N N 97 GLU OXT O N N 98 GLU H H N N 99 GLU H2 H N N 100 GLU HA H N N 101 GLU HB2 H N N 102 GLU HB3 H N N 103 GLU HG2 H N N 104 GLU HG3 H N N 105 GLU HE2 H N N 106 GLU HXT H N N 107 GLY N N N N 108 GLY CA C N N 109 GLY C C N N 110 GLY O O N N 111 GLY OXT O N N 112 GLY H H N N 113 GLY H2 H N N 114 GLY HA2 H N N 115 GLY HA3 H N N 116 GLY HXT H N N 117 HIS N N N N 118 HIS CA C N S 119 HIS C C N N 120 HIS O O N N 121 HIS CB C N N 122 HIS CG C Y N 123 HIS ND1 N Y N 124 HIS CD2 C Y N 125 HIS CE1 C Y N 126 HIS NE2 N Y N 127 HIS OXT O N N 128 HIS H H N N 129 HIS H2 H N N 130 HIS HA H N N 131 HIS HB2 H N N 132 HIS HB3 H N N 133 HIS HD1 H N N 134 HIS HD2 H N N 135 HIS HE1 H N N 136 HIS HE2 H N N 137 HIS HXT H N N 138 ILE N N N N 139 ILE CA C N S 140 ILE C C N N 141 ILE O O N N 142 ILE CB C N S 143 ILE CG1 C N N 144 ILE CG2 C N N 145 ILE CD1 C N N 146 ILE OXT O N N 147 ILE H H N N 148 ILE H2 H N N 149 ILE HA H N N 150 ILE HB H N N 151 ILE HG12 H N N 152 ILE HG13 H N N 153 ILE HG21 H N N 154 ILE HG22 H N N 155 ILE HG23 H N N 156 ILE HD11 H N N 157 ILE HD12 H N N 158 ILE HD13 H N N 159 ILE HXT H N N 160 LEU N N N N 161 LEU CA C N S 162 LEU C C N N 163 LEU O O N N 164 LEU CB C N N 165 LEU CG C N N 166 LEU CD1 C N N 167 LEU CD2 C N N 168 LEU OXT O N N 169 LEU H H N N 170 LEU H2 H N N 171 LEU HA H N N 172 LEU HB2 H N N 173 LEU HB3 H N N 174 LEU HG H N N 175 LEU HD11 H N N 176 LEU HD12 H N N 177 LEU HD13 H N N 178 LEU HD21 H N N 179 LEU HD22 H N N 180 LEU HD23 H N N 181 LEU HXT H N N 182 LYS N N N N 183 LYS CA C N S 184 LYS C C N N 185 LYS O O N N 186 LYS CB C N N 187 LYS CG C N N 188 LYS CD C N N 189 LYS CE C N N 190 LYS NZ N N N 191 LYS OXT O N N 192 LYS H H N N 193 LYS H2 H N N 194 LYS HA H N N 195 LYS HB2 H N N 196 LYS HB3 H N N 197 LYS HG2 H N N 198 LYS HG3 H N N 199 LYS HD2 H N N 200 LYS HD3 H N N 201 LYS HE2 H N N 202 LYS HE3 H N N 203 LYS HZ1 H N N 204 LYS HZ2 H N N 205 LYS HZ3 H N N 206 LYS HXT H N N 207 MET N N N N 208 MET CA C N S 209 MET C C N N 210 MET O O N N 211 MET CB C N N 212 MET CG C N N 213 MET SD S N N 214 MET CE C N N 215 MET OXT O N N 216 MET H H N N 217 MET H2 H N N 218 MET HA H N N 219 MET HB2 H N N 220 MET HB3 H N N 221 MET HG2 H N N 222 MET HG3 H N N 223 MET HE1 H N N 224 MET HE2 H N N 225 MET HE3 H N N 226 MET HXT H N N 227 PHE N N N N 228 PHE CA C N S 229 PHE C C N N 230 PHE O O N N 231 PHE CB C N N 232 PHE CG C Y N 233 PHE CD1 C Y N 234 PHE CD2 C Y N 235 PHE CE1 C Y N 236 PHE CE2 C Y N 237 PHE CZ C Y N 238 PHE OXT O N N 239 PHE H H N N 240 PHE H2 H N N 241 PHE HA H N N 242 PHE HB2 H N N 243 PHE HB3 H N N 244 PHE HD1 H N N 245 PHE HD2 H N N 246 PHE HE1 H N N 247 PHE HE2 H N N 248 PHE HZ H N N 249 PHE HXT H N N 250 PRO N N N N 251 PRO CA C N S 252 PRO C C N N 253 PRO O O N N 254 PRO CB C N N 255 PRO CG C N N 256 PRO CD C N N 257 PRO OXT O N N 258 PRO H H N N 259 PRO HA H N N 260 PRO HB2 H N N 261 PRO HB3 H N N 262 PRO HG2 H N N 263 PRO HG3 H N N 264 PRO HD2 H N N 265 PRO HD3 H N N 266 PRO HXT H N N 267 SER N N N N 268 SER CA C N S 269 SER C C N N 270 SER O O N N 271 SER CB C N N 272 SER OG O N N 273 SER OXT O N N 274 SER H H N N 275 SER H2 H N N 276 SER HA H N N 277 SER HB2 H N N 278 SER HB3 H N N 279 SER HG H N N 280 SER HXT H N N 281 THR N N N N 282 THR CA C N S 283 THR C C N N 284 