data_1TOF # _entry.id 1TOF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1TOF pdb_00001tof 10.2210/pdb1tof/pdb WWPDB D_1000176768 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-12-07 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1TOF _pdbx_database_status.recvd_initial_deposition_date 1996-05-30 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mittard, V.' 1 'Blackledge, M.J.' 2 'Stein, M.' 3 'Jacquot, J.-P.' 4 'Marion, D.' 5 'Lancelin, J.-M.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'NMR solution structure of an oxidised thioredoxin h from the eukaryotic green alga Chlamydomonas reinhardtii.' Eur.J.Biochem. 243 374 383 1997 EJBCAI IX 0014-2956 0262 ? 9030762 10.1111/j.1432-1033.1997.0374a.x 1 ;Chlamydomonas Reinhardtii Thioredoxins: Structure of the Genes Coding for the Chloroplastic M and Cytosolic H Isoforms; Expression in Escherichia Coli of the Recombinant Proteins, Purification and Biochemical Properties ; 'Plant Mol.Biol.' 28 487 ? 1995 PMBIDB NE 0167-4412 2006 ? ? ? 2 ;1H, 13C, 15N-NMR Resonance Assignments of Oxidized Thioredoxin H from the Eukaryotic Green Alga Chlamydomonas Reinhardtii Using New Methods Based on Two-Dimensional Triple-Resonance NMR Spectroscopy and Computer-Assisted Backbone Assignment ; Eur.J.Biochem. 229 473 ? 1995 EJBCAI IX 0014-2956 0262 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mittard, V.' 1 ? primary 'Blackledge, M.J.' 2 ? primary 'Stein, M.' 3 ? primary 'Jacquot, J.P.' 4 ? primary 'Marion, D.' 5 ? primary 'Lancelin, J.M.' 6 ? 1 'Stein, M.' 7 ? 1 'Jacquot, J.P.' 8 ? 1 'Jeannette, E.' 9 ? 1 'Decottignies, P.' 10 ? 1 'Hodges, M.' 11 ? 1 'Lancelin, J.M.' 12 ? 1 'Mittard, V.' 13 ? 1 'Schmitter, J.M.' 14 ? 1 'Miginiac-Maslow, M.' 15 ? 2 'Mittard, V.' 16 ? 2 'Morelle, N.' 17 ? 2 'Brutscher, B.' 18 ? 2 'Simorre, J.P.' 19 ? 2 'Marion, D.' 20 ? 2 'Stein, M.' 21 ? 2 'Jacquot, J.P.' 22 ? 2 'Lirsac, P.N.' 23 ? 2 'Lancelin, J.M.' 24 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'THIOREDOXIN H' _entity.formula_weight 11727.534 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HTRX, HCH1, CH1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVDAVAAVAEAAGITAMP TFHVYKDGVKADDLVGASQDKLKALVAKHAAA ; _entity_poly.pdbx_seq_one_letter_code_can ;GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVDAVAAVAEAAGITAMP TFHVYKDGVKADDLVGASQDKLKALVAKHAAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 SER n 1 4 VAL n 1 5 ILE n 1 6 VAL n 1 7 ILE n 1 8 ASP n 1 9 SER n 1 10 LYS n 1 11 ALA n 1 12 ALA n 1 13 TRP n 1 14 ASP n 1 15 ALA n 1 16 GLN n 1 17 LEU n 1 18 ALA n 1 19 LYS n 1 20 GLY n 1 21 LYS n 1 22 GLU n 1 23 GLU n 1 24 HIS n 1 25 LYS n 1 26 PRO n 1 27 ILE n 1 28 VAL n 1 29 VAL n 1 30 ASP n 1 31 PHE n 1 32 THR n 1 33 ALA n 1 34 THR n 1 35 TRP n 1 36 CYS n 1 37 GLY n 1 38 PRO n 1 39 CYS n 1 40 LYS n 1 41 MET n 1 42 ILE n 1 43 ALA n 1 44 PRO n 1 45 LEU n 1 46 PHE n 1 47 GLU n 1 48 THR n 1 49 LEU n 1 50 SER n 1 51 ASN n 1 52 ASP n 1 53 TYR n 1 54 ALA n 1 55 GLY n 1 56 LYS n 1 57 VAL n 1 58 ILE n 1 59 PHE n 1 60 LEU n 1 61 LYS n 1 62 VAL n 1 63 ASP n 1 64 VAL n 1 65 ASP n 1 66 ALA n 1 67 VAL n 1 68 ALA n 1 69 ALA n 1 70 VAL n 1 71 ALA n 1 72 GLU n 1 73 ALA n 1 74 ALA n 1 75 GLY n 1 76 ILE n 1 77 THR n 1 78 ALA n 1 79 MET n 1 80 PRO n 1 81 THR n 1 82 PHE