data_1TOT # _entry.id 1TOT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1TOT pdb_00001tot 10.2210/pdb1tot/pdb RCSB RCSB022801 ? ? WWPDB D_1000022801 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-01-18 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.value' 17 4 'Structure model' '_struct_conn.pdbx_dist_value' 18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 30 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 31 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1TOT _pdbx_database_status.recvd_initial_deposition_date 2004-06-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1f81 _pdbx_database_related.details 'Neighboring domain in murine CBP' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Legge, G.B.' 1 'Martinez-Yamout, M.A.' 2 'Hambly, D.M.' 3 'Trinh, T.' 4 'Dyson, H.J.' 5 'Wright, P.E.' 6 # _citation.id primary _citation.title 'ZZ domain of CBP: an unusual zinc finger fold in a protein interaction module' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 343 _citation.page_first 1081 _citation.page_last 1093 _citation.year 2004 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15476823 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2004.08.087 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Legge, G.B.' 1 ? primary 'Martinez-Yamout, M.A.' 2 ? primary 'Hambly, D.M.' 3 ? primary 'Trinh, T.' 4 ? primary 'Lee, B.M.' 5 ? primary 'Dyson, H.J.' 6 ? primary 'Wright, P.E.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CREB-binding protein' 6230.059 1 2.3.1.48 ? 'ZZ domain of murine CBP (residues 1700-1751)' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLD _entity_poly.pdbx_seq_one_letter_code_can GQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLN n 1 3 ASP n 1 4 ARG n 1 5 PHE n 1 6 VAL n 1 7 TYR n 1 8 THR n 1 9 CYS n 1 10 ASN n 1 11 GLU n 1 12 CYS n 1 13 LYS n 1 14 HIS n 1 15 HIS n 1 16 VAL n 1 17 GLU n 1 18 THR n 1 19 ARG n 1 20 TRP n 1 21 HIS n 1 22 CYS n 1 23 THR n 1 24 VAL n 1 25 CYS n 1 26 GLU n 1 27 ASP n 1 28 TYR n 1 29 ASP n 1 30 LEU n 1 31 CYS n 1 32 ILE n 1 33 ASN n 1 34 CYS n 1 35 TYR n 1 36 ASN n 1 37 THR n 1 38 LYS n 1 39 SER n 1 40 HIS n 1 41 THR n 1 42 HIS n 1 43 LYS n 1 44 MET n 1 45 VAL n 1 46 LYS n 1 47 TRP n 1 48 GLY n 1 49 LEU n 1 50 GLY n 1 51 LEU n 1 52 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene 'CREBBP, CBP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) [DNAY]' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ASP 52 52 52 ASP ASP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 53 53 ZN ZN A . C 2 ZN 1 54 54 ZN ZN A . # _exptl.entry_id 1TOT _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1TOT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1TOT _struct.title 'ZZ Domain of CBP- a Novel Fold for a Protein Interaction