data_1TLQ # _entry.id 1TLQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1TLQ pdb_00001tlq 10.2210/pdb1tlq/pdb RCSB RCSB022751 ? ? WWPDB D_1000022751 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-06-22 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-02-03 5 'Structure model' 1 4 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Structure summary' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' audit_author 2 4 'Structure model' pdbx_struct_conn_angle 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_ref_seq_dif 5 4 'Structure model' struct_site 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 9 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_audit_author.identifier_ORCID' 2 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 29 4 'Structure model' '_struct_ref_seq_dif.details' 30 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 31 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 4 'Structure model' '_struct_site.pdbx_auth_seq_id' 33 5 'Structure model' '_database_2.pdbx_DOI' 34 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1TLQ _pdbx_database_status.recvd_initial_deposition_date 2004-06-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id NYSGXRC-T1519 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kniewel, R.' 1 ? 'Rajashankar, K.R.' 2 ? 'Solorzano, V.' 3 ? 'Lima, C.D.' 4 ? 'Burley, S.K.' 5 0000-0002-2487-9713 'New York SGX Research Center for Structural Genomics (NYSGXRC)' 6 ? # _citation.id primary _citation.title 'Crystal Structure of a Hypothetical Protein from Bacillus subtilis' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'KNIEWEL, R.' 1 ? primary 'RAJASHANKAR, K.R.' 2 ? primary 'SOLORZANO, V.' 3 ? primary 'LIMA, C.D.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hypothetical protein ypjQ' 21565.668 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 water nat water 18.015 24 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)SLKKYT(MSE)NE(MSE)VDITKD(MSE)LNKRGV(MSE)IEDIARIVQKLQEKYNPNLPLSVC(MSE)ENVEKV LNKREIIHAVLTGLALDQLAEQKLLPEPLQHLVETDEPLYGIDEIIPLSIVNVYGSIGLTNFGYLDKEKIGIIKELDESP DGIHTFLDDIVAALAAAAASRIAHTHQDLQDEEKEQDEKPVVSEGGSHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSLKKYTMNEMVDITKDMLNKRGVMIEDIARIVQKLQEKYNPNLPLSVCMENVEKVLNKREIIHAVLTGLALDQLAEQKL LPEPLQHLVETDEPLYGIDEIIPLSIVNVYGSIGLTNFGYLDKEKIGIIKELDESPDGIHTFLDDIVAALAAAAASRIAH THQDLQDEEKEQDEKPVVSEGGSHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGXRC-T1519 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 SER n 1 3 LEU n 1 4 LYS n 1 5 LYS n 1 6 TYR n 1 7 THR n 1 8 MSE n 1 9 ASN n 1 10 GLU n 1 11 MSE n 1 12 VAL n 1 13 ASP n 1 14 ILE n 1 15 THR n 1 16 LYS n 1 17 ASP n 1 18 MSE n 1 19 LEU n 1 20 ASN n 1 21 LYS n 1 22 ARG n 1 23 GLY n 1 24 VAL n 1 25 MSE n 1 26 ILE n 1 27 GLU n 1 28 ASP n 1 29 ILE n 1 30 ALA n 1 31 ARG n 1 32 ILE n 1 33 VAL n 1 34 GLN n 1 35 LYS n 1 36 LEU n 1 37 GLN n 1 38 GLU n 1 39 LYS n 1 40 TYR n 1 41 ASN n 1 42 PRO n 1 43 ASN n 1 44 LEU n 1 45 PRO n 1 46 LEU n 1 47 SER n 1 48 VAL n 1 49 CYS n 1 50 MSE n 1 51 GLU n 1 52 ASN n 1 53 VAL n 1 54 GLU n 1 55 LYS n 1 56 VAL n 1 57 LEU n 1 58 ASN n 1 59 LYS n 1 60 ARG n 1 61 GLU n 1 62 ILE n 1 63 ILE n 1 64 HIS n 1 65 ALA n 1 66 VAL n 1 67 LEU n 1 68 THR n 1 69 GLY n 1 70 LEU n 1 71 ALA n 1 72 LEU n 1 73 ASP n 1 74 GLN n 1 75 LEU n 1 76 ALA n 1 77 GLU n 1 78 GLN n 1 79 LYS n 1 80 LEU n 1 81 LEU n 1 82 PRO n 1 83 GLU n 1 84 PRO n 1 85 LEU n 1 86 GLN n 1 87 HIS n 1 88 LEU n 1 89 VAL n 1 90 GLU n 1 91 THR n 1 92 ASP n 1 93 GLU n 1 94 PRO n 1 95 LEU n 1 96 TYR n 1 97 GLY n 1 98 ILE n 1 99 ASP n 1 100 GLU n 1 101 ILE n 1 102 ILE n 1 103 PRO n 1 104 LEU n 1 105 SER n 1 106 ILE n 1 107 VAL n 1 108 ASN n 1 109 VAL n 1 110 TYR n 1 111 GLY n 1 112 SER n 1 113 ILE n 1 114 GLY n 1 115 LEU n 1 116 THR n 1 117 ASN n 1 118 PHE n 1 119 GLY n 1 120 TYR n 1 121 LEU n 1 122 ASP n 1 123 LYS n 1 124 GLU n 1 125 LYS