data_1TL5
# 
_entry.id   1TL5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1TL5         pdb_00001tl5 10.2210/pdb1tl5/pdb 
RCSB  RCSB022741   ?            ?                   
WWPDB D_1000022741 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-10-26 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-03-02 
5 'Structure model' 1 4 2024-05-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2            
2 4 'Structure model' pdbx_nmr_software     
3 4 'Structure model' pdbx_nmr_spectrometer 
4 4 'Structure model' pdbx_struct_assembly  
5 4 'Structure model' pdbx_struct_oper_list 
6 5 'Structure model' chem_comp_atom        
7 5 'Structure model' chem_comp_bond        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_pdbx_nmr_software.name'             
4 4 'Structure model' '_pdbx_nmr_spectrometer.model'        
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1TL5 
_pdbx_database_status.recvd_initial_deposition_date   2004-06-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          CIRMMP27 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Anastassopoulou, I.'                     1 
'Banci, L.'                               2 
'Bertini, I.'                             3 
'Cantini, F.'                             4 
'Katsari, E.'                             5 
'Rosato, A.'                              6 
'Structural Proteomics in Europe (SPINE)' 7 
# 
_citation.id                        primary 
_citation.title                     'Solution Structure of the Apo and Copper(I)-Loaded Human Metallochaperone HAH1.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            43 
_citation.page_first                13046 
_citation.page_last                 13053 
_citation.year                      2004 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15476398 
_citation.pdbx_database_id_DOI      10.1021/bi0487591 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Anastassopoulou, I.' 1 ? 
primary 'Banci, L.'           2 ? 
primary 'Bertini, I.'         3 ? 
primary 'Cantini, F.'         4 ? 
primary 'Katsari, E.'         5 ? 
primary 'Rosato, A.'          6 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Copper transport protein ATOX1' 
_entity.formula_weight             7412.646 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Metal transport protein ATX1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE 
_entity_poly.pdbx_seq_one_letter_code_can   MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         CIRMMP27 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  PRO n 
1 3  LYS n 
1 4  HIS n 
1 5  GLU n 
1 6  PHE n 
1 7  SER n 
1 8  VAL n 
1 9  ASP n 
1 10 MET n 
1 11 THR n 
1 12 CYS n 
1 13 GLY n 
1 14 GLY n 
1 15 CYS n 
1 16 ALA n 
1 17 GLU n 
1 18 ALA n 
1 19 VAL n 
1 20 SER n 
1 21 ARG n 
1 22 VAL n 
1 23 LEU n 
1 24 ASN n 
1 25 LYS n 
1 26 LEU n 
1 27 GLY n 
1 28 GLY n 
1 29 VAL n 
1 30 LYS n 
1 31 TYR n 
1 32 ASP n 
1 33 ILE n 
1 34 ASP n 
1 35 LEU n 
1 36 PRO n 
1 37 ASN n 
1 38 LYS n 
1 39 LYS n 
1 40 VAL n 
1 41 CYS n 
1 42 ILE n 
1 43 GLU n 
1 44 SER n 
1 45 GLU n 
1 46 HIS n 
1 47 SER n 
1 48 MET n 
1 49 ASP n 
1 50 THR n 
1 51 LEU n 
1 52 LEU n 
1 53 ALA n 
1 54 THR n 
1 55 LEU n 
1 56 LYS n 
1 57 LYS n 
1 58 THR n 
1 59 GLY n 
1 60 LYS n 
1 61 THR n 
1 62 VAL n 
1 63 SER n 
1 64 TYR n 
1 65 LEU n 