Module' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1TOT _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'Zinc Binding, CBP, TAZ2, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CBP_MOUSE _struct_ref.pdbx_db_accession P45481 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLD _struct_ref.pdbx_align_begin 1700 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1TOT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 52 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P45481 _struct_ref_seq.db_align_beg 1700 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1751 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 52 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 31 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 39 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 31 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 39 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 9 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 9 A ZN 54 1_555 ? ? ? ? ? ? ? 2.271 ? ? metalc2 metalc ? ? A CYS 12 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 12 A ZN 54 1_555 ? ? ? ? ? ? ? 2.297 ? ? metalc3 metalc ? ? A CYS 22 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 22 A ZN 53 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc4 metalc ? ? A CYS 25 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 25 A ZN 53 1_555 ? ? ? ? ? ? ? 2.319 ? ? metalc5 metalc ? ? A CYS 31 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 31 A ZN 54 1_555 ? ? ? ? ? ? ? 2.287 ? ? metalc6 metalc ? ? A CYS 34 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 34 A ZN 54 1_555 ? ? ? ? ? ? ? 2.297 ? ? metalc7 metalc ? ? A HIS 40 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 40 A ZN 53 1_555 ? ? ? ? ? ? ? 2.094 ? ? metalc8 metalc ? ? A HIS 42 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 42 A ZN 53 1_555 ? ? ? ? ? ? ? 2.099 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 9 ? A CYS 9 ? 1_555 ZN ? C ZN . ? A ZN 54 ? 1_555 SG ? A CYS 12 ? A CYS 12 ? 1_555 103.6 ? 2 SG ? A CYS 9 ? A CYS 9 ? 1_555 ZN ? C ZN . ? A ZN 54 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 105.9 ? 3 SG ? A CYS 12 ? A CYS 12 ? 1_555 ZN ? C ZN . ? A ZN 54 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 117.2 ? 4 SG ? A CYS 9 ? A CYS 9 ? 1_555 ZN ? C ZN . ? A ZN 54 ? 1_555 SG ? A CYS 34 ? A CYS 34 ? 1_555 112.3 ? 5 SG ? A CYS 12 ? A CYS 12 ? 1_555 ZN ? C ZN . ? A ZN 54 ? 1_555 SG ? A CYS 34 ? A CYS 34 ? 1_555 114.4 ? 6 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? C ZN . ? A ZN 54 ? 1_555 SG ? A CYS 34 ? A CYS 34 ? 1_555 103.5 ? 7 SG ? A CYS 22 ? A CYS 22 ? 1_555 ZN ? B ZN . ? A ZN 53 ? 1_555 SG ? A CYS 25 ? A CYS 25 ? 1_555 107.3 ? 8 SG ? A CYS 22 ? A CYS 22 ? 1_555 ZN ? B ZN . ? A ZN 53 ? 