n 1 126 ILE n 1 127 GLY n 1 128 ILE n 1 129 ILE n 1 130 LYS n 1 131 GLU n 1 132 LEU n 1 133 ASP n 1 134 GLU n 1 135 SER n 1 136 PRO n 1 137 ASP n 1 138 GLY n 1 139 ILE n 1 140 HIS n 1 141 THR n 1 142 PHE n 1 143 LEU n 1 144 ASP n 1 145 ASP n 1 146 ILE n 1 147 VAL n 1 148 ALA n 1 149 ALA n 1 150 LEU n 1 151 ALA n 1 152 ALA n 1 153 ALA n 1 154 ALA n 1 155 ALA n 1 156 SER n 1 157 ARG n 1 158 ILE n 1 159 ALA n 1 160 HIS n 1 161 THR n 1 162 HIS n 1 163 GLN n 1 164 ASP n 1 165 LEU n 1 166 GLN n 1 167 ASP n 1 168 GLU n 1 169 GLU n 1 170 LYS n 1 171 GLU n 1 172 GLN n 1 173 ASP n 1 174 GLU n 1 175 LYS n 1 176 PRO n 1 177 VAL n 1 178 VAL n 1 179 SER n 1 180 GLU n 1 181 GLY n 1 182 GLY n 1 183 SER n 1 184 HIS n 1 185 HIS n 1 186 HIS n 1 187 HIS n 1 188 HIS n 1 189 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene 'YPJQ, BSU21830' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'B834 DE3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pETT7 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 LYS 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 MSE 8 8 8 MSE MSE A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 MSE 11 11 11 MSE MSE A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 MSE 18 18 18 MSE MSE A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 MSE 25 25 25 MSE MSE A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 MSE 50 50 50 MSE MSE A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 TYR 120 120 120 TYR TYR A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 SER 135 135 135 SER SER A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 HIS 140 140 140 HIS HIS A . n A 1 141 THR 141 141 141 THR THR A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 SER 156 156 156 SER SER A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 HIS 160 160 160 HIS HIS A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 HIS 162 162 162 HIS HIS A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 ASP 167 167 ? ? ? A . n A 1 168 GLU 168 168 ? ? ? A . n A 1 169 GLU 169 169 ? ? ? A . n A 1 170 LYS 170 170 ? ? ? A . n A 1 171 GLU 171 171 ? ? ? A . n A 1 172 GLN 172 172 ? ? ? A . n A 1 173 ASP 173 173 ? ? ? A . n A 1 174 GLU 174 174 ? ? ? A . n A 1 175 LYS 175 175 ? ? ? A . n A 1 176 PRO 176 176 ? ? ? A . n A 1 177 VAL 177 177 ? ? ? A . n A 1 178 VAL 178 178 ? ? ? A . n A 1 179 SER 179 179 ? ? ? A . n A 1 180 GLU 180 180 ? ? ? A . n A 1 181 GLY 181 181 ? ? ? A . n A 1 182 GLY 182 182 ? ? ? A . n A 1 183 SER 183 183 ? ? ? A . n A 1 184 HIS 184 184 ? ? ? A . n A 1 185 HIS 185 185 ? ? ? A . n A 1 186 HIS 186 186 ? ? ? A . n A 1 187 HIS 187 187 ? ? ? A . n A 1 188 HIS 188 188 ? ? ? A . n A 1 189 HIS 189 189 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 190 1 CA CA A . C 3 HOH 1 191 2 HOH HOH A . C 3 HOH 2 192 3 HOH HOH A . C 3 HOH 3 193 4 HOH HOH A . C 3 HOH 4 194 5 HOH HOH A . C 3 HOH 5 195 6 HOH HOH A . C 3 HOH 6 196 7 HOH HOH A . C 3 HOH 7 197 8 HOH HOH A . C 3 HOH 8 198 9 HOH HOH A . C 3 HOH 9 199 10 HOH HOH A . C 3 HOH 10 200 11 HOH HOH A . C 3 HOH 11 201 12 HOH HOH A . C 3 HOH 12 202 13 HOH HOH A . C 3 HOH 13 203 14 HOH HOH A . C 3 HOH 14 204 15 HOH HOH A . C 3 HOH 15 205 16 HOH HOH A . C 3 HOH 16 206 17 HOH HOH A . C 3 HOH 17 207 18 HOH HOH A . C 3 HOH 18 208 19 HOH HOH A . C 3 HOH 19 209 20 HOH HOH A . C 3 HOH 20 210 21 HOH HOH A . C 3 HOH 21 211 22 HOH HOH A . C 3 HOH 22 212 23 HOH HOH A . C 3 HOH 23 213 24 HOH HOH A . C 3 HOH 24 214 25 HOH HOH A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.1.24 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 SOLVE phasing . ? 