n 1 83 HIS n 1 84 VAL n 1 85 TYR n 1 86 LYS n 1 87 ASP n 1 88 GLY n 1 89 VAL n 1 90 LYS n 1 91 ALA n 1 92 ASP n 1 93 ASP n 1 94 LEU n 1 95 VAL n 1 96 GLY n 1 97 ALA n 1 98 SER n 1 99 GLN n 1 100 ASP n 1 101 LYS n 1 102 LEU n 1 103 LYS n 1 104 ALA n 1 105 LEU n 1 106 VAL n 1 107 ALA n 1 108 LYS n 1 109 HIS n 1 110 ALA n 1 111 ALA n 1 112 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Chlamydomonas _entity_src_gen.pdbx_gene_src_gene 'THIOREDOXIN H CDNA (X78822 EMB' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain CW15 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Chlamydomonas reinhardtii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3055 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location CYTOPLASM _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene 'THIOREDOXIN H CDNA (X78822,EMBL)' _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-3D _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 TRP 13 13 13 TRP TRP A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 TRP 35 35 35 TRP TRP A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 MET 41 41 41 MET MET A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 ALA 112 112 112 ALA ALA A . n # _cell.entry_id 1TOF _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1TOF _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1TOF _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1TOF _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1TOF _struct.title 'THIOREDOXIN H (OXIDIZED FORM), NMR, 23 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1TOF _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'OXIDOREDUCTASE, ELECTRON TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRXH_CHLRE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P80028 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVDAVAAVAEAAGITAMP TFHVYKDGVKADDLVGASQDKLKALVAKHAAA ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1TOF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 112 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P80028 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 112 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 112 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 10 ? LYS A 19 ? LYS A 10 LYS A 19 1 ? 10 HELX_P HELX_P2 2 GLU A 22 ? HIS A 24 ? GLU A 22 HIS A 24 5 ? 3 HELX_P HELX_P3 3 GLY A 37 ? ASP A 52 ? GLY A 37 ASP A 52 5 ? 16 HELX_P HELX_P4 4 ALA A 68 ? ALA A 74 ? ALA A 68 ALA A 74 1 ? 7 HELX_P HELX_P5 5 GLN A 99 ? ALA A 110 ? GLN A 99 ALA A 110 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 36 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 39 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 36 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 39 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.078 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 36 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 39 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 36 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 39 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 1 -0.41 2 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 2 -0.54 3 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 3 -1.30 4 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 