1_555 NE2 ? A HIS 40 ? A HIS 40 ? 1_555 104.7 ? 9 SG ? A CYS 25 ? A CYS 25 ? 1_555 ZN ? B ZN . ? A ZN 53 ? 1_555 NE2 ? A HIS 40 ? A HIS 40 ? 1_555 121.0 ? 10 SG ? A CYS 22 ? A CYS 22 ? 1_555 ZN ? B ZN . ? A ZN 53 ? 1_555 ND1 ? A HIS 42 ? A HIS 42 ? 1_555 111.0 ? 11 SG ? A CYS 25 ? A CYS 25 ? 1_555 ZN ? B ZN . ? A ZN 53 ? 1_555 ND1 ? A HIS 42 ? A HIS 42 ? 1_555 111.1 ? 12 NE2 ? A HIS 40 ? A HIS 40 ? 1_555 ZN ? B ZN . ? A ZN 53 ? 1_555 ND1 ? A HIS 42 ? A HIS 42 ? 1_555 101.5 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 7 ? THR A 8 ? TYR A 7 THR A 8 A 2 HIS A 15 ? VAL A 16 ? HIS A 15 VAL A 16 B 1 ASP A 29 ? LEU A 30 ? ASP A 29 LEU A 30 B 2 ARG A 19 ? CYS A 22 ? ARG A 19 CYS A 22 B 3 MET A 44 ? TRP A 47 ? MET A 44 TRP A 47 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 7 ? N TYR A 7 O VAL A 16 ? O VAL A 16 B 1 2 O LEU A 30 ? O LEU A 30 N TRP A 20 ? N TRP A 20 B 2 3 N ARG A 19 ? N ARG A 19 O TRP A 47 ? O TRP A 47 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 53 ? 5 'BINDING SITE FOR RESIDUE ZN A 53' AC2 Software A ZN 54 ? 4 'BINDING SITE FOR RESIDUE ZN A 54' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 22 ? CYS A 22 . ? 1_555 ? 2 AC1 5 VAL A 24 ? VAL A 24 . ? 1_555 ? 3 AC1 5 CYS A 25 ? CYS A 25 . ? 1_555 ? 4 AC1 5 HIS A 40 ? HIS A 40 . ? 1_555 ? 5 AC1 5 HIS A 42 ? HIS A 42 . ? 1_555 ? 6 AC2 4 CYS A 9 ? CYS A 9 . ? 1_555 ? 7 AC2 4 CYS A 12 ? CYS A 12 . ? 1_555 ? 8 AC2 4 CYS A 31 ? CYS A 31 . ? 1_555 ? 9 AC2 4 CYS A 34 ? CYS A 34 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 OE1 A GLU 17 ? ? HG1 A THR 18 ? ? 1.59 2 4 OE1 A GLU 17 ? ? HG1 A THR 18 ? ? 1.59 3 5 OE1 A GLU 17 ? ? HG1 A THR 18 ? ? 1.59 4 7 OE1 A GLU 17 ? ? HG1 A THR 18 ? ? 1.58 5 9 OE1 A GLU 17 ? ? HG1 A THR 18 ? ? 1.58 6 10 OE1 A GLU 17 ? ? HG1 A THR 18 ? ? 1.57 7 13 OE1 A GLU 17 ? ? HG1 A THR 18 ? ? 1.57 8 14 OE1 A GLU 17 ? ? HG1 A THR 18 ? ? 1.58 9 15 OE1 A GLU 17 ? ? HG1 A THR 18 ? ? 1.56 10 18 OE1 A GLU 17 ? ? HG1 A THR 18 ? ? 1.56 11 19 OE1 A GLU 17 ? ? HG1 A THR 18 ? ? 1.60 12 20 OE1 A GLU 17 ? ? HG1 A THR 18 ? ? 1.60 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 7 CB A TYR 7 ? ? CG A TYR 7 ? ? CD2 A TYR 7 ? ? 117.35 121.00 -3.65 0.60 N 2 8 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.43 120.30 3.13 0.50 N 3 8 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH2 A ARG 19 ? ? 116.17 120.30 -4.13 0.50 N 4 10 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH2 A ARG 19 ? ? 116.10 120.30 -4.20 0.50 N 5 17 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH2 A ARG 19 ? ? 117.21 120.30 -3.09 0.50 N 6 19 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH2 A ARG 19 ? ? 