1 66 GLY n 
1 67 LEU n 
1 68 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'ATOX1, HAH1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET20b+ 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  1  MET MET A . n 
A 1 2  PRO 2  2  2  PRO PRO A . n 
A 1 3  LYS 3  3  3  LYS LYS A . n 
A 1 4  HIS 4  4  4  HIS HIS A . n 
A 1 5  GLU 5  5  5  GLU GLU A . n 
A 1 6  PHE 6  6  6  PHE PHE A . n 
A 1 7  SER 7  7  7  SER SER A . n 
A 1 8  VAL 8  8  8  VAL VAL A . n 
A 1 9  ASP 9  9  9  ASP ASP A . n 
A 1 10 MET 10 10 10 MET MET A . n 
A 1 11 THR 11 11 11 THR THR A . n 
A 1 12 CYS 12 12 12 CYS CYS A . n 
A 1 13 GLY 13 13 13 GLY GLY A . n 
A 1 14 GLY 14 14 14 GLY GLY A . n 
A 1 15 CYS 15 15 15 CYS CYS A . n 
A 1 16 ALA 16 16 16 ALA ALA A . n 
A 1 17 GLU 17 17 17 GLU GLU A . n 
A 1 18 ALA 18 18 18 ALA ALA A . n 
A 1 19 VAL 19 19 19 VAL VAL A . n 
A 1 20 SER 20 20 20 SER SER A . n 
A 1 21 ARG 21 21 21 ARG ARG A . n 
A 1 22 VAL 22 22 22 VAL VAL A . n 
A 1 23 LEU 23 23 23 LEU LEU A . n 
A 1 24 ASN 24 24 24 ASN ASN A . n 
A 1 25 LYS 25 25 25 LYS LYS A . n 
A 1 26 LEU 26 26 26 LEU LEU A . n 
A 1 27 GLY 27 27 27 GLY GLY A . n 
A 1 28 GLY 28 28 28 GLY GLY A . n 
A 1 29 VAL 29 29 29 VAL VAL A . n 
A 1 30 LYS 30 30 30 LYS LYS A . n 
A 1 31 TYR 31 31 31 TYR TYR A . n 
A 1 32 ASP 32 32 32 ASP ASP A . n 
A 1 33 ILE 33 33 33 ILE ILE A . n 
A 1 34 ASP 34 34 34 ASP ASP A . n 
A 1 35 LEU 35 35 35 LEU LEU A . n 
A 1 36 PRO 36 36 36 PRO PRO A . n 
A 1 37 ASN 37 37 37 ASN ASN A . n 
A 1 38 LYS 38 38 38 LYS LYS A . n 
A 1 39 LYS 39 39 39 LYS LYS A . n 
A 1 40 VAL 40 40 40 VAL VAL A . n 
A 1 41 CYS 41 41 41 CYS CYS A . n 
A 1 42 ILE 42 42 42 ILE ILE A . n 
A 1 43 GLU 43 43 43 GLU GLU A . n 
A 1 44 SER 44 44 44 SER SER A . n 
A 1 45 GLU 45 45 45 GLU GLU A . n 
A 1 46 HIS 46 46 46 HIS HIS A . n 
A 1 47 SER 47 47 47 SER SER A . n 
A 1 48 MET 48 48 48 MET MET A . n 
A 1 49 ASP 49 49 49 ASP ASP A . n 
A 1 50 THR 50 50 50 THR THR A . n 
A 1 51 LEU 51 51 51 LEU LEU A . n 
A 1 52 LEU 52 52 52 LEU LEU A . n 
A 1 53 ALA 53 53 53 ALA ALA A . n 
A 1 54 THR 54 54 54 THR THR A . n 
A 1 55 LEU 55 55 55 LEU LEU A . n 
A 1 56 LYS 56 56 56 LYS LYS A . n 
A 1 57 LYS 57 57 57 LYS LYS A . n 
A 1 58 THR 58 58 58 THR THR A . n 
A 1 59 GLY 59 59 59 GLY GLY A . n 
A 1 60 LYS 60 60 60 LYS LYS A . n 
A 1 61 THR 61 61 61 THR THR A . n 
A 1 62 VAL 62 62 62 VAL VAL A . n 
A 1 63 SER 63 63 63 SER SER A . n 
A 1 64 TYR 64 64 64 TYR TYR A . n 
A 1 65 LEU 65 65 65 LEU LEU A . n 
A 1 66 GLY 66 66 66 GLY GLY A . n 
A 1 67 LEU 67 67 67 LEU LEU A . n 
A 1 68 GLU 68 68 68 GLU GLU A . n 
# 
_exptl.entry_id          1TL5 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_database_PDB_matrix.entry_id          1TL5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1TL5 
_struct.title                     'Solution structure of apoHAH1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1TL5 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
_struct_keywords.text            
'copper protein, copper chaperone, Menkes, Wilson, Structural Proteomics in Europe, SPINE, Structural Genomics, METAL TRANSPORT' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ATOX1_HUMAN 