THR O O N N 285 THR CB C N R 286 THR OG1 O N N 287 THR CG2 C N N 288 THR OXT O N N 289 THR H H N N 290 THR H2 H N N 291 THR HA H N N 292 THR HB H N N 293 THR HG1 H N N 294 THR HG21 H N N 295 THR HG22 H N N 296 THR HG23 H N N 297 THR HXT H N N 298 TYR N N N N 299 TYR CA C N S 300 TYR C C N N 301 TYR O O N N 302 TYR CB C N N 303 TYR CG C Y N 304 TYR CD1 C Y N 305 TYR CD2 C Y N 306 TYR CE1 C Y N 307 TYR CE2 C Y N 308 TYR CZ C Y N 309 TYR OH O N N 310 TYR OXT O N N 311 TYR H H N N 312 TYR H2 H N N 313 TYR HA H N N 314 TYR HB2 H N N 315 TYR HB3 H N N 316 TYR HD1 H N N 317 TYR HD2 H N N 318 TYR HE1 H N N 319 TYR HE2 H N N 320 TYR HH H N N 321 TYR HXT H N N 322 VAL N N N N 323 VAL CA C N S 324 VAL C C N N 325 VAL O O N N 326 VAL CB C N N 327 VAL CG1 C N N 328 VAL CG2 C N N 329 VAL OXT O N N 330 VAL H H N N 331 VAL H2 H N N 332 VAL HA H N N 333 VAL HB H N N 334 VAL HG11 H N N 335 VAL HG12 H N N 336 VAL HG13 H N N 337 VAL HG21 H N N 338 VAL HG22 H N N 339 VAL HG23 H N N 340 VAL HXT H N N 341 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 HIS N CA sing N N 110 HIS N H sing N N 111 HIS N H2 sing N N 112 HIS CA C sing N N 113 HIS CA CB sing N N 114 HIS CA HA sing N N 115 HIS C O doub N N 116 HIS C OXT sing N N 117 HIS CB CG sing N N 118 HIS CB HB2 sing N N 119 HIS CB HB3 sing N N 120 HIS CG ND1 sing Y N 121 HIS CG CD2 doub Y N 122 HIS ND1 CE1 doub Y N 123 HIS ND1 HD1 sing N N 124 HIS CD2 NE2 sing Y N 125 HIS CD2 HD2 sing N N 126 HIS CE1 NE2 sing Y N 127 HIS CE1 HE1 sing N N 128 HIS NE2 HE2 sing N N 129 HIS OXT HXT sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 MET N CA sing N N 197 MET N H sing N N 198 MET N H2 sing N N 199 MET CA C sing N N 200 MET CA CB sing N N 201 MET CA HA sing N N 202 MET C O doub N N 203 MET C OXT sing N N 204 MET CB CG sing N N 205 MET CB HB2 sing N N 206 MET CB HB3 sing N N 207 MET CG SD sing N N 208 MET CG HG2 sing N N 209 MET CG HG3 sing N N 210 MET SD CE sing N N 211 MET CE HE1 sing N N 212 MET CE HE2 sing N N 213 MET CE HE3 sing N N 214 MET OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TYR N CA sing N N 285 TYR N H sing N N 286 TYR N H2 sing N N 287 TYR CA C sing N N 288 TYR CA CB sing N N 289 TYR CA HA sing N N 290 TYR C O doub N N 291 TYR C OXT sing N N 292 TYR CB CG sing N N 293 TYR CB HB2 sing N N 294 TYR CB HB3 sing N N 295 TYR CG CD1 doub Y N 296 TYR CG CD2 sing Y N 297 TYR CD1 CE1 sing Y N 298 TYR CD1 HD1 sing N N 299 TYR CD2 CE2 doub Y N 300 TYR CD2 HD2 sing N N 301 TYR CE1 CZ doub Y N 302 TYR CE1 HE1 sing N N 303 TYR CE2 CZ sing Y N 304 TYR CE2 HE2 sing N N 305 TYR CZ OH sing N N 306 TYR OH HH sing N N 307 TYR OXT HXT sing N N 308 VAL N CA sing N N 309 VAL N H sing N N 310 VAL N H2 sing N N 311 VAL CA C sing N N 312 VAL CA CB sing N N 313 VAL CA HA sing N N 314 VAL C O doub N N 315 VAL C OXT sing N N 316 VAL CB CG1 sing N N 317 VAL CB CG2 sing N N 318 VAL CB HB sing N N 319 VAL CG1 HG11 sing N N 320 VAL CG1 HG12 sing N N 321 VAL CG1 HG13 sing N N 322 VAL CG2 HG21 sing N N 323 VAL CG2 HG22 sing N N 324 VAL CG2 HG23 sing N N 325 VAL OXT HXT sing N N 326 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 500 2 ? Bruker AVANCE 900 3 ? Bruker AVANCE 600 # _atom_sites.entry_id 1TL4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU H N O S # loop_