116.64 120.30 -3.66 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 5 ? ? -147.01 10.79 2 1 VAL A 24 ? ? -101.27 -65.32 3 1 THR A 37 ? ? -130.93 -45.70 4 2 ASN A 10 ? ? -67.80 0.44 5 2 VAL A 24 ? ? -103.42 -63.66 6 3 PHE A 5 ? ? -147.16 16.30 7 3 ASN A 10 ? ? -66.92 0.57 8 3 VAL A 24 ? ? -103.26 -61.30 9 3 LYS A 38 ? ? -68.63 0.49 10 3 SER A 39 ? ? 39.44 47.39 11 3 LEU A 49 ? ? 84.11 8.61 12 4 PHE A 5 ? ? -154.17 23.13 13 4 ASN A 10 ? ? -67.22 1.19 14 5 PHE A 5 ? ? -159.95 25.95 15 6 ASN A 10 ? ? -68.69 0.48 16 6 VAL A 24 ? ? -104.50 -60.14 17 7 PHE A 5 ? ? -151.47 17.96 18 7 VAL A 24 ? ? -102.41 -62.02 19 7 SER A 39 ? ? 33.98 46.02 20 7 LEU A 51 ? ? -148.98 54.07 21 8 PHE A 5 ? ? -162.29 25.64 22 8 VAL A 24 ? ? -101.04 -62.09 23 8 THR A 37 ? ? -128.04 -52.53 24 8 LYS A 43 ? ? -68.38 97.86 25 8 LEU A 49 ? ? 76.84 -1.21 26 8 LEU A 51 ? ? -145.63 34.66 27 9 PHE A 5 ? ? -152.27 13.27 28 9 ASN A 10 ? ? -66.46 1.27 29 9 VAL A 24 ? ? -120.17 -65.38 30 10 ASP A 3 ? ? -137.33 -133.79 31 11 ASN A 10 ? ? -68.23 0.51 32 11 VAL A 24 ? ? -102.63 -61.09 33 11 SER A 39 ? ? 31.61 52.42 34 11 LEU A 49 ? ? -144.91 -6.12 35 12 PHE A 5 ? ? -149.72 21.94 36 12 LYS A 38 ? ? -68.39 0.94 37 12 SER A 39 ? ? 35.91 47.64 38 13 PHE A 5 ? ? -154.27 12.20 39 13 ASN A 10 ? ? -67.69 0.88 40 13 LYS A 13 ? ? 59.75 18.53 41 13 THR A 37 ? ? -128.62 -53.48 42 13 THR A 41 ? ? -66.83 25.66 43 13 LEU A 49 ? ? -151.84 -1.59 44 14 VAL A 24 ? ? -107.84 -60.23 45 14 ASP A 27 ? ? 38.96 38.10 46 14 LEU A 49 ? ? -140.12 -16.86 47 14 LEU A 51 ? ? -119.59 74.36 48 15 PHE A 5 ? ? -147.80 10.64 49 15 ASN A 10 ? ? -68.70 0.22 50 15 VAL A 24 ? ? -99.75 -61.88 51 15 THR A 37 ? ? -132.05 -49.36 52 15 HIS A 40 ? ? -69.19 86.89 53 15 THR A 41 ? ? -64.50 11.12 54 15 LEU A 49 ? ? -145.28 -19.30 55 16 PHE A 5 ? ? -148.25 17.54 56 17 SER A 39 ? ? 31.69 48.97 57 17 LEU A 51 ? ? -141.14 -3.50 58 18 ASP A 3 ? ? -141.82 -158.65 59 18 PHE A 5 ? ? -145.44 16.93 60 18 VAL A 24 ? ? -90.36 -61.49 61 18 THR A 37 ? ? -130.75 -47.62 62 18 THR A 41 ? ? -63.06 23.83 63 19 PHE A 5 ? ? -151.90 14.84 64 19 ASN A 10 ? ? -65.34 0.98 65 19 ASP A 27 ? ? 37.14 39.94 66 19 LEU A 49 ? ? -145.43 -22.11 67 20 PHE A 5 ? ? -156.75 19.65 68 20 ASN A 10 ? ? -69.96 4.99 69 20 VAL A 24 ? ? -99.80 -64.57 70 20 SER A 39 ? ? 34.08 40.93 71 20 HIS A 40 ? ? -64.02 95.44 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 4 ? ? 0.082 'SIDE CHAIN' 2 4 TYR A 7 ? ? 0.128 'SIDE CHAIN' 3 4 ARG A 19 ? ? 0.120 'SIDE CHAIN' 4 5 TYR A 7 ? ? 0.107 'SIDE CHAIN' 5 5 ARG A 19 ? ? 0.083 'SIDE CHAIN' 6 6 ARG A 19 ? ? 0.097 'SIDE CHAIN' 7 7 TYR A 7 ? ? 0.148 'SIDE CHAIN' 8 7 ARG A 19 ? ? 0.097 'SIDE CHAIN' 9 9 ARG A 4 ? ? 0.081 'SIDE CHAIN' 10 9 TYR A 7 ? ? 0.100 'SIDE CHAIN' 11 9 ARG A 19 ? ? 0.102 'SIDE CHAIN' 12 11 TYR A 7 ? ? 0.096 'SIDE CHAIN' 13 11 ARG A 19 ? ? 0.093 'SIDE CHAIN' 14 12 TYR A 7 ? ? 0.102 'SIDE CHAIN' 15 13 HIS A 14 ? ? 0.081 'SIDE CHAIN' 16 15 ARG A 19 ? ? 