_struct_ref.pdbx_db_accession          O00244 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1TL5 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 68 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O00244 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  68 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       68 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 13 ? GLY A 27 ? GLY A 13 GLY A 27 1 ? 15 
HELX_P HELX_P2 2 SER A 47 ? LYS A 57 ? SER A 47 LYS A 57 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 31 ? ASP A 34 ? TYR A 31 ASP A 34 
A 2 LYS A 39 ? GLU A 43 ? LYS A 39 GLU A 43 
A 3 LYS A 3  ? SER A 7  ? LYS A 3  SER A 7  
A 4 SER A 63 ? GLU A 68 ? SER A 63 GLU A 68 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASP A 34 ? N ASP A 34 O LYS A 39 ? O LYS A 39 
A 2 3 O VAL A 40 ? O VAL A 40 N PHE A 6  ? N PHE A 6  
A 3 4 N LYS A 3  ? N LYS A 3  O GLU A 68 ? O GLU A 68 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  THR A 61 ? ? -71.18  32.94   
2   1  LEU A 65 ? ? -155.39 85.93   
3   2  VAL A 29 ? ? -12.77  118.19  
4   2  THR A 61 ? ? -70.68  30.59   
5   2  LEU A 65 ? ? -155.16 85.68   
6   3  PRO A 2  ? ? -84.69  -132.31 
7   3  THR A 61 ? ? -74.05  40.65   
8   3  LEU A 65 ? ? -152.28 82.35   
9   4  PRO A 2  ? ? -79.86  -135.21 
10  4  THR A 61 ? ? -73.01  32.99   
11  4  LEU A 65 ? ? -155.61 85.85   
12  5  PRO A 2  ? ? -52.05  88.15   
13  5  ASP A 9  ? ? -64.86  82.49   
14  5  LYS A 38 ? ? 71.03   46.45   
15  5  THR A 61 ? ? -72.50  45.37   
16  5  LEU A 65 ? ? -151.48 84.60   
17  6  ASP A 9  ? ? -68.29  80.46   
18  6  LYS A 38 ? ? 70.28   53.56   
19  6  LEU A 65 ? ? -152.56 84.30   
20  7  LYS A 38 ? ? 80.26   50.44   
21  7  LEU A 65 ? ? -154.26 85.88   
22  8  ASP A 9  ? ? -65.12  75.44   
23  8  LYS A 57 ? ? -58.45  -9.84   
24  8  THR A 61 ? ? -69.75  71.67   
25  8  LEU A 65 ? ? -156.64 85.34   
26  9  PRO A 2  ? ? -86.00  -116.09 
27  9  ASP A 9  ? ? -117.33 55.72   
28  9  THR A 11 ? ? -149.47 26.25   
29  9  LEU A 65 ? ? -152.25 84.43   
30  10 THR A 11 ? ? -152.92 86.39   
31  10 CYS A 12 ? ? -149.54 22.19   
32  10 GLU A 43 ? ? -150.34 88.33   
33  10 LEU A 65 ? ? -155.48 85.45   
34  11 LEU A 65 ? ? -154.19 85.38   
35  12 PRO A 2  ? ? -80.42  -108.09 
36  12 ASP A 9  ? ? -66.59  83.45   
37  12 LEU A 65 ? ? -155.91 85.82   
38  13 LYS A 56 ? ? -37.62  -39.07  
39  13 LEU A 65 ? ? -155.87 85.15   
40  14 THR A 61 ? ? -74.18  44.45   
41  14 LEU A 65 ? ? -156.71 85.30   
42  15 PRO A 2  ? ? -100.53 64.54   
43  15 CYS A 12 ? ? -155.30 68.15   
44  15 PRO A 36 ? ? -79.42  38.13   
45  15 ASN A 37 ? ? -157.52 -48.64  
46  15 LYS A 38 ? ? 90.30   56.02   
47  15 THR A 61 ? ? -68.19  70.03   
48  15 LEU A 65 ? ? -155.46 85.36   
49  16 PRO A 2  ? ? -68.28  -155.60 
50  16 THR A 11 ? ? -155.68 83.09   
51  16 CYS A 12 ? ? -146.13 45.61   
52  16 GLU A 45 ? ? -76.58  24.49   
53  16 LYS A 56 ? ? -35.71  -36.69  
54  16 THR A 61 ? ? -69.07  49.87   
55  16 LEU A 65 ? ? -153.59 85.37   
56  17 PRO A 2  ? ? -81.16  -124.24 
57  17 THR A 61 ? ? -75.44  45.42   
58  17 LEU A 65 ? ? -155.78 85.09   
59  18 MET A 10 ? ? -118.72 50.11   
60  18 THR A 61 ? ? -74.28  49.12   
61  18 LEU A 65 ? ? -155.22 85.19   
62  19 GLU A 45 ? ? -109.96 52.99   
63  19 THR A 61 ? ? -79.41  44.69   
64  19 LEU A 65 ? ? -155.91 83.88   
65  20 PRO A 2  ? ? -74.73  -145.77 
66  20 ASP A 9  ? ? -110.23 66.42   
67  20 THR A 11 ? ? -147.07 51.47   
68  20 THR A 61 ? ? -76.81  38.58   