4 # _cell.entry_id 1TLQ _cell.length_a 118.112 _cell.length_b 118.112 _cell.length_c 65.792 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1TLQ _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall ? # _exptl.entry_id 1TLQ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.12 _exptl_crystal.density_percent_sol 60.22 _exptl_crystal.description 'The number of reflections for the data collection 20050 includes Friedel pairs' _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.75 _exptl_crystal_grow.pdbx_details '26% Peg 4k, 0.1M Tris, 0.8M Lithium Chloride, pH 8.75, VAPOR DIFFUSION, HANGING DROP, temperature 291K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2004-04-27 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SAGITALLY FOCUSED Si(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X9A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X9A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.98 # _reflns.entry_id 1TLQ _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 2.4 _reflns.d_resolution_low 20.0 _reflns.number_all 20050 _reflns.number_obs 20050 _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.074 _reflns.pdbx_netI_over_sigmaI 31.75 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 11.15 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.4 _reflns_shell.d_res_low 2.49 _reflns_shell.percent_possible_all 99.9 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.456 _reflns_shell.meanI_over_sigI_obs 4.45 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1998 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1TLQ _refine.ls_number_reflns_obs 10470 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 2.40 _refine.ls_percent_reflns_obs 99.59 _refine.ls_R_factor_obs 0.23534 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.23244 _refine.ls_R_factor_R_free 0.29466 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 529 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.932 _refine.correlation_coeff_Fo_to_Fc_free 0.895 _refine.B_iso_mean 44.966 _refine.aniso_B[1][1] 2.58 _refine.aniso_B[2][2] 2.58 _refine.aniso_B[3][3] -3.88 _refine.aniso_B[1][2] 1.29 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'Experimental electron density from Selenium SAD experiment.' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.279 _refine.pdbx_overall_ESU_R_Free 0.252 _refine.overall_SU_ML 0.178 _refine.overall_SU_B 7.609 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1262 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 24 _refine_hist.number_atoms_total 1287 _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.046 0.022 ? 1280 'X-RAY DIFFRACTION' ? r_angle_refined_deg 3.232 1.985 ? 1736 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 8.527 5.000 ? 160 'X-RAY DIFFRACTION' ? r_chiral_restr 0.238 0.200 ? 209 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.019 0.020 ? 936 'X-RAY DIFFRACTION' ? r_nbd_refined 0.312 0.200 ? 689 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.187 0.200 ? 55 'X-RAY DIFFRACTION' ? r_metal_ion_refined 0.283 0.200 ? 2 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.281 0.200 ? 42 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.234 0.200 ? 5 'X-RAY DIFFRACTION' ? r_mcbond_it 2.034 1.500 ? 803 'X-RAY DIFFRACTION' ? r_mcangle_it 3.534 2.000 ? 1305 'X-RAY DIFFRACTION' ? r_scbond_it 5.288 3.000 ? 477 'X-RAY DIFFRACTION' ? r_scangle_it 7.926 4.500 ? 431 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.400 _refine_ls_shell.d_res_low 2.463 _refine_ls_shell.number_reflns_R_work 768 _refine_ls_shell.R_factor_R_work 0.247 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.292 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 40 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _database_PDB_matrix.entry_id 1TLQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1TLQ _struct.title 'Crystal structure of protein ypjQ from Bacillus subtilis, Pfam DUF64' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1TLQ _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;YPJQ, Bacillus subtilis, Structural Genomics, NYSGXRC, T1519, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YPJQ_BACSU _struct_ref.pdbx_db_accession