0.082 'SIDE CHAIN' 17 16 ARG A 19 ? ? 0.092 'SIDE CHAIN' 18 19 TYR A 7 ? ? 0.077 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1TOT _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1TOT _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2.3 mM solutions in degassed 10 mM Tris-d11 pH 6.8, 200 M ZnCl2, 10 mM DTT-d10, 0.05% w/v sodium azide, 94 % H2O, 6 % D2O' _pdbx_nmr_sample_details.solvent_system '94 % H2O, 6 % D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength '10 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY 3 1 1 'HBHA(CCCO)NH TOSCY' 4 1 1 'CCONH TOCSY' 5 1 1 'HCCH TOSCSY' 6 1 1 'HCCH COSY' 7 1 1 HNCO 8 1 1 'HN(CA)CO' 9 1 1 CBCACONH 10 1 1 HNCACB # _pdbx_nmr_details.entry_id 1TOT _pdbx_nmr_details.text ;This structure was determined using standard 3D homonuclear techniques, and by Cd113 NMR of a cadmium substituted sample to confirm metal coordinating ligands and coordinating atoms. ; # _pdbx_nmr_refine.entry_id 1TOT _pdbx_nmr_refine.method 'torsion angle dynamics and simulated annealing' _pdbx_nmr_refine.details ;The calculated structures are based on a total of 1846 NOEs, and include duplicate NOEs. 441 intraresidue, 328 sequential, 157 medium range, 386 long range, 534 ambigous, 5 defined hydrogen bonds from H/D exchange and 29 Phi and 29 Psi constraints and 22 Chi1 constraints. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DYANA 1.0 'structure solution' Guntert 1 SANE 1.0 'data analysis' Duggan 2 Amber 8.0 'structure solution' Case 3 NMRPipe 1.0 processing Delaglio 4 NMRView 5.04 'data analysis' Johnson 5 Amber 8.0 refinement Case 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 CYS N N N N 61 CYS CA C N R 62 CYS C C N N 63 CYS O O N N 64 CYS CB C N N 65 CYS SG S N N 66 CYS OXT O N N 67 CYS H H N N 68 CYS H2 H N N 69 CYS HA H N N 70 CYS HB2 H N N 71 CYS HB3 H N N 72 CYS HG H N N 73 CYS HXT H N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 ILE N N N N 145 ILE CA C N S 146 ILE C C N N 147 ILE O O N N 148 ILE CB C N S 149 ILE CG1 C N N 150 ILE CG2 C N N 151 ILE CD1 C N N 152 ILE OXT O N N 153 ILE H H N N 154 ILE H2 H N N 155 ILE HA H N N 156 ILE HB H N N 157 ILE HG12 H N N 158 ILE HG13 H N N 159 ILE HG21 H N N 160 ILE HG22 H N N 161 ILE HG23 H N N 162 ILE HD11 H N N 163 ILE HD12 H N N 164 ILE HD13 H N N 165 ILE HXT H N N 166 LEU N N N N 167 LEU CA C N S 168 LEU C C N N 169 LEU O O N N 170 LEU CB C N N 171 LEU CG C N N 172 LEU CD1 C N N 173 LEU CD2 C N N 174 LEU OXT O N N 175 LEU H H N N 176 LEU H2 H N N 177 LEU HA H N N 178 LEU HB2 H N N 179 LEU HB3 H N N 180 LEU HG H N N 181 LEU HD11 H N N 182 LEU HD12 H N N 183 LEU HD13 H N N 184 LEU HD21 H N N 185 LEU HD22 H N N 186 LEU HD23 H N N 187 LEU HXT H N N 188 LYS N N N N 189 LYS CA C N S 190 LYS C C N N 191 LYS O O N N 192 LYS CB C N N 193 LYS CG C N N 