69  20 LEU A 65 ? ? -156.41 85.25   
70  21 THR A 61 ? ? -73.68  45.67   
71  21 LEU A 65 ? ? -153.81 83.29   
72  22 PRO A 2  ? ? -91.74  -114.29 
73  22 CYS A 12 ? ? -155.29 67.67   
74  22 LYS A 56 ? ? -37.65  -37.95  
75  22 THR A 61 ? ? -75.67  45.84   
76  22 LEU A 65 ? ? -153.71 85.38   
77  23 THR A 11 ? ? -151.62 51.13   
78  23 LYS A 38 ? ? 74.75   49.37   
79  23 LEU A 65 ? ? -155.01 85.84   
80  24 THR A 11 ? ? -150.10 48.03   
81  24 LYS A 56 ? ? -35.67  -38.87  
82  24 THR A 61 ? ? -72.53  28.32   
83  24 LEU A 65 ? ? -153.80 85.30   
84  25 LYS A 38 ? ? 82.88   65.14   
85  25 GLU A 45 ? ? -81.34  45.78   
86  25 THR A 54 ? ? -64.76  -70.95  
87  25 LEU A 65 ? ? -152.13 84.99   
88  26 PRO A 2  ? ? -53.09  179.23  
89  26 THR A 11 ? ? -93.88  57.11   
90  26 CYS A 12 ? ? -156.19 68.37   
91  26 LYS A 38 ? ? 72.30   52.03   
92  26 THR A 61 ? ? -73.13  43.21   
93  26 LEU A 65 ? ? -155.33 84.22   
94  27 LYS A 56 ? ? -23.45  -51.41  
95  27 LEU A 65 ? ? -155.54 85.80   
96  28 LEU A 65 ? ? -154.14 86.02   
97  29 THR A 61 ? ? -73.59  39.42   
98  29 LEU A 65 ? ? -156.64 85.07   
99  30 ASP A 9  ? ? -66.23  79.83   
100 30 THR A 61 ? ? -61.03  84.53   
101 30 LEU A 65 ? ? -153.63 84.88   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 3  VAL A 8 ? ? ASP A 9 ? ? 140.71 
2 14 VAL A 8 ? ? ASP A 9 ? ? 149.12 
3 15 VAL A 8 ? ? ASP A 9 ? ? 149.41 
4 26 VAL A 8 ? ? ASP A 9 ? ? 146.12 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1  TYR A 64 ? ? 0.063 'SIDE CHAIN' 
2  2  TYR A 31 ? ? 0.119 'SIDE CHAIN' 
3  2  TYR A 64 ? ? 0.073 'SIDE CHAIN' 
4  3  TYR A 31 ? ? 0.131 'SIDE CHAIN' 
5  4  TYR A 31 ? ? 0.102 'SIDE CHAIN' 
6  4  TYR A 64 ? ? 0.147 'SIDE CHAIN' 
7  5  TYR A 31 ? ? 0.138 'SIDE CHAIN' 
8  5  HIS A 46 ? ? 0.099 'SIDE CHAIN' 
9  5  TYR A 64 ? ? 0.091 'SIDE CHAIN' 
10 7  TYR A 31 ? ? 0.127 'SIDE CHAIN' 
11 8  TYR A 31 ? ? 0.084 'SIDE CHAIN' 
12 8  TYR A 64 ? ? 0.113 'SIDE CHAIN' 
13 10 TYR A 31 ? ? 0.089 'SIDE CHAIN' 
14 11 TYR A 64 ? ? 0.125 'SIDE CHAIN' 
15 12 TYR A 64 ? ? 0.076 'SIDE CHAIN' 
16 13 TYR A 64 ? ? 0.147 'SIDE CHAIN' 
17 14 TYR A 64 ? ? 0.233 'SIDE CHAIN' 
18 15 TYR A 31 ? ? 0.218 'SIDE CHAIN' 
19 15 TYR A 64 ? ? 0.137 'SIDE CHAIN' 
20 16 TYR A 31 ? ? 0.083 'SIDE CHAIN' 
21 17 TYR A 31 ? ? 0.075 'SIDE CHAIN' 
22 17 TYR A 64 ? ? 0.082 'SIDE CHAIN' 
23 18 TYR A 31 ? ? 0.071 'SIDE CHAIN' 
24 18 TYR A 64 ? ? 0.108 'SIDE CHAIN' 
25 19 TYR A 31 ? ? 0.070 'SIDE CHAIN' 
26 19 TYR A 64 ? ? 0.176 'SIDE CHAIN' 
27 20 TYR A 64 ? ? 0.075 'SIDE CHAIN' 
28 21 TYR A 31 ? ? 0.107 'SIDE CHAIN' 
29 23 ARG A 21 ? ? 0.095 'SIDE CHAIN' 
30 24 TYR A 31 ? ? 0.097 'SIDE CHAIN' 
31 24 TYR A 64 ? ? 0.074 'SIDE CHAIN' 
32 25 TYR A 31 ? ? 0.094 'SIDE CHAIN' 
33 26 TYR A 64 ? ? 0.089 'SIDE CHAIN' 
34 27 TYR A 64 ? ? 0.089 'SIDE CHAIN' 
35 28 TYR A 31 ? ? 0.089 'SIDE CHAIN' 
36 28 TYR A 64 ? ? 0.096 'SIDE CHAIN' 
37 29 TYR A 31 ? ? 0.127 'SIDE CHAIN' 
38 29 TYR A 64 ? ? 0.231 'SIDE CHAIN' 
39 30 TYR A 31 ? ? 0.075 'SIDE CHAIN' 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Proteomics in Europe' 
_pdbx_SG_project.initial_of_center     SPINE 
# 
_pdbx_nmr_ensemble.entry_id                                      1TL5 
_pdbx_nmr_ensemble.conformers_calculated_total_number            400 