P54173 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KKYTMNEMVDITKDMLNKRGVMIEDIARIVQKLQEKYNPNLPLSVCMENVEKVLNKREIIHAVLTGLALDQLAEQKLLPE PLQHLVETDEPLYGIDEIIPLSIVNVYGSIGLTNFGYLDKEKIGIIKELDESPDGIHTFLDDIVAALAAAAASRIAHTHQ DLQDEEKEQDEKPVVS ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1TLQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 179 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P54173 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 177 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 179 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1TLQ MSE A 1 ? UNP P54173 ? ? 'cloning artifact' 1 1 1 1TLQ SER A 2 ? UNP P54173 ? ? 'cloning artifact' 2 2 1 1TLQ LEU A 3 ? UNP P54173 ? ? 'cloning artifact' 3 3 1 1TLQ MSE A 8 ? UNP P54173 MET 6 'modified residue' 8 4 1 1TLQ MSE A 11 ? UNP P54173 MET 9 'modified residue' 11 5 1 1TLQ MSE A 18 ? UNP P54173 MET 16 'modified residue' 18 6 1 1TLQ MSE A 25 ? UNP P54173 MET 23 'modified residue' 25 7 1 1TLQ MSE A 50 ? UNP P54173 MET 48 'modified residue' 50 8 1 1TLQ GLU A 180 ? UNP P54173 ? ? 'expression tag' 180 9 1 1TLQ GLY A 181 ? UNP P54173 ? ? 'expression tag' 181 10 1 1TLQ GLY A 182 ? UNP P54173 ? ? 'expression tag' 182 11 1 1TLQ SER A 183 ? UNP P54173 ? ? 'expression tag' 183 12 1 1TLQ HIS A 184 ? UNP P54173 ? ? 'expression tag' 184 13 1 1TLQ HIS A 185 ? UNP P54173 ? ? 'expression tag' 185 14 1 1TLQ HIS A 186 ? UNP P54173 ? ? 'expression tag' 186 15 1 1TLQ HIS A 187 ? UNP P54173 ? ? 'expression tag' 187 16 1 1TLQ HIS A 188 ? UNP P54173 ? ? 'expression tag' 188 17 1 1TLQ HIS A 189 ? UNP P54173 ? ? 'expression tag' 189 18 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 10480 ? 1 MORE -124 ? 1 'SSA (A^2)' 24250 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 59.0560000000 0.0000000000 -1.0000000000 0.0000000000 102.2879924918 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 7_555 y,x,-z+1/3 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 21.9306666667 4 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+1/3 0.5000000000 -0.8660254038 0.0000000000 59.0560000000 -0.8660254038 -0.5000000000 0.0000000000 102.2879924918 0.0000000000 0.0000000000 -1.0000000000 21.9306666667 # _struct_biol.id 1 _struct_biol.details ;Crystal packing suggests that biological assembly is a tetramer. Other three parts can be generated with symmetry operations (Y,X, 1/3-Z), (1-Y,1-X,1/3-Z) and (1-X,1-Y,Z) ; _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 7 ? ARG A 22 ? THR A 7 ARG A 22 1 ? 16 HELX_P HELX_P2 2 MSE A 25 ? GLN A 37 ? MSE A 25 GLN A 37 1 ? 13 HELX_P HELX_P3 3 PRO A 45 ? LEU A 57 ? PRO A 45 LEU A 57 1 ? 13 HELX_P HELX_P4 4 LYS A 59 ? GLN A 78 ? LYS A 59 GLN A 78 1 ? 20 HELX_P HELX_P5 5 PRO A 84 ? ASP A 92 ? PRO A 84 ASP A 92 1 ? 9 HELX_P HELX_P6 6 GLY A 97 ? ILE A 102 ? GLY A 97 ILE A 102 1 ? 6 HELX_P HELX_P7 7 PRO A 103 ? VAL A 109 ? PRO A 103 VAL A 109 1 ? 7 HELX_P HELX_P8 8 TYR A 110 ? GLU A 124 ? TYR A 110 GLU A 124 1 ? 15 HELX_P HELX_P9 9 GLY A 127 ? LEU A 132 ? GLY A 127 LEU A 132 1 ? 6 HELX_P HELX_P10 10 PHE A 142 ? HIS A 160 ? PHE A 142 HIS A 160 1 ? 19 HELX_P HELX_P11 11 HIS A 160 ? GLN A 166 ? HIS A 160 GLN A 166 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A THR 7 C ? ? ? 1_555 A MSE 8 N ? ? A THR 7 A MSE 8 1_555 ? ? ? ? ? ? ? 1.343 ? ? covale2 covale both ? A MSE 8 C ? ? ? 1_555 A ASN 9 N ? ? A MSE 8 A ASN 9 1_555 ? ? ? ? ? ? ? 1.346 ? ? covale3 covale both ? A GLU 10 C ? ? ? 1_555 A MSE 11 N ? ? A GLU 10 A MSE 11 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale4 covale both ? A MSE 11 C ? ? ? 1_555 A VAL 12 N ? ? A MSE 11 A VAL 12 1_555 ? ? ? ? ? ? ? 1.314 ? ? covale5 covale both ? A ASP 17 C ? ? ? 1_555 A MSE 18 N ? ? A ASP 17 A MSE 18 1_555 ? ? ? ? ? ? ? 1.346 ? ? covale6 covale both ? A MSE 18 C ? ? ? 1_555 A LEU 19 N ? ? A MSE 18 A LEU 19 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale7 covale both ? A VAL 24 C ? ? ? 