194 LYS CD C N N 195 LYS CE C N N 196 LYS NZ N N N 197 LYS OXT O N N 198 LYS H H N N 199 LYS H2 H N N 200 LYS HA H N N 201 LYS HB2 H N N 202 LYS HB3 H N N 203 LYS HG2 H N N 204 LYS HG3 H N N 205 LYS HD2 H N N 206 LYS HD3 H N N 207 LYS HE2 H N N 208 LYS HE3 H N N 209 LYS HZ1 H N N 210 LYS HZ2 H N N 211 LYS HZ3 H N N 212 LYS HXT H N N 213 MET N N N N 214 MET CA C N S 215 MET C C N N 216 MET O O N N 217 MET CB C N N 218 MET CG C N N 219 MET SD S N N 220 MET CE C N N 221 MET OXT O N N 222 MET H H N N 223 MET H2 H N N 224 MET HA H N N 225 MET HB2 H N N 226 MET HB3 H N N 227 MET HG2 H N N 228 MET HG3 H N N 229 MET HE1 H N N 230 MET HE2 H N N 231 MET HE3 H N N 232 MET HXT H N N 233 PHE N N N N 234 PHE CA C N S 235 PHE C C N N 236 PHE O O N N 237 PHE CB C N N 238 PHE CG C Y N 239 PHE CD1 C Y N 240 PHE CD2 C Y N 241 PHE CE1 C Y N 242 PHE CE2 C Y N 243 PHE CZ C Y N 244 PHE OXT O N N 245 PHE H H N N 246 PHE H2 H N N 247 PHE HA H N N 248 PHE HB2 H N N 249 PHE HB3 H N N 250 PHE HD1 H N N 251 PHE HD2 H N N 252 PHE HE1 H N N 253 PHE HE2 H N N 254 PHE HZ H N N 255 PHE HXT H N N 256 SER N N N N 257 SER CA C N S 258 SER C C N N 259 SER O O N N 260 SER CB C N N 261 SER OG O N N 262 SER OXT O N N 263 SER H H N N 264 SER H2 H N N 265 SER HA H N N 266 SER HB2 H N N 267 SER HB3 H N N 268 SER HG H N N 269 SER HXT H N N 270 THR N N N N 271 THR CA C N S 272 THR C C N N 273 THR O O N N 274 THR CB C N R 275 THR OG1 O N N 276 THR CG2 C N N 277 THR OXT O N N 278 THR H H N N 279 THR H2 H N N 280 THR HA H N N 281 THR HB H N N 282 THR HG1 H N N 283 THR HG21 H N N 284 THR HG22 H N N 285 THR HG23 H N N 286 THR HXT H N N 287 TRP N N N N 288 TRP CA C N S 289 TRP C C N N 290 TRP O O N N 291 TRP CB C N N 292 TRP CG C Y N 293 TRP CD1 C Y N 294 TRP CD2 C Y N 295 TRP NE1 N Y N 296 TRP CE2 C Y N 297 TRP CE3 C Y N 298 TRP CZ2 C Y N 299 TRP CZ3 C Y N 300 TRP CH2 C Y N 301 TRP OXT O N N 302 TRP H H N N 303 TRP H2 H N N 304 TRP HA H N N 305 TRP HB2 H N N 306 TRP HB3 H N N 307 TRP HD1 H N N 308 TRP HE1 H N N 309 TRP HE3 H N N 310 TRP HZ2 H N N 311 TRP HZ3 H N N 312 TRP HH2 H N N 313 TRP HXT H N N 314 TYR N N N N 315 TYR CA C N S 316 TYR C C N N 317 TYR O O N N 318 TYR CB C N N 319 TYR CG C Y N 320 TYR CD1 C Y N 321 TYR CD2 C Y N 322 TYR CE1 C Y N 323 TYR CE2 C Y N 324 TYR CZ C Y N 325 TYR OH O N N 326 TYR OXT O N N 327 TYR H H N N 328 TYR H2 H N N 329 TYR HA H N N 330 TYR HB2 H N N 331 TYR HB3 H N N 332 TYR HD1 H N N 333 TYR HD2 H N N 334 TYR HE1 H N N 335 TYR HE2 H N N 336 TYR HH H N N 337 TYR HXT H N N 338 VAL N N N N 339 VAL CA C N S 340 VAL C C N N 341 VAL O O N N 342 VAL CB C N N 343 VAL CG1 C N N 344 VAL CG2 C N N 345 VAL OXT O N N 346 VAL H H N N 347 VAL H2 H N N 348 VAL HA H N N 349 VAL HB H N N 350 VAL HG11 H N N 351 VAL HG12 H N N 352 VAL HG13 H N N 353 VAL HG21 H N N 354 VAL HG22 