_pdbx_nmr_ensemble.conformers_submitted_total_number             30 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1.0 mM apoHAH1 U-15N; 5mM DTT; 100 mM phosphate buffer'              '90% H2O/10% D2O' 
2 '2 mM apoHAH1 U-95% 13C,U-98% 15N; 5 mM DTT; 100 mM phosphate buffer' '90% H2O/10% D2O' 
3 '2 mM unlabelled apoHAH1 ; 5 mM DTT; 100 mM phosphate buffer'         '90% H2O/10% D2O' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '100 mM phosphate buffer' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1  2 1 CBCANH                 
2  2 1 CBCACONH               
3  2 1 HNCO                   
4  2 1 HNCACO                 
5  2 1 '(H)CCH-TOCSY'         
6  2 1 3D_13C-separated_NOESY 
7  1 1 3D_15N-separated_NOESY 
8  3 1 '2D NOESY'             
9  3 1 '2D TOCSY'             
10 2 1 HNHA                   
# 
_pdbx_nmr_refine.entry_id           1TL5 
_pdbx_nmr_refine.method             
'torsion angle dynamics coupled with simulated annealing followed by restrained energy minimization' 
_pdbx_nmr_refine.details            
'the structures were based on a total of 1219 meaningful distance constraints, 99 dihedral angle restraints.' 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XwinNMR ?   collection           ? 1 
XEASY   1.3 'data analysis'      ? 2 
DIANA   1.5 'structure solution' ? 3 
CYANA   1.0 'structure solution' ? 4 
Amber   5.0 refinement           ? 5 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLU N    N N N 88  
GLU CA   C N S 89  
GLU C    C N N 90  
GLU O    O N N 91  
GLU CB   C N N 92  
GLU CG   C N N 93  
GLU CD   C N N 94  
GLU OE1  O N N 95  
GLU OE2  O N N 96  
GLU OXT  O N N 97  
GLU H    H N N 98  
GLU H2   H N N 99  
GLU HA   H N N 100 
GLU HB2  H N N 101 
GLU HB3  H N N 102 
GLU HG2  H N N 103 
GLU HG3  H N N 104 
GLU HE2  H N N 105 
GLU HXT  H N N 106 
GLY N    N N N 107 
GLY CA   C N N 108 
GLY C    C N N 109 
GLY O    O N N 110 
GLY OXT  O N N 111 
GLY H    H N N 112 
GLY H2   H N N 113 
GLY HA2  H N N 114 
GLY HA3  H N N 115 
GLY HXT  H N N 116 
HIS N    N N N 117 
HIS CA   C N S 118 
HIS C    C N N 119 
HIS O    O N N 120 
HIS CB   C N N 121 
HIS CG   C Y N 122 
HIS ND1  N Y N 123 
HIS CD2  C Y N 124 
HIS CE1  C Y N 125 
HIS NE2  N Y N 126 
HIS OXT  O N N 127 
HIS H    H N N 128 
HIS H2   H N N 129 
HIS HA   H N N 130 
HIS HB2  H N N 131 
HIS HB3  H N N 132 
HIS HD1  H N N 133 
HIS HD2  H N N 134 
HIS HE1  H N N 135 
HIS HE2  H N N 136 
HIS HXT  H N N 137 
ILE N    N N N 138 
ILE CA   C N S 139 
ILE C    C N N 140 
ILE O    O N N 141 
ILE CB   C N S 142 
ILE CG1  C N N 143 
ILE CG2  C N N 144 
ILE CD1  C N N 145 
ILE OXT  O N N 146 
ILE H    H N N 147 
ILE H2   H N N 148 
ILE HA   H N N 149 
ILE HB   H N N 150 
ILE HG12 H N N 151 
ILE HG13 H N N 152 
ILE HG21 H N N 153 
ILE HG22 H N N 154 
ILE HG23 H N N 155 
ILE HD11 H N N 156 
ILE HD12 H N N 157 
ILE HD13 H N N 158 
ILE HXT  H N N 159 
LEU N    N N N 160 
LEU CA   C N S 161 
LEU C    C N N 162 
LEU O    O N N 163 
LEU CB   C N N 164 
LEU CG   C N N 165 
LEU CD1  C N N 166 
LEU CD2  C N N 167 
LEU OXT  O N N 168 
LEU H    H N N 169 
LEU H2   H N N 170 
LEU HA   H N N 171 
LEU HB2  H N N 172 
LEU HB3  H N N 173 
LEU HG   H N N 174 
LEU HD11 H N N 175 
LEU HD12 H N N 176 
LEU HD13 H N N 177 
LEU HD21 H N N 178 
LEU HD22 H N N 179 
LEU HD23 H N N 180 
LEU HXT  H N N 181 
LYS N    N N N 182 
LYS CA   C N S 183 
LYS C    C N N 184 