4 -1.10 5 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 5 1.92 6 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 6 0.82 7 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 7 -2.15 8 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 8 -3.33 9 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 9 0.58 10 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 10 -2.05 11 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 11 -1.26 12 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 12 -1.92 13 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 13 0.01 14 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 14 -3.60 15 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 15 -0.85 16 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 16 -2.02 17 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 17 -1.14 18 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 18 -1.07 19 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 19 -2.71 20 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 20 -1.79 21 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 21 -0.61 22 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 22 -1.66 23 MET 79 A . ? MET 79 A PRO 80 A ? PRO 80 A 23 -1.01 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 58 ? ASP A 63 ? ILE A 58 ASP A 63 A 2 ILE A 27 ? THR A 32 ? ILE A 27 THR A 32 A 3 THR A 81 ? VAL A 84 ? THR A 81 VAL A 84 A 4 ASP A 92 ? VAL A 95 ? ASP A 92 VAL A 95 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 58 ? O ILE A 58 N VAL A 28 ? N VAL A 28 A 2 3 O VAL A 29 ? O VAL A 29 N HIS A 83 ? N HIS A 83 A 3 4 O PHE A 82 ? O PHE A 82 N LEU A 94 ? N LEU A 94 # _struct_site.id ACT _struct_site.pdbx_evidence_code Unknown _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'SSBOND AT REDOX-ACTIVE CENTER.' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 ACT 5 TRP A 35 ? TRP A 35 . ? 1_555 ? 2 ACT 5 CYS A 36 ? CYS A 36 . ? 1_555 ? 3 ACT 5 GLY A 37 ? GLY A 37 . ? 1_555 ? 4 ACT 5 PRO A 38 ? PRO A 38 . ? 1_555 ? 5 ACT 5 CYS A 39 ? CYS A 39 . ? 1_555 ? # _pdbx_entry_details.entry_id 1TOF _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 5 CA A CYS 36 ? ? CB A CYS 36 ? ? SG A CYS 36 ? ? 121.50 114.20 7.30 1.10 N 2 12 CA A CYS 36 ? ? CB A CYS 36 ? ? SG A CYS 36 ? ? 121.58 114.20 7.38 1.10 N 3 17 C A GLY 37 ? ? N A PRO 38 ? ? CD A PRO 38 ? ? 115.21 128.40 -13.19 2.10 Y 4 17 CA A PRO 38 ? ? N A PRO 38 ? ? CD A PRO 38 ? ? 101.72 111.70 -9.98 1.40 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 4 ? ? -78.60 35.98 2 1 GLU A 23 ? ? -15.05 -59.79 3 1 THR A 34 ? ? -71.25 -70.11 4 1 PRO A 38 ? ? -39.81 -39.44 5 1 ALA A 66 ? ? -92.80 -62.31 6 1 THR A 77 ? ? -136.00 -83.72 7 1 ASP A 87 ? ? 72.98 -54.84 8 1 LYS A 90 ? ? -46.73 91.07 9 1 LEU A 94 ? ? -162.11 114.83 10 1 SER A 98 ? ? 35.11 50.41 11 2 LYS A 21 ? ? 62.92 63.10 12 2 HIS A 24 ? ? -154.16 19.23 13 2 ALA A 54 ? ? 36.05 -125.44 14 2 THR A 77 ? ? -113.51 -74.92 15 2 LYS A 90 ? ? -60.00 103.01 16 2 ALA A 97 ? ? -76.89 46.16 17 3 ASP A 8 ? ? -134.32 -38.33 18 3 GLU A 22 ? ? -67.91 64.15 19 3 HIS A 24 ? ? 68.04 72.81 20 3 THR A 77 ? ? -139.84 -78.95 21 3 ASP A 87 ? ? 