1_555 A MSE 25 N ? ? A VAL 24 A MSE 25 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale8 covale both ? A MSE 25 C ? ? ? 1_555 A ILE 26 N ? ? A MSE 25 A ILE 26 1_555 ? ? ? ? ? ? ? 1.361 ? ? covale9 covale both ? A CYS 49 C ? ? ? 1_555 A MSE 50 N ? ? A CYS 49 A MSE 50 1_555 ? ? ? ? ? ? ? 1.355 ? ? covale10 covale both ? A MSE 50 C ? ? ? 1_555 A GLU 51 N ? ? A MSE 50 A GLU 51 1_555 ? ? ? ? ? ? ? 1.277 ? ? metalc1 metalc ? ? A TYR 96 O ? ? ? 1_555 B CA . CA ? ? A TYR 96 A CA 190 1_555 ? ? ? ? ? ? ? 2.518 ? ? metalc2 metalc ? ? A ASP 99 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 99 A CA 190 1_555 ? ? ? ? ? ? ? 2.536 ? ? metalc3 metalc ? ? A ASP 99 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 99 A CA 190 1_555 ? ? ? ? ? ? ? 2.571 ? ? metalc4 metalc ? ? A GLU 100 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 100 A CA 190 1_555 ? ? ? ? ? ? ? 2.846 ? ? metalc5 metalc ? ? A GLU 100 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 100 A CA 190 1_555 ? ? ? ? ? ? ? 2.671 ? ? metalc6 metalc ? ? B CA . CA ? ? ? 1_555 C HOH . O ? ? A CA 190 A HOH 198 1_555 ? ? ? ? ? ? ? 2.366 ? ? metalc7 metalc ? ? B CA . CA ? ? ? 1_555 C HOH . O ? ? A CA 190 A HOH 199 1_555 ? ? ? ? ? ? ? 2.659 ? ? metalc8 metalc ? ? B CA . CA ? ? ? 1_555 C HOH . O ? ? A CA 190 A HOH 210 1_555 ? ? ? ? ? ? ? 2.023 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A TYR 96 ? A TYR 96 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 OD1 ? A ASP 99 ? A ASP 99 ? 1_555 125.9 ? 2 O ? A TYR 96 ? A TYR 96 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 OD2 ? A ASP 99 ? A ASP 99 ? 1_555 78.2 ? 3 OD1 ? A ASP 99 ? A ASP 99 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 OD2 ? A ASP 99 ? A ASP 99 ? 1_555 51.1 ? 4 O ? A TYR 96 ? A TYR 96 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 OE1 ? A GLU 100 ? A GLU 100 ? 1_555 81.6 ? 5 OD1 ? A ASP 99 ? A ASP 99 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 OE1 ? A GLU 100 ? A GLU 100 ? 1_555 95.9 ? 6 OD2 ? A ASP 99 ? A ASP 99 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 OE1 ? A GLU 100 ? A GLU 100 ? 1_555 70.6 ? 7 O ? A TYR 96 ? A TYR 96 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 OE2 ? A GLU 100 ? A GLU 100 ? 1_555 130.8 ? 8 OD1 ? A ASP 99 ? A ASP 99 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 OE2 ? A GLU 100 ? A GLU 100 ? 1_555 74.7 ? 9 OD2 ? A ASP 99 ? A ASP 99 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 OE2 ? A GLU 100 ? A GLU 100 ? 1_555 91.5 ? 10 OE1 ? A GLU 100 ? A GLU 100 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 OE2 ? A GLU 100 ? A GLU 100 ? 1_555 50.0 ? 11 O ? A TYR 96 ? A TYR 96 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 O ? C HOH . ? A HOH 198 ? 1_555 85.0 ? 12 OD1 ? A ASP 99 ? A ASP 99 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 O ? C HOH . ? A HOH 198 ? 1_555 148.8 ? 13 OD2 ? A ASP 99 ? A ASP 99 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 O ? C HOH . ? A HOH 198 ? 1_555 150.6 ? 14 OE1 ? A GLU 100 ? A GLU 100 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 O ? C HOH . ? A HOH 198 ? 1_555 83.4 ? 15 OE2 ? A GLU 100 ? A GLU 100 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 O ? C HOH . ? A HOH 198 ? 1_555 81.4 ? 16 O ? A TYR 96 ? A TYR 96 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 O ? C HOH . ? A HOH 199 ? 1_555 83.4 ? 17 OD1 ? A ASP 99 ? A ASP 99 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 O ? C HOH . ? A HOH 199 ? 1_555 84.3 ? 18 OD2 ? A ASP 99 ? A ASP 99 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 O ? C HOH . ? A HOH 199 ? 1_555 96.1 ? 19 OE1 ? A GLU 100 ? A GLU 100 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 O ? C HOH . ? A HOH 199 ? 1_555 161.7 ? 20 OE2 ? A GLU 100 ? A GLU 100 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 O ? C HOH . ? A HOH 199 ? 1_555 145.8 ? 