LYS O    O N N 185 
LYS CB   C N N 186 
LYS CG   C N N 187 
LYS CD   C N N 188 
LYS CE   C N N 189 
LYS NZ   N N N 190 
LYS OXT  O N N 191 
LYS H    H N N 192 
LYS H2   H N N 193 
LYS HA   H N N 194 
LYS HB2  H N N 195 
LYS HB3  H N N 196 
LYS HG2  H N N 197 
LYS HG3  H N N 198 
LYS HD2  H N N 199 
LYS HD3  H N N 200 
LYS HE2  H N N 201 
LYS HE3  H N N 202 
LYS HZ1  H N N 203 
LYS HZ2  H N N 204 
LYS HZ3  H N N 205 
LYS HXT  H N N 206 
MET N    N N N 207 
MET CA   C N S 208 
MET C    C N N 209 
MET O    O N N 210 
MET CB   C N N 211 
MET CG   C N N 212 
MET SD   S N N 213 
MET CE   C N N 214 
MET OXT  O N N 215 
MET H    H N N 216 
MET H2   H N N 217 
MET HA   H N N 218 
MET HB2  H N N 219 
MET HB3  H N N 220 
MET HG2  H N N 221 
MET HG3  H N N 222 
MET HE1  H N N 223 
MET HE2  H N N 224 
MET HE3  H N N 225 
MET HXT  H N N 226 
PHE N    N N N 227 
PHE CA   C N S 228 
PHE C    C N N 229 
PHE O    O N N 230 
PHE CB   C N N 231 
PHE CG   C Y N 232 
PHE CD1  C Y N 233 
PHE CD2  C Y N 234 
PHE CE1  C Y N 235 
PHE CE2  C Y N 236 
PHE CZ   C Y N 237 
PHE OXT  O N N 238 
PHE H    H N N 239 
PHE H2   H N N 240 
PHE HA   H N N 241 
PHE HB2  H N N 242 
PHE HB3  H N N 243 
PHE HD1  H N N 244 
PHE HD2  H N N 245 
PHE HE1  H N N 246 
PHE HE2  H N N 247 
PHE HZ   H N N 248 
PHE HXT  H N N 249 
PRO N    N N N 250 
PRO CA   C N S 251 
PRO C    C N N 252 
PRO O    O N N 253 
PRO CB   C N N 254 
PRO CG   C N N 255 
PRO CD   C N N 256 
PRO OXT  O N N 257 
PRO H    H N N 258 
PRO HA   H N N 259 
PRO HB2  H N N 260 
PRO HB3  H N N 261 
PRO HG2  H N N 262 
PRO HG3  H N N 263 
PRO HD2  H N N 264 
PRO HD3  H N N 265 
PRO HXT  H N N 266 
SER N    N N N 267 
SER CA   C N S 268 
SER C    C N N 269 
SER O    O N N 270 
SER CB   C N N 271 
SER OG   O N N 272 
SER OXT  O N N 273 
SER H    H N N 274 
SER H2   H N N 275 
SER HA   H N N 276 
SER HB2  H N N 277 
SER HB3  H N N 278 
SER HG   H N N 279 
SER HXT  H N N 280 
THR N    N N N 281 
THR CA   C N S 282 
THR C    C N N 283 
THR O    O N N 284 
THR CB   C N R 285 
THR OG1  O N N 286 
THR CG2  C N N 287 
THR OXT  O N N 288 
THR H    H N N 289 
THR H2   H N N 290 
THR HA   H N N 291 
THR HB   H N N 292 
THR HG1  H N N 293 
THR HG21 H N N 294 
THR HG22 H N N 295 
THR HG23 H N N 296 
THR HXT  H N N 297 
TYR N    N N N 298 
TYR CA   C N S 299 
TYR C    C N N 300 
TYR O    O N N 301 
TYR CB   C N N 302 
TYR CG   C Y N 303 
TYR CD1  C Y N 304 
TYR CD2  C Y N 305 
TYR CE1  C Y N 306 
TYR CE2  C Y N 307 
TYR CZ   C Y N 308 
TYR OH   O N N 309 
TYR OXT  O N N 310 
TYR H    H N N 311 
TYR H2   H N N 312 
TYR HA   H N N 313 
TYR HB2  H N N 314 
TYR HB3  H N N 315 
TYR HD1  H N N 316 
TYR HD2  H N N 317 
TYR HE1  H N N 318 
TYR HE2  H N N 319 
TYR HH   H N N 320 
TYR HXT  H N N 321 
VAL N    N N N 322 
VAL CA   C N S 323 
VAL C    C N N 324 
VAL O    O N N 325 
VAL CB   C N N 326 
VAL CG1  C N N 327 
VAL CG2  C N N 328 
VAL OXT  O N N 329 
VAL H    H N N 330 
VAL H2   H N N 331 
VAL HA   H N N 332 
VAL HB   H N N 333 
VAL HG11 H N N 334 
VAL HG12 H N N 335 
VAL HG13 H N N 336 
VAL HG21 H N N 337 
VAL HG22 H N N 338 
VAL HG23 H N N 339 
VAL HXT  H N N 340 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLU N   CA   sing N N 83  
GLU N   H    sing N N 84  
GLU N   H2   sing N N 85  
GLU CA  C    sing N N 86  
GLU CA  CB   sing N N 87  
GLU CA  HA   sing N N 88  