67.00 -59.81 22 3 LYS A 90 ? ? -62.96 98.64 23 3 ALA A 97 ? ? -78.62 42.79 24 4 SER A 9 ? ? -14.13 110.81 25 4 ALA A 18 ? ? -106.19 -60.23 26 4 GLU A 22 ? ? -73.55 43.36 27 4 THR A 32 ? ? -116.14 -165.11 28 4 LYS A 56 ? ? -71.81 38.45 29 4 ALA A 66 ? ? -96.00 -61.42 30 4 THR A 77 ? ? -136.75 -82.25 31 4 ASP A 87 ? ? 62.46 -64.02 32 4 LYS A 90 ? ? -57.51 106.08 33 4 SER A 98 ? ? -157.59 80.27 34 5 SER A 3 ? ? -68.06 78.47 35 5 SER A 9 ? ? -37.12 105.71 36 5 GLU A 23 ? ? -22.57 -66.63 37 5 THR A 34 ? ? -25.67 -47.99 38 5 ASP A 63 ? ? -69.90 86.20 39 5 ALA A 66 ? ? -84.78 -70.80 40 5 THR A 77 ? ? -101.34 -71.41 41 5 ASP A 87 ? ? 67.26 -63.12 42 5 SER A 98 ? ? -163.85 108.13 43 5 ALA A 111 ? ? -91.31 -105.32 44 6 ASP A 8 ? ? -145.01 56.13 45 6 LYS A 21 ? ? 66.08 73.75 46 6 GLU A 22 ? ? -71.06 49.44 47 6 HIS A 24 ? ? -152.96 24.61 48 6 PRO A 38 ? ? -39.58 -37.82 49 6 ALA A 66 ? ? -91.18 -75.32 50 6 THR A 77 ? ? -93.21 -75.98 51 6 ASP A 87 ? ? 68.18 -58.92 52 6 LYS A 90 ? ? -60.87 95.29 53 6 LEU A 94 ? ? 167.01 142.82 54 6 ALA A 97 ? ? -75.48 43.61 55 6 ALA A 111 ? ? 63.15 -126.47 56 7 VAL A 6 ? ? -161.43 64.51 57 7 ASP A 8 ? ? -162.61 -44.22 58 7 GLU A 22 ? ? -31.76 -34.50 59 7 GLU A 23 ? ? -12.65 -70.75 60 7 PRO A 26 ? ? -67.70 91.60 61 7 TYR A 53 ? ? -102.69 44.68 62 7 ALA A 54 ? ? -76.81 43.29 63 7 LYS A 56 ? ? -80.44 45.07 64 7 THR A 77 ? ? -136.39 -88.67 65 7 ASP A 87 ? ? 68.28 -58.87 66 7 LYS A 90 ? ? -60.68 96.70 67 7 ALA A 97 ? ? -76.42 41.77 68 8 ILE A 7 ? ? -160.82 -160.63 69 8 ASP A 8 ? ? -157.19 -56.90 70 8 SER A 9 ? ? -31.06 118.38 71 8 LYS A 21 ? ? 58.76 76.63 72 8 HIS A 24 ? ? -170.39 65.64 73 8 ALA A 54 ? ? 70.78 -173.34 74 8 THR A 77 ? ? -124.51 -84.94 75 8 ASP A 87 ? ? 69.18 -64.11 76 8 LYS A 90 ? ? -55.99 101.87 77 8 ALA A 97 ? ? -76.67 38.37 78 9 SER A 9 ? ? 29.73 -119.15 79 9 GLU A 22 ? ? -63.39 24.60 80 9 THR A 32 ? ? -113.36 -167.71 81 9 THR A 34 ? ? -99.28 -65.06 82 9 ALA A 54 ? ? 61.70 -63.72 83 9 LYS A 56 ? ? -76.61 48.70 84 9 THR A 77 ? ? -136.58 -70.11 85 9 ASP A 87 ? ? 74.51 -58.28 86 9 LYS A 90 ? ? -56.42 106.15 87 9 ALA A 97 ? ? -76.44 40.99 88 10 VAL A 6 ? ? -150.44 -158.72 89 10 LYS A 21 ? ? 51.44 70.82 90 10 GLU A 23 ? ? -109.18 -66.38 91 10 HIS A 24 ? ? -161.40 17.85 92 10 CYS A 36 ? ? 69.39 -62.25 93 10 ALA A 54 ? ? 60.11 -70.16 94 10 ALA A 66 ? ? -76.37 -70.21 95 10 THR A 77 ? ? -137.30 -70.72 96 10 ASP A 87 ? ? 70.46 -68.69 97 10 ALA A 97 ? ? -77.34 39.18 98 10 ALA A 111 ? ? 53.10 -119.56 99 11 LYS A 21 ? ? 60.68 67.33 100 11 THR A 77 ? ? -136.25 -74.03 101 11 ASP A 87 ? ? 69.59 -63.62 102 11 LYS A 90 ? ? -60.01 94.70 103 11 LEU A 94 ? ? 165.82 147.73 104 11 ALA A 97 ? ? -76.10 35.92 105 11 ALA A 111 ? ? 70.14 -59.31 106 12 LYS A 21 ? ? 76.53 84.49 107 12 GLU A 23 ? ? -94.62 -61.25 108 12 HIS A 24 ? ? -168.10 8.04 109 12 ALA A 33 ? ? -98.10 56.58 110 12 THR A 34 ? ? 6.89 -74.38 111 12 THR A 77 ? ? -98.37 -84.54 112 12 ASP A 87 ? ? 70.84 -66.99 113 12 LYS A 90 ? ? -45.61 90.98 114 12 LEU A 94 ? ? -162.52 115.46 115 12 SER A 98 ? ? 23.16 57.83 116 12 ALA A 110 ? ? -79.00 47.97 117 13 SER A 3 ? ? -71.62 48.56 118 13 GLU A 22 ? ? -62.40 37.18 119 13 GLU A 23 ? ? -60.10 -76.37 120 13 LYS A 56 ? ? -69.72 36.62 121 13 ALA A 66 ? ? -99.60 -71.86 122 13 THR A 77 ? ? -131.03 -78.67 123 13 ASP A 87 ? ? 