21 O ? C HOH . ? A HOH 198 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 O ? C HOH . ? A HOH 199 ? 1_555 105.8 ? 22 O ? A TYR 96 ? A TYR 96 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 O ? C HOH . ? A HOH 210 ? 1_555 143.9 ? 23 OD1 ? A ASP 99 ? A ASP 99 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 O ? C HOH . ? A HOH 210 ? 1_555 83.2 ? 24 OD2 ? A ASP 99 ? A ASP 99 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 O ? C HOH . ? A HOH 210 ? 1_555 134.3 ? 25 OE1 ? A GLU 100 ? A GLU 100 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 O ? C HOH . ? A HOH 210 ? 1_555 119.9 ? 26 OE2 ? A GLU 100 ? A GLU 100 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 O ? C HOH . ? A HOH 210 ? 1_555 72.6 ? 27 O ? C HOH . ? A HOH 198 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 O ? C HOH . ? A HOH 210 ? 1_555 70.6 ? 28 O ? C HOH . ? A HOH 199 ? 1_555 CA ? B CA . ? A CA 190 ? 1_555 O ? C HOH . ? A HOH 210 ? 1_555 78.4 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 83 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 83 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 84 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 84 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 6.06 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CA _struct_site.pdbx_auth_seq_id 190 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE CA A 190' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 TYR A 96 ? TYR A 96 . ? 1_555 ? 2 AC1 6 ASP A 99 ? ASP A 99 . ? 1_555 ? 3 AC1 6 GLU A 100 ? GLU A 100 . ? 1_555 ? 4 AC1 6 HOH C . ? HOH A 198 . ? 1_555 ? 5 AC1 6 HOH C . ? HOH A 199 . ? 1_555 ? 6 AC1 6 HOH C . ? HOH A 210 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 CG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLN _pdbx_validate_close_contact.auth_seq_id_1 78 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 212 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.10 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CZ A ARG 22 ? ? NH1 A ARG 22 ? ? 1.408 1.326 0.082 0.013 N 2 1 CB A VAL 24 ? ? CG2 A VAL 24 ? ? 1.655 1.524 0.131 0.021 N 3 1 CB A MSE 25 ? ? CG A MSE 25 ? ? 1.721 1.520 0.201 0.030 N 4 1 CG A ARG 31 ? ? CD A ARG 31 ? ? 1.668 1.515 0.153 0.025 N 5 1 CB A VAL 48 ? ? CG1 A VAL 48 ? ? 1.658 1.524 0.134 0.021 N 6 1 CD A GLU 61 ? ? OE1 A GLU 61 ? ? 1.381 1.252 0.129 0.011 N 7 1 CD A GLU 83 ? ? OE1 A GLU 83 ? ? 1.328 1.252 0.076 0.011 N 8 1 CG A TYR 96 ? ? CD2 A TYR 96 ? ? 1.486 1.387 0.099 0.013 N 9 1 CD A GLU 100 ? ? OE2 A GLU 100 ? ? 1.331 1.252 0.079 0.011 N 10 1 C A ASN 108 ? ? O A ASN 108 ? ? 1.400 1.229 0.171 0.019 N 11 1 CE1 A TYR 110 ? ? CZ A TYR 110 ? ? 1.504 1.381 0.123 0.013 N 12 1 CE2 A TYR 110 ? ? CD2 A TYR 110 ? ? 1.523 1.389 0.134 0.015 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG A MSE 8 ? ? SE A MSE 8 ? ? CE A MSE 8 ? ? 82.29 98.90 -16.61 2.20 N 2 1 CG A MSE 18 ? ? SE A MSE 18 ? ? CE A MSE 18 ? ? 83.35 98.90 -15.55 2.20 N 3 1 NE A ARG 22 ? ? CZ A ARG 22 ? ? NH1 A ARG 22 ? ? 126.96 120.30 6.66 0.50 N 4 1 NE A ARG 22 ? ? CZ A ARG 22 ? ? NH2 A ARG 22 ? ? 113.90 120.30 -6.40 0.50 N 5 1 CG A MSE 25 ? ? SE A MSE 25 ? ? CE A MSE 25 ? ? 79.72 98.90 -19.18 2.20 N 6 1 CB A LEU 46 ? ? CG A LEU 46 ? ? CD1 A LEU 46 ? ? 122.25 111.00 11.25 1.70 N 7 1 CB A LEU 57 ? ? CG A LEU 57 ? ? CD2 A LEU 57 ? ? 100.21 111.00 -10.79 1.70 N 8 1 NE A ARG 60 ? ? CZ A ARG 60 ? ? NH1 A ARG 60 ? ? 124.42 120.30 4.12 0.50 N 9 1 NE A ARG 60 ? ? CZ A ARG 60 ? ? NH2 A ARG 60 ? ? 113.82 120.30 -6.48 0.50 N 10 1 CB A ASP 122 ? ? CG A ASP 122 ? ? OD2 A ASP 122 ? ? 123.98 118.30 5.68 0.90 N 11 1 CB A ASP 133 ? ? CG A ASP 133 ? ? OD1 A ASP 133 ? ? 112.23 118.30 -6.07 0.90 N 12 1 CB A ASP 133 ? ? CG A ASP 133 ? ? OD2 A ASP 133 ? ? 128.87 118.30 10.57 0.90 N 13 1 CB A ASP 145 ? ? CG A ASP 145 ? ? OD2 A ASP 145 ? ? 125.22 118.30 6.92 0.90 N 14 1 CG A ARG 157 ? ? CD A ARG 157 ? ? NE A ARG 157 ? ? 