GLU C   O    doub N N 89  
GLU C   OXT  sing N N 90  
GLU CB  CG   sing N N 91  
GLU CB  HB2  sing N N 92  
GLU CB  HB3  sing N N 93  
GLU CG  CD   sing N N 94  
GLU CG  HG2  sing N N 95  
GLU CG  HG3  sing N N 96  
GLU CD  OE1  doub N N 97  
GLU CD  OE2  sing N N 98  
GLU OE2 HE2  sing N N 99  
GLU OXT HXT  sing N N 100 
GLY N   CA   sing N N 101 
GLY N   H    sing N N 102 
GLY N   H2   sing N N 103 
GLY CA  C    sing N N 104 
GLY CA  HA2  sing N N 105 
GLY CA  HA3  sing N N 106 
GLY C   O    doub N N 107 
GLY C   OXT  sing N N 108 
GLY OXT HXT  sing N N 109 
HIS N   CA   sing N N 110 
HIS N   H    sing N N 111 
HIS N   H2   sing N N 112 
HIS CA  C    sing N N 113 
HIS CA  CB   sing N N 114 
HIS CA  HA   sing N N 115 
HIS C   O    doub N N 116 
HIS C   OXT  sing N N 117 
HIS CB  CG   sing N N 118 
HIS CB  HB2  sing N N 119 
HIS CB  HB3  sing N N 120 
HIS CG  ND1  sing Y N 121 
HIS CG  CD2  doub Y N 122 
HIS ND1 CE1  doub Y N 123 
HIS ND1 HD1  sing N N 124 
HIS CD2 NE2  sing Y N 125 
HIS CD2 HD2  sing N N 126 
HIS CE1 NE2  sing Y N 127 
HIS CE1 HE1  sing N N 128 
HIS NE2 HE2  sing N N 129 
HIS OXT HXT  sing N N 130 
ILE N   CA   sing N N 131 
ILE N   H    sing N N 132 
ILE N   H2   sing N N 133 
ILE CA  C    sing N N 134 
ILE CA  CB   sing N N 135 
ILE CA  HA   sing N N 136 
ILE C   O    doub N N 137 
ILE C   OXT  sing N N 138 
ILE CB  CG1  sing N N 139 
ILE CB  CG2  sing N N 140 
ILE CB  HB   sing N N 141 
ILE CG1 CD1  sing N N 142 
ILE CG1 HG12 sing N N 143 
ILE CG1 HG13 sing N N 144 
ILE CG2 HG21 sing N N 145 
ILE CG2 HG22 sing N N 146 
ILE CG2 HG23 sing N N 147 
ILE CD1 HD11 sing N N 148 
ILE CD1 HD12 sing N N 149 
ILE CD1 HD13 sing N N 150 
ILE OXT HXT  sing N N 151 
LEU N   CA   sing N N 152 
LEU N   H    sing N N 153 
LEU N   H2   sing N N 154 
LEU CA  C    sing N N 155 
LEU CA  CB   sing N N 156 
LEU CA  HA   sing N N 157 
LEU C   O    doub N N 158 
LEU C   OXT  sing N N 159 
LEU CB  CG   sing N N 160 
LEU CB  HB2  sing N N 161 
LEU CB  HB3  sing N N 162 
LEU CG  CD1  sing N N 163 
LEU CG  CD2  sing N N 164 
LEU CG  HG   sing N N 165 
LEU CD1 HD11 sing N N 166 
LEU CD1 HD12 sing N N 167 
LEU CD1 HD13 sing N N 168 
LEU CD2 HD21 sing N N 169 
LEU CD2 HD22 sing N N 170 
LEU CD2 HD23 sing N N 171 
LEU OXT HXT  sing N N 172 
LYS N   CA   sing N N 173 
LYS N   H    sing N N 174 
LYS N   H2   sing N N 175 
LYS CA  C    sing N N 176 
LYS CA  CB   sing N N 177 
LYS CA  HA   sing N N 178 
LYS C   O    doub N N 179 
LYS C   OXT  sing N N 180 
LYS CB  CG   sing N N 181 
LYS CB  HB2  sing N N 182 
LYS CB  HB3  sing N N 183 
LYS CG  CD   sing N N 184 
LYS CG  HG2  sing N N 185 
LYS CG  HG3  sing N N 186 
LYS CD  CE   sing N N 187 
LYS CD  HD2  sing N N 188 
LYS CD  HD3  sing N N 189 
LYS CE  NZ   sing N N 190 
LYS CE  HE2  sing N N 191 
LYS CE  HE3  sing N N 192 
LYS NZ  HZ1  sing N N 193 
LYS NZ  HZ2  sing N N 194 
LYS NZ  HZ3  sing N N 195 
LYS OXT HXT  sing N N 196 
MET N   CA   sing N N 197 
MET N   H    sing N N 198 
MET N   H2   sing N N 199 
MET CA  C    sing N N 200 
MET CA  CB   sing N N 201 
MET CA  HA   sing N N 202 
MET C   O    doub N N 203 
MET C   OXT  sing N N 204 
MET CB  CG   sing N N 205 
MET CB  HB2  sing N N 206 
MET CB  HB3  sing N N 207 
MET CG  SD   sing N N 208 
MET CG  HG2  sing N N 209 
MET CG  HG3  sing N N 210 
MET SD  CE   sing N N 211 