69.67 -60.19 124 13 LYS A 90 ? ? -39.83 97.34 125 13 ALA A 97 ? ? -77.72 40.85 126 13 ALA A 110 ? ? -83.83 41.86 127 14 SER A 3 ? ? -78.48 46.39 128 14 ASP A 8 ? ? -165.34 -49.60 129 14 SER A 9 ? ? -35.57 114.99 130 14 ALA A 18 ? ? -109.33 -63.12 131 14 LYS A 21 ? ? 67.81 64.88 132 14 HIS A 24 ? ? -160.53 75.25 133 14 TYR A 53 ? ? -81.11 38.31 134 14 THR A 77 ? ? -127.24 -81.42 135 14 ASP A 87 ? ? 70.58 -56.11 136 14 LYS A 90 ? ? -62.29 94.93 137 14 LEU A 94 ? ? -178.09 138.55 138 14 ALA A 97 ? ? 49.62 -108.57 139 15 SER A 9 ? ? -59.42 72.86 140 15 LYS A 10 ? ? -92.94 -66.91 141 15 GLU A 22 ? ? -69.40 46.12 142 15 THR A 32 ? ? -127.21 -150.97 143 15 THR A 77 ? ? -134.15 -80.35 144 15 VAL A 89 ? ? 24.45 -139.54 145 15 LYS A 90 ? ? -54.12 85.14 146 15 LEU A 94 ? ? -172.39 103.90 147 15 ALA A 97 ? ? -78.45 45.34 148 15 ALA A 110 ? ? -82.58 42.67 149 16 SER A 9 ? ? -32.86 113.17 150 16 GLU A 22 ? ? -68.64 62.51 151 16 GLU A 23 ? ? -116.92 -93.16 152 16 HIS A 24 ? ? -113.67 73.48 153 16 THR A 34 ? ? -96.80 -66.49 154 16 ALA A 54 ? ? 60.97 -64.64 155 16 ALA A 66 ? ? -71.03 -70.91 156 16 THR A 77 ? ? -92.10 -72.58 157 16 TYR A 85 ? ? -110.81 76.36 158 16 VAL A 89 ? ? 67.18 -154.83 159 16 LYS A 90 ? ? -64.29 79.53 160 16 ALA A 97 ? ? -79.01 44.84 161 17 ILE A 7 ? ? -160.58 -41.31 162 17 LYS A 21 ? ? 103.64 81.25 163 17 CYS A 36 ? ? 176.20 133.13 164 17 PRO A 38 ? ? 50.91 -29.51 165 17 ALA A 54 ? ? 18.77 73.89 166 17 LYS A 56 ? ? -76.46 46.29 167 17 ALA A 66 ? ? -92.46 -65.80 168 17 THR A 77 ? ? -131.92 -96.11 169 17 TYR A 85 ? ? -92.68 52.83 170 17 ASP A 87 ? ? 74.85 -62.19 171 17 LYS A 90 ? ? -60.54 91.23 172 17 LEU A 94 ? ? -172.39 108.08 173 18 SER A 3 ? ? -66.49 71.99 174 18 VAL A 4 ? ? -142.57 31.64 175 18 SER A 9 ? ? -38.06 130.11 176 18 HIS A 24 ? ? -163.37 22.81 177 18 TRP A 35 ? ? -59.43 74.70 178 18 CYS A 36 ? ? 170.72 -21.58 179 18 ALA A 54 ? ? 59.91 -73.37 180 18 LYS A 56 ? ? -69.88 19.43 181 18 THR A 77 ? ? -153.64 -57.53 182 18 ASP A 87 ? ? 69.28 -64.78 183 18 LYS A 90 ? ? -50.28 97.46 184 18 LEU A 94 ? ? -164.96 106.18 185 18 VAL A 95 ? ? -85.56 32.07 186 18 ALA A 97 ? ? -74.92 38.55 187 18 ALA A 111 ? ? -77.95 48.72 188 19 SER A 3 ? ? -68.55 69.56 189 19 ASP A 14 ? ? -106.06 -72.62 190 19 HIS A 24 ? ? -163.48 22.59 191 19 PRO A 26 ? ? -69.81 92.39 192 19 ASP A 65 ? ? 177.69 -71.65 193 19 THR A 77 ? ? -124.52 -85.08 194 19 VAL A 89 ? ? 20.89 -134.66 195 19 LYS A 90 ? ? -58.18 79.06 196 19 SER A 98 ? ? 33.49 21.34 197 19 ALA A 111 ? ? -78.91 49.56 198 20 SER A 3 ? ? -64.46 96.31 199 20 SER A 9 ? ? -55.56 71.98 200 20 LYS A 10 ? ? -93.78 -94.86 201 20 GLU A 22 ? ? -38.75 -31.57 202 20 GLU A 23 ? ? -9.06 -74.09 203 20 ALA A 54 ? ? 64.91 -56.03 204 20 ALA A 66 ? ? -81.65 -72.25 205 20 THR A 77 ? ? -112.31 -76.79 206 20 TYR A 85 ? ? -115.21 60.78 207 20 ASP A 87 ? ? 72.72 -52.88 208 20 LYS A 90 ? ? -56.64 104.01 209 20 LEU A 94 ? ? -162.54 110.85 210 20 SER A 98 ? ? 30.82 46.77 211 21 SER A 3 ? ? -68.47 78.26 212 21 GLU A 22 ? ? -78.64 40.00 213 21 GLU A 23 ? ? -15.20 -63.08 214 21 HIS A 24 ? ? -142.74 23.14 215 21 CYS A 36 ? ? 136.24 -59.72 216 21 ALA A 54 ? ? -19.37 -61.85 217 21 ALA A 66 ? ? -97.76 -65.87 218 21 THR A 77 ? ? -140.18 -76.65 219 21 ASP A 87 ? ? 69.71 -64.03 220 21 ALA A 97 ? ? -77.32 43.35 221 22 ALA A 18 ? ? -102.47 -68.38 222 22 GLU A 23 ? ? -10.24 -65.80 223 22 HIS A 24 ? ? -146.39 57.27 224 22 THR A 32 ? ? -166.12 -159.79 225 22 ALA A 33 ? ? 