96.28 111.80 -15.52 2.10 N 15 1 NE A ARG 157 ? ? CZ A ARG 157 ? ? NH2 A ARG 157 ? ? 114.54 120.30 -5.76 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 41 ? ? -154.17 70.39 2 1 VAL A 53 ? ? -24.98 -55.52 3 1 PRO A 103 ? ? -63.64 0.61 4 1 SER A 135 ? ? 71.28 -167.14 5 1 ASP A 137 ? ? -64.98 13.82 6 1 THR A 161 ? ? -101.26 -73.40 7 1 HIS A 162 ? ? -31.96 -24.88 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLN _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 163 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ASP _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 164 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 145.42 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'New York SGX Research Center for Structural Genomics' _pdbx_SG_project.initial_of_center NYSGXRC # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 8 A MSE 8 ? MET SELENOMETHIONINE 2 A MSE 11 A MSE 11 ? MET SELENOMETHIONINE 3 A MSE 18 A MSE 18 ? MET SELENOMETHIONINE 4 A MSE 25 A MSE 25 ? MET SELENOMETHIONINE 5 A MSE 50 A MSE 50 ? MET SELENOMETHIONINE # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A LYS 4 ? A LYS 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A ASP 167 ? A ASP 167 7 1 Y 1 A GLU 168 ? A GLU 168 8 1 Y 1 A GLU 169 ? A GLU 169 9 1 Y 1 A LYS 170 ? A LYS 170 10 1 Y 1 A GLU 171 ? A GLU 171 11 1 Y 1 A GLN 172 ? A GLN 172 12 1 Y 1 A ASP 173 ? A ASP 173 13 1 Y 1 A GLU 174 ? A GLU 174 14 1 Y 1 A LYS 175 ? A LYS 175 15 1 Y 1 A PRO 176 ? A PRO 176 16 1 Y 1 A VAL 177 ? A VAL 177 17 1 Y 1 A VAL 178 ? A VAL 178 18 1 Y 1 A SER 179 ? A SER 179 19 1 Y 1 A GLU 180 ? A GLU 180 20 1 Y 1 A GLY 181 ? A GLY 181 21 1 Y 1 A GLY 182 ? A GLY 182 22 1 Y 1 A SER 183 ? A SER 183 23 1 Y 1 A HIS 184 ? A HIS 184 24 1 Y 1 A HIS 185 ? A HIS 185 25 1 Y 1 A HIS 186 ? A HIS 186 26 1 Y 1 A HIS 187 ? A HIS 187 27 1 Y 1 A HIS 188 ? A HIS 188 28 1 Y 1 A HIS 189 ? A HIS 189 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 MSE N N N N 251 MSE CA C N S 252 MSE C C N N 253 MSE O O N N 254 MSE OXT O N N 255 MSE CB C N N 256 MSE CG C N N 257 MSE SE SE N N 258 MSE CE C N N 259 MSE H H N N 260 MSE H2 H N N 261 MSE HA H N N 262 MSE HXT H N N 263 MSE HB2 H N N 264 MSE HB3 H N N 265 MSE HG2 H N N 266 MSE HG3 H N N 267 MSE HE1 H N N 268 MSE HE2 H N N 269 MSE HE3 H N N 270 PHE N N N N 271 PHE CA C N S 272 PHE C C N N 273 PHE O O N N 274 PHE CB C N N 275 PHE CG C Y N 276 PHE CD1 C Y N 277 PHE CD2 C Y N 278 PHE CE1 C Y N 279 PHE CE2 C Y N 280 PHE CZ C Y N 281 PHE OXT O N N 282 PHE H H N N 283 PHE H2 H N N 284 PHE HA H N N 285 PHE HB2 H N N 286 PHE HB3 H N N 287 PHE HD1 H N N 288 PHE HD2 H N N 289 PHE HE1 H N N 290 PHE HE2 H N N 291 PHE HZ H N N 292 PHE HXT H N N 293 PRO N N N N 294 PRO CA C N S 295 PRO C C N N 296 PRO O O N N 297 PRO CB C N N 298 PRO CG C N N 299 PRO CD C N N 300 PRO OXT O N N 301 PRO H H N N 302 PRO HA H N N 303 PRO HB2 H N N 304 PRO HB3 H N N 305 PRO HG2 H N N 306 PRO HG3 H N N 307 PRO HD2 H N N 308 PRO HD3 H N N 309 PRO HXT H N N 310 SER N N N N 311 SER CA C N S 312 SER C C N N 313 SER O O N N 314 SER CB C N N 315 SER OG O N N 316 SER OXT O N N 317 SER H H N N 318 SER H2 H N N 319 SER HA H N N 320 SER HB2 H N N 321 SER HB3 H N N 322 SER HG H N N 323 SER HXT H N N 324 THR N N N N 325 THR CA C N S 326 THR C C N N 327 THR O O N N 328 THR CB C N R 329 THR OG1 O N N 330 THR CG2 C N N 331 THR OXT O N N 332 THR H H N N 333 THR H2 H N N 334 THR HA H N N 335 THR HB H N N 336 THR HG1 H N N 337 THR HG21 H N N 338 THR HG22 H N N 339 THR HG23 H N N 340 THR HXT H N N 341 TYR N N N N 342 TYR CA C N S 343 TYR C C N N 344 TYR O O N N 345 TYR CB C N N 346 TYR CG C Y N 347 TYR CD1 C Y N 348 TYR CD2 C Y N 349 TYR CE1 C Y N 350 TYR CE2 C Y N 351 TYR CZ C Y N 352 TYR OH O N N 353 TYR OXT O N N 354 TYR H H N N 355 TYR H2 H N N 356 TYR HA H N N 357 TYR HB2 H N N 358 TYR HB3 H N N 359 TYR HD1 H N N 360 TYR HD2 H N N 361 TYR HE1 H N N 362 TYR HE2 H N N 363 