H N N 355 VAL HG23 H N N 356 VAL HXT H N N 357 ZN ZN ZN N N 358 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 CYS N CA sing N N 58 CYS N H sing N N 59 CYS N H2 sing N N 60 CYS CA C sing N N 61 CYS CA CB sing N N 62 CYS CA HA sing N N 63 CYS C O doub N N 64 CYS C OXT sing N N 65 CYS CB SG sing N N 66 CYS CB HB2 sing N N 67 CYS CB HB3 sing N N 68 CYS SG HG sing N N 69 CYS OXT HXT sing N N 70 GLN N CA sing N N 71 GLN N H sing N N 72 GLN N H2 sing N N 73 GLN CA C sing N N 74 GLN CA CB sing N N 75 GLN CA HA sing N N 76 GLN C O doub N N 77 GLN C OXT sing N N 78 GLN CB CG sing N N 79 GLN CB HB2 sing N N 80 GLN CB HB3 sing N N 81 GLN CG CD sing N N 82 GLN CG HG2 sing N N 83 GLN CG HG3 sing N N 84 GLN CD OE1 doub N N 85 GLN CD NE2 sing N N 86 GLN NE2 HE21 sing N N 87 GLN NE2 HE22 sing N N 88 GLN OXT HXT sing N N 89 GLU N CA sing N N 90 GLU N H sing N N 91 GLU N H2 sing N N 92 GLU CA C sing N N 93 GLU CA CB sing N N 94 GLU CA HA sing N N 95 GLU C O doub N N 96 GLU C OXT sing N N 97 GLU CB CG sing N N 98 GLU CB HB2 sing N N 99 GLU CB HB3 sing N N 100 GLU CG CD sing N N 101 GLU CG HG2 sing N N 102 GLU CG HG3 sing N N 103 GLU CD OE1 doub N N 104 GLU CD OE2 sing N N 105 GLU OE2 HE2 sing N N 106 GLU OXT HXT sing N N 107 GLY N CA sing N N 108 GLY N H sing N N 109 GLY N H2 sing N N 110 GLY CA C sing N N 111 GLY CA HA2 sing N N 112 GLY CA HA3 sing N N 113 GLY C O doub N N 114 GLY C OXT sing N N 115 GLY OXT HXT sing N N 116 HIS N CA sing N N 117 HIS N H sing N N 118 HIS N H2 sing N N 119 HIS CA C sing N N 120 HIS CA CB sing N N 121 HIS CA HA sing N N 122 HIS C O doub N N 123 HIS C OXT sing N N 124 HIS CB CG sing N N 125 HIS CB HB2 sing N N 126 HIS CB HB3 sing N N 127 HIS CG ND1 sing Y N 128 HIS CG CD2 doub Y N 129 HIS ND1 CE1 doub Y N 130 HIS ND1 HD1 sing N N 131 HIS CD2 NE2 sing Y N 132 HIS CD2 HD2 sing N N 133 HIS CE1 NE2 sing Y N 134 HIS CE1 HE1 sing N N 135 HIS NE2 HE2 sing N N 136 HIS OXT HXT sing N N 137 ILE N CA sing N N 138 ILE N H sing N N 139 ILE N H2 sing N N 140 ILE CA C sing N N 141 ILE CA CB sing N N 142 ILE CA HA sing N N 143 ILE C O doub N N 144 ILE C OXT sing N N 145 ILE CB CG1 sing N N 146 ILE CB CG2 sing N N 147 ILE CB HB sing N N 148 ILE CG1 CD1 sing N N 149 ILE CG1 HG12 sing N N 150 ILE CG1 HG13 sing N N 151 ILE CG2 HG21 sing N N 152 ILE CG2 HG22 sing N N 153 ILE CG2 HG23 sing N N 154 ILE CD1 HD11 sing N N 155 ILE CD1 HD12 sing N N 156 ILE CD1 HD13 sing N N 157 ILE OXT HXT sing N N 158 LEU N CA sing N N 159 LEU N H sing N N 160 LEU N H2 sing N N 161 LEU CA C sing N N 162 LEU CA CB sing N N 163 LEU CA HA sing N N 164 LEU C O doub N N 165 LEU C OXT sing N N 166 LEU CB CG sing N N 167 LEU CB HB2 sing N N 168 LEU CB HB3 sing N N 169 LEU CG CD1 sing N N 170 LEU CG CD2 sing N N 171 LEU CG HG sing N N 172 LEU CD1 HD11 sing N N 173 LEU