64.10 -135.27 226 22 THR A 34 ? ? 54.61 -107.43 227 22 ALA A 54 ? ? -21.45 110.48 228 22 THR A 77 ? ? -148.90 -80.24 229 22 ASP A 87 ? ? 71.40 -60.02 230 22 ALA A 97 ? ? -76.73 44.24 231 23 SER A 3 ? ? -51.69 105.81 232 23 SER A 9 ? ? -38.13 117.59 233 23 LYS A 21 ? ? 57.55 73.02 234 23 THR A 32 ? ? -127.47 -162.39 235 23 CYS A 36 ? ? -97.24 35.34 236 23 ALA A 66 ? ? -97.96 -72.40 237 23 THR A 77 ? ? -119.89 -109.39 238 23 LYS A 86 ? ? -90.82 -100.20 239 23 ALA A 97 ? ? -82.98 -80.00 240 23 SER A 98 ? ? 36.11 57.90 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 PHE A 46 ? ? 0.109 'SIDE CHAIN' 2 1 TYR A 85 ? ? 0.076 'SIDE CHAIN' 3 2 PHE A 31 ? ? 0.108 'SIDE CHAIN' 4 2 TYR A 85 ? ? 0.084 'SIDE CHAIN' 5 3 PHE A 31 ? ? 0.081 'SIDE CHAIN' 6 3 TYR A 53 ? ? 0.109 'SIDE CHAIN' 7 3 TYR A 85 ? ? 0.092 'SIDE CHAIN' 8 4 TYR A 53 ? ? 0.137 'SIDE CHAIN' 9 5 PHE A 46 ? ? 0.079 'SIDE CHAIN' 10 5 PHE A 59 ? ? 0.088 'SIDE CHAIN' 11 6 PHE A 31 ? ? 0.117 'SIDE CHAIN' 12 7 PHE A 31 ? ? 0.074 'SIDE CHAIN' 13 7 PHE A 46 ? ? 0.105 'SIDE CHAIN' 14 7 TYR A 53 ? ? 0.144 'SIDE CHAIN' 15 7 TYR A 85 ? ? 0.083 'SIDE CHAIN' 16 8 PHE A 59 ? ? 0.127 'SIDE CHAIN' 17 9 PHE A 31 ? ? 0.094 'SIDE CHAIN' 18 9 TYR A 53 ? ? 0.078 'SIDE CHAIN' 19 9 PHE A 59 ? ? 0.103 'SIDE CHAIN' 20 10 PHE A 31 ? ? 0.122 'SIDE CHAIN' 21 10 PHE A 59 ? ? 0.091 'SIDE CHAIN' 22 10 TYR A 85 ? ? 0.077 'SIDE CHAIN' 23 11 PHE A 31 ? ? 0.113 'SIDE CHAIN' 24 11 PHE A 46 ? ? 0.084 'SIDE CHAIN' 25 11 TYR A 53 ? ? 0.096 'SIDE CHAIN' 26 11 TYR A 85 ? ? 0.070 'SIDE CHAIN' 27 12 PHE A 31 ? ? 0.111 'SIDE CHAIN' 28 12 TYR A 53 ? ? 0.162 'SIDE CHAIN' 29 12 PHE A 59 ? ? 0.096 'SIDE CHAIN' 30 12 TYR A 85 ? ? 0.100 'SIDE CHAIN' 31 13 PHE A 46 ? ? 0.076 'SIDE CHAIN' 32 13 PHE A 82 ? ? 0.078 'SIDE CHAIN' 33 14 PHE A 31 ? ? 0.102 'SIDE CHAIN' 34 14 TYR A 53 ? ? 0.121 'SIDE CHAIN' 35 14 TYR A 85 ? ? 0.070 'SIDE CHAIN' 36 15 PHE A 31 ? ? 0.089 'SIDE CHAIN' 37 15 TYR A 53 ? ? 0.128 'SIDE CHAIN' 38 15 TYR A 85 ? ? 0.085 'SIDE CHAIN' 39 16 PHE A 31 ? ? 0.107 'SIDE CHAIN' 40 16 PHE A 46 ? ? 0.098 'SIDE CHAIN' 41 16 PHE A 59 ? ? 0.110 'SIDE CHAIN' 42 17 PHE A 59 ? ? 0.089 'SIDE CHAIN' 43 17 TYR A 85 ? ? 0.064 'SIDE CHAIN' 44 18 TYR A 85 ? ? 0.071 'SIDE CHAIN' 45 19 PHE A 31 ? ? 0.087 'SIDE CHAIN' 46 19 TYR A 53 ? ? 0.086 'SIDE CHAIN' 47 20 PHE A 46 ? ? 0.086 'SIDE CHAIN' 48 20 TYR A 85 ? ? 0.085 'SIDE CHAIN' 49 21 PHE A 31 ? ? 0.093 'SIDE CHAIN' 50 22 PHE A 31 ? ? 0.114 'SIDE CHAIN' 51 22 PHE A 59 ? ? 0.110 'SIDE CHAIN' 52 23 PHE A 46 ? ? 0.102 'SIDE CHAIN' 53 23 PHE A 59 ? ? 0.109 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1TOF _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 23 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name Discover _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BIOSYM _pdbx_nmr_software.ordinal 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 LYS N N N N 175 LYS CA C N S 176 LYS C C N N 177 LYS O O N N 178 LYS CB C N N 179 LYS CG C N N 180 LYS CD C N N 181 LYS CE C N N 182 LYS NZ N N N 183 LYS OXT O N N 184 LYS H H N N 185 LYS H2 H N N 186 LYS HA H N N 187 LYS HB2 H N N 188 LYS HB3 H N N 189 LYS HG2 H N N 190 LYS HG3 H N N 191 LYS HD2 H N N 192 LYS HD3 H N N 193 LYS HE2 H N N 194 LYS HE3 H N N 195 LYS