TYR HH H N N 364 TYR HXT H N N 365 VAL N N N N 366 VAL CA C N S 367 VAL C C N N 368 VAL O O N N 369 VAL CB C N N 370 VAL CG1 C N N 371 VAL CG2 C N N 372 VAL OXT O N N 373 VAL H H N N 374 VAL H2 H N N 375 VAL HA H N N 376 VAL HB H N N 377 VAL HG11 H N N 378 VAL HG12 H N N 379 VAL HG13 H N N 380 VAL HG21 H N N 381 VAL HG22 H N N 382 VAL HG23 H N N 383 VAL HXT H N N 384 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 MSE N CA sing N N 237 MSE N H sing N N 238 MSE N H2 sing N N 239 MSE CA C sing N N 240 MSE CA CB sing N N 241 MSE CA HA sing N N 242 MSE C O doub N N 243 MSE C OXT sing N N 244 MSE OXT HXT sing N N 245 MSE CB CG sing N N 246 MSE CB HB2 sing N N 247 MSE CB HB3 sing N N 248 MSE CG SE sing N N 249 MSE CG HG2 sing N N 250 MSE CG HG3 sing N N 251 MSE SE CE sing N N 252 MSE CE HE1 sing N N 253 MSE CE HE2 sing N N 254 MSE CE HE3 sing N N 255 PHE N CA sing N N 256 PHE N H sing N N 257 PHE N H2 sing N N 258 PHE CA C sing N N 259 PHE CA CB sing N N 260 PHE CA HA sing N N 261 PHE C O doub N N 262 PHE C OXT sing N N 263 PHE CB CG sing N N 264 PHE CB HB2 sing N N 265 PHE CB HB3 sing N N 266 PHE CG CD1 doub Y N 267 PHE CG CD2 sing Y N 268 PHE CD1 CE1 sing Y N 269 PHE CD1 HD1 sing N N 270 PHE CD2 CE2 doub Y N 271 PHE CD2 HD2 sing N N 272 PHE CE1 CZ doub Y N 273 PHE CE1 HE1 sing N N 274 PHE CE2 CZ sing Y N 275 PHE CE2 HE2 sing N N 276 PHE CZ HZ sing N N 277 PHE OXT HXT sing N N 278 PRO N CA sing N N 279 PRO N CD sing N N 280 PRO N H sing N N 281 PRO CA C sing N N 282 PRO CA CB sing N N 283 PRO CA HA sing N N 284 PRO C O doub N N 285 PRO C OXT sing N N 286 PRO CB CG sing N N 287 PRO CB HB2 sing N N 288 PRO CB HB3 sing N N 289 PRO CG CD sing N N 290 PRO CG HG2 sing N N 291 PRO CG HG3 sing N N 292 PRO CD HD2 sing N N 293 PRO CD HD3 sing N N 294 PRO OXT HXT sing N N 295 SER N CA sing N N 296 SER N H sing N N 297 SER N H2 sing N N 298 SER CA C sing N N 299 SER CA CB sing N N 300 SER CA HA sing N N 301 SER C O doub N N 302 SER C OXT sing N N 303 SER CB OG sing N N 304 SER CB HB2 sing N N 305 SER CB HB3 sing N N 306 SER OG HG sing N N 307 SER OXT HXT sing N N 308 THR N CA sing N N 309 THR N H sing N N 310 THR N H2 sing N N 311 THR CA C sing N N 312 THR CA CB sing N N 313 THR CA HA sing N N 314 THR C O doub N N 315 THR C OXT sing N N 316 THR CB OG1 sing N N 317 THR CB CG2 sing N N 318 THR CB HB sing N N 319 THR OG1 HG1 sing N N 320 THR CG2 HG21 sing N N 321 THR CG2 HG22 sing N N 322 THR CG2 HG23 sing N N 323 THR OXT HXT sing N N 324 TYR N CA sing N N 325 TYR N H sing N N 326 TYR N H2 sing N N 327 TYR CA C sing N N 328 TYR CA CB sing N N 329 TYR CA HA sing N N 330 TYR C O doub N N 331 TYR C OXT sing N N 332 TYR CB CG sing N N 333 TYR CB HB2 sing N N 334 TYR CB HB3 sing N N 335 TYR CG CD1 doub Y N 336 TYR CG CD2 sing Y N 337 TYR CD1 CE1 sing Y N 338 TYR CD1 HD1 sing N N 339 TYR CD2 CE2 doub Y N 340 TYR CD2 HD2 sing N N 341 TYR CE1 CZ doub Y N 342 TYR CE1 HE1 sing N N 343 TYR CE2 CZ sing Y N 344 TYR CE2 HE2 sing N N 345 TYR CZ OH sing N N 346 TYR OH HH sing N N 347 TYR OXT HXT sing N N 348 VAL N CA sing N N 349 VAL N H sing N N 350 VAL N H2 sing N N 351 VAL CA C sing N N 352 VAL CA CB sing N N 353 VAL CA HA sing N N 354 VAL C O doub N N 355 VAL C OXT sing N N 356 VAL CB CG1 sing N N 357 VAL CB CG2 sing N N 358 VAL CB HB sing N N 359 VAL CG1 HG11 sing N N 360 VAL CG1 HG12 sing N N 361 VAL CG1 HG13 sing N N 362 VAL CG2 HG21 sing N N 363 VAL CG2 HG22 sing N N 364 VAL CG2 HG23 sing N N 365 VAL OXT HXT sing N N 366 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details 'Experimental electron density from Selenium SAD experiment.' # _atom_sites.entry_id 1TLQ _atom_sites.fract_transf_matrix[1][1] 0.008467 _atom_sites.fract_transf_matrix[1][2] 0.004888 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009776 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015199 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S SE # loop_