MET CE  HE1  sing N N 212 
MET CE  HE2  sing N N 213 
MET CE  HE3  sing N N 214 
MET OXT HXT  sing N N 215 
PHE N   CA   sing N N 216 
PHE N   H    sing N N 217 
PHE N   H2   sing N N 218 
PHE CA  C    sing N N 219 
PHE CA  CB   sing N N 220 
PHE CA  HA   sing N N 221 
PHE C   O    doub N N 222 
PHE C   OXT  sing N N 223 
PHE CB  CG   sing N N 224 
PHE CB  HB2  sing N N 225 
PHE CB  HB3  sing N N 226 
PHE CG  CD1  doub Y N 227 
PHE CG  CD2  sing Y N 228 
PHE CD1 CE1  sing Y N 229 
PHE CD1 HD1  sing N N 230 
PHE CD2 CE2  doub Y N 231 
PHE CD2 HD2  sing N N 232 
PHE CE1 CZ   doub Y N 233 
PHE CE1 HE1  sing N N 234 
PHE CE2 CZ   sing Y N 235 
PHE CE2 HE2  sing N N 236 
PHE CZ  HZ   sing N N 237 
PHE OXT HXT  sing N N 238 
PRO N   CA   sing N N 239 
PRO N   CD   sing N N 240 
PRO N   H    sing N N 241 
PRO CA  C    sing N N 242 
PRO CA  CB   sing N N 243 
PRO CA  HA   sing N N 244 
PRO C   O    doub N N 245 
PRO C   OXT  sing N N 246 
PRO CB  CG   sing N N 247 
PRO CB  HB2  sing N N 248 
PRO CB  HB3  sing N N 249 
PRO CG  CD   sing N N 250 
PRO CG  HG2  sing N N 251 
PRO CG  HG3  sing N N 252 
PRO CD  HD2  sing N N 253 
PRO CD  HD3  sing N N 254 
PRO OXT HXT  sing N N 255 
SER N   CA   sing N N 256 
SER N   H    sing N N 257 
SER N   H2   sing N N 258 
SER CA  C    sing N N 259 
SER CA  CB   sing N N 260 
SER CA  HA   sing N N 261 
SER C   O    doub N N 262 
SER C   OXT  sing N N 263 
SER CB  OG   sing N N 264 
SER CB  HB2  sing N N 265 
SER CB  HB3  sing N N 266 
SER OG  HG   sing N N 267 
SER OXT HXT  sing N N 268 
THR N   CA   sing N N 269 
THR N   H    sing N N 270 
THR N   H2   sing N N 271 
THR CA  C    sing N N 272 
THR CA  CB   sing N N 273 
THR CA  HA   sing N N 274 
THR C   O    doub N N 275 
THR C   OXT  sing N N 276 
THR CB  OG1  sing N N 277 
THR CB  CG2  sing N N 278 
THR CB  HB   sing N N 279 
THR OG1 HG1  sing N N 280 
THR CG2 HG21 sing N N 281 
THR CG2 HG22 sing N N 282 
THR CG2 HG23 sing N N 283 
THR OXT HXT  sing N N 284 
TYR N   CA   sing N N 285 
TYR N   H    sing N N 286 
TYR N   H2   sing N N 287 
TYR CA  C    sing N N 288 
TYR CA  CB   sing N N 289 
TYR CA  HA   sing N N 290 
TYR C   O    doub N N 291 
TYR C   OXT  sing N N 292 
TYR CB  CG   sing N N 293 
TYR CB  HB2  sing N N 294 
TYR CB  HB3  sing N N 295 
TYR CG  CD1  doub Y N 296 
TYR CG  CD2  sing Y N 297 
TYR CD1 CE1  sing Y N 298 
TYR CD1 HD1  sing N N 299 
TYR CD2 CE2  doub Y N 300 
TYR CD2 HD2  sing N N 301 
TYR CE1 CZ   doub Y N 302 
TYR CE1 HE1  sing N N 303 
TYR CE2 CZ   sing Y N 304 
TYR CE2 HE2  sing N N 305 
TYR CZ  OH   sing N N 306 
TYR OH  HH   sing N N 307 
TYR OXT HXT  sing N N 308 
VAL N   CA   sing N N 309 
VAL N   H    sing N N 310 
VAL N   H2   sing N N 311 
VAL CA  C    sing N N 312 
VAL CA  CB   sing N N 313 
VAL CA  HA   sing N N 314 
VAL C   O    doub N N 315 
VAL C   OXT  sing N N 316 
VAL CB  CG1  sing N N 317 
VAL CB  CG2  sing N N 318 
VAL CB  HB   sing N N 319 
VAL CG1 HG11 sing N N 320 
VAL CG1 HG12 sing N N 321 
VAL CG1 HG13 sing N N 322 
VAL CG2 HG21 sing N N 323 
VAL CG2 HG22 sing N N 324 
VAL CG2 HG23 sing N N 325 
VAL OXT HXT  sing N N 326 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker AVANCE 500 
2 ? Bruker AVANCE 600 
3 ? Bruker AVANCE 700 
# 
_atom_sites.entry_id                    1TL5 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_