HZ1 H N N 196 LYS HZ2 H N N 197 LYS HZ3 H N N 198 LYS HXT H N N 199 MET N N N N 200 MET CA C N S 201 MET C C N N 202 MET O O N N 203 MET CB C N N 204 MET CG C N N 205 MET SD S N N 206 MET CE C N N 207 MET OXT O N N 208 MET H H N N 209 MET H2 H N N 210 MET HA H N N 211 MET HB2 H N N 212 MET HB3 H N N 213 MET HG2 H N N 214 MET HG3 H N N 215 MET HE1 H N N 216 MET HE2 H N N 217 MET HE3 H N N 218 MET HXT H N N 219 PHE N N N N 220 PHE CA C N S 221 PHE C C N N 222 PHE O O N N 223 PHE CB C N N 224 PHE CG C Y N 225 PHE CD1 C Y N 226 PHE CD2 C Y N 227 PHE CE1 C Y N 228 PHE CE2 C Y N 229 PHE CZ C Y N 230 PHE OXT O N N 231 PHE H H N N 232 PHE H2 H N N 233 PHE HA H N N 234 PHE HB2 H N N 235 PHE HB3 H N N 236 PHE HD1 H N N 237 PHE HD2 H N N 238 PHE HE1 H N N 239 PHE HE2 H N N 240 PHE HZ H N N 241 PHE HXT H N N 242 PRO N N N N 243 PRO CA C N S 244 PRO C C N N 245 PRO O O N N 246 PRO CB C N N 247 PRO CG C N N 248 PRO CD C N N 249 PRO OXT O N N 250 PRO H H N N 251 PRO HA H N N 252 PRO HB2 H N N 253 PRO HB3 H N N 254 PRO HG2 H N N 255 PRO HG3 H N N 256 PRO HD2 H N N 257 PRO HD3 H N N 258 PRO HXT H N N 259 SER N N N N 260 SER CA C N S 261 SER C C N N 262 SER O O N N 263 SER CB C N N 264 SER OG O N N 265 SER OXT O N N 266 SER H H N N 267 SER H2 H N N 268 SER HA H N N 269 SER HB2 H N N 270 SER HB3 H N N 271 SER HG H N N 272 SER HXT H N N 273 THR N N N N 274 THR CA C N S 275 THR C C N N 276 THR O O N N 277 THR CB C N R 278 THR OG1 O N N 279 THR CG2 C N N 280 THR OXT O N N 281 THR H H N N 282 THR H2 H N N 283 THR HA H N N 284 THR HB H N N 285 THR HG1 H N N 286 THR HG21 H N N 287 THR HG22 H N N 288 THR HG23 H N N 289 THR HXT H N N 290 TRP N N N N 291 TRP CA C N S 292 TRP C C N N 293 TRP O O N N 294 TRP CB C N N 295 TRP CG C Y N 296 TRP CD1 C Y N 297 TRP CD2 C Y N 298 TRP NE1 N Y N 299 TRP CE2 C Y N 300 TRP CE3 C Y N 301 TRP CZ2 C Y N 302 TRP CZ3 C Y N 303 TRP CH2 C Y N 304 TRP OXT O N N 305 TRP H H N N 306 TRP H2 H N N 307 TRP HA H N N 308 TRP HB2 H N N 309 TRP HB3 H N N 310 TRP HD1 H N N 311 TRP HE1 H N N 312 TRP HE3 H N N 313 TRP HZ2 H N N 314 TRP HZ3 H N N 315 TRP HH2 H N N 316 TRP HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 ILE N CA sing N N 124 ILE N H sing N N 125 ILE N H2 sing N N 126 ILE CA C sing N N 127 ILE CA CB sing N N 128 ILE CA HA sing N N 129 ILE C O doub N N 130 ILE C OXT sing N N 131 ILE CB CG1 sing N N 132 ILE CB CG2 sing N N 133 ILE CB HB sing N N 134 ILE CG1 CD1 sing N N 135 ILE CG1 HG12 sing N N 136 ILE CG1 HG13 sing N N 137 ILE CG2 HG21 sing N N 138 ILE CG2 HG22 sing N N 139 ILE CG2 HG23 sing N N 140 ILE CD1 HD11 sing N N 141 ILE CD1 HD12 sing N N 142 ILE CD1 HD13 sing N N 143 ILE OXT HXT sing N N 144 LEU N CA sing N N 145 LEU N H sing N N 146 LEU N H2 sing N N 147 LEU CA C sing N N 148 LEU CA CB sing N N 149 LEU CA HA sing N N 150 LEU C O doub N N 151 LEU C OXT sing N N 152 LEU CB CG sing N N 153 LEU CB HB2 sing N N 154 LEU CB HB3 sing N N 155 LEU CG CD1 sing N N 156 LEU CG CD2 sing N N 157 LEU CG HG sing N N 158 LEU CD1 HD11 sing N N 159 LEU CD1 HD12 sing N N 160 LEU CD1 HD13 sing N N 161 LEU CD2 HD21 sing N N 162 LEU CD2 HD22 sing N N 163 LEU CD2 HD23 sing N N 164 LEU OXT HXT sing N N 165 LYS N CA sing N N 166 LYS N H sing N N 167 LYS N H2 sing N N 168 LYS CA C sing N N 169 LYS CA CB sing N N 170 LYS CA HA sing N N 171 LYS C O doub N N 172 LYS C OXT sing N N 173 LYS CB CG sing N N 174 LYS CB HB2 sing N N 175 LYS CB HB3 sing N N 176 LYS CG CD sing N N 177 LYS CG HG2 sing N N 178 LYS CG HG3 sing N N 179 LYS CD CE sing N N 180 LYS CD HD2 sing N N 181 LYS CD HD3 sing N N 182 LYS CE NZ sing N N 183 LYS CE HE2 sing N N 184 LYS CE HE3 sing N N 185 LYS NZ HZ1 sing N N 186 LYS NZ HZ2 sing N N 187 LYS NZ HZ3 sing N N 188 LYS OXT HXT sing N N 189 MET N CA sing N N 190 MET N H sing N N 191 MET N H2 sing N N 192 MET CA C sing N N 193 MET CA CB sing N N 194 MET CA HA sing N N 195 MET C O doub N N 196 MET C OXT sing N N 197 MET CB CG sing N N 198 MET CB HB2 sing N N 199 MET CB HB3 sing N N 200 MET CG SD sing N N 201 MET CG HG2 sing N N 202 MET CG HG3 sing N N 203 MET SD CE sing N N 204 MET CE HE1 sing N N 205 MET CE HE2 sing N N 206 MET CE HE3 sing N N 207 MET OXT HXT sing N N 208 PHE N CA sing N N 209 PHE N H sing N N 210 PHE N H2 sing N N 211 PHE CA C sing N N 212 PHE CA CB sing N N 213 PHE CA HA sing N N 214 PHE C O doub N N 215 PHE C OXT sing N N 216 PHE CB CG sing N N 217 PHE CB HB2 sing N N 218 PHE CB HB3 sing N N 219 PHE CG CD1 doub Y N 220 PHE CG CD2 sing Y N 221 PHE CD1 CE1 sing Y N 222 PHE CD1 HD1 sing N N 223 PHE CD2 CE2 doub Y N 224 PHE CD2 HD2 sing N N 225 PHE CE1 CZ doub Y N 226 PHE CE1 HE1 sing N N 227 PHE CE2 CZ sing Y N 228 PHE CE2 HE2 sing N N 229 PHE CZ HZ sing N N 230 PHE OXT HXT sing N N 231 PRO N CA sing N N 232 PRO N CD sing N N 233 PRO N H sing N N 234 PRO CA C sing N N 235 PRO CA CB sing N N 236 PRO CA HA sing N N 237 PRO C O doub N N 238 PRO C OXT sing N N 239 PRO CB CG sing N N 240 PRO CB HB2 sing N N 241 PRO CB HB3 sing N N 242 PRO CG CD sing N N 243 PRO CG HG2 sing N N 244 PRO CG HG3 sing N N 245 PRO CD HD2 sing N N 246 PRO CD HD3 sing N N 247 PRO OXT HXT sing N N 248 SER N CA sing N N 249 SER N H sing N N 250 SER N H2 sing N N 251 SER CA C sing N N 252 SER CA CB sing N N 253 SER CA HA sing N N 254 SER C O doub N N 255 SER C OXT sing N N 256 SER CB OG sing N N 257 SER CB HB2 sing N N 258 SER CB HB3 sing N N 259 SER OG HG sing N N 260 SER OXT HXT sing N N 261 THR N CA sing N N 262 THR N H sing N N 263 THR N H2 sing N N 264 THR CA C sing N N 265 THR CA CB sing N N 266 THR CA HA sing N N 267 THR C O doub N N 268 THR C OXT sing N N 269 THR CB OG1 sing N N 270 THR CB CG2 sing N N 271 THR CB HB sing N N 272 THR OG1 HG1 sing N N 273 THR CG2 HG21 sing N N 274 THR CG2 HG22 sing N N 275 THR CG2 HG23 sing N N 276 THR OXT HXT sing N N 277 TRP N CA sing N N 278 TRP N H sing N N 279 TRP N H2 sing N N 280 TRP CA C sing N N 281 TRP CA CB sing N N 282 TRP CA HA sing N N 283 TRP C O doub N N 284 TRP C OXT sing N N 285 TRP CB CG sing N N 286 TRP CB HB2 sing N N 287 TRP CB HB3 sing N N 288 TRP CG CD1 doub Y N 289 TRP CG CD2 sing Y N 290 TRP CD1 NE1 sing Y N 291 TRP CD1 HD1 sing N N 292 TRP CD2 CE2 doub Y N 293 TRP CD2 CE3 sing Y N 294 TRP NE1 CE2 sing Y N 295 TRP NE1 HE1 sing N N 296 TRP CE2 CZ2 sing Y N 297 TRP CE3 CZ3 doub Y N 298 TRP CE3 HE3 sing N N 299 TRP CZ2 CH2 doub Y N 300 TRP CZ2 HZ2 sing N N 301 TRP CZ3 CH2 sing Y N 302 TRP CZ3 HZ3 sing N N 303 TRP CH2 HH2 sing N N 304 TRP OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # _atom_sites.entry_id 1TOF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_