CD1 HD12 sing N N 174 LEU CD1 HD13 sing N N 175 LEU CD2 HD21 sing N N 176 LEU CD2 HD22 sing N N 177 LEU CD2 HD23 sing N N 178 LEU OXT HXT sing N N 179 LYS N CA sing N N 180 LYS N H sing N N 181 LYS N H2 sing N N 182 LYS CA C sing N N 183 LYS CA CB sing N N 184 LYS CA HA sing N N 185 LYS C O doub N N 186 LYS C OXT sing N N 187 LYS CB CG sing N N 188 LYS CB HB2 sing N N 189 LYS CB HB3 sing N N 190 LYS CG CD sing N N 191 LYS CG HG2 sing N N 192 LYS CG HG3 sing N N 193 LYS CD CE sing N N 194 LYS CD HD2 sing N N 195 LYS CD HD3 sing N N 196 LYS CE NZ sing N N 197 LYS CE HE2 sing N N 198 LYS CE HE3 sing N N 199 LYS NZ HZ1 sing N N 200 LYS NZ HZ2 sing N N 201 LYS NZ HZ3 sing N N 202 LYS OXT HXT sing N N 203 MET N CA sing N N 204 MET N H sing N N 205 MET N H2 sing N N 206 MET CA C sing N N 207 MET CA CB sing N N 208 MET CA HA sing N N 209 MET C O doub N N 210 MET C OXT sing N N 211 MET CB CG sing N N 212 MET CB HB2 sing N N 213 MET CB HB3 sing N N 214 MET CG SD sing N N 215 MET CG HG2 sing N N 216 MET CG HG3 sing N N 217 MET SD CE sing N N 218 MET CE HE1 sing N N 219 MET CE HE2 sing N N 220 MET CE HE3 sing N N 221 MET OXT HXT sing N N 222 PHE N CA sing N N 223 PHE N H sing N N 224 PHE N H2 sing N N 225 PHE CA C sing N N 226 PHE CA CB sing N N 227 PHE CA HA sing N N 228 PHE C O doub N N 229 PHE C OXT sing N N 230 PHE CB CG sing N N 231 PHE CB HB2 sing N N 232 PHE CB HB3 sing N N 233 PHE CG CD1 doub Y N 234 PHE CG CD2 sing Y N 235 PHE CD1 CE1 sing Y N 236 PHE CD1 HD1 sing N N 237 PHE CD2 CE2 doub Y N 238 PHE CD2 HD2 sing N N 239 PHE CE1 CZ doub Y N 240 PHE CE1 HE1 sing N N 241 PHE CE2 CZ sing Y N 242 PHE CE2 HE2 sing N N 243 PHE CZ HZ sing N N 244 PHE OXT HXT sing N N 245 SER N CA sing N N 246 SER N H sing N N 247 SER N H2 sing N N 248 SER CA C sing N N 249 SER CA CB sing N N 250 SER CA HA sing N N 251 SER C O doub N N 252 SER C OXT sing N N 253 SER CB OG sing N N 254 SER CB HB2 sing N N 255 SER CB HB3 sing N N 256 SER OG HG sing N N 257 SER OXT HXT sing N N 258 THR N CA sing N N 259 THR N H sing N N 260 THR N H2 sing N N 261 THR CA C sing N N 262 THR CA CB sing N N 263 THR CA HA sing N N 264 THR C O doub N N 265 THR C OXT sing N N 266 THR CB OG1 sing N N 267 THR CB CG2 sing N N 268 THR CB HB sing N N 269 THR OG1 HG1 sing N N 270 THR CG2 HG21 sing N N 271 THR CG2 HG22 sing N N 272 THR CG2 HG23 sing N N 273 THR OXT HXT sing N N 274 TRP N CA sing N N 275 TRP N H sing N N 276 TRP N H2 sing N N 277 TRP CA C sing N N 278 TRP CA CB sing N N 279 TRP CA HA sing N N 280 TRP C O doub N N 281 TRP C OXT sing N N 282 TRP CB CG sing N N 283 TRP CB HB2 sing N N 284 TRP CB HB3 sing N N 285 TRP CG CD1 doub Y N 286 TRP CG CD2 sing Y N 287 TRP CD1 NE1 sing Y N 288 TRP CD1 HD1 sing N N 289 TRP CD2 CE2 doub Y N 290 TRP CD2 CE3 sing Y N 291 TRP NE1 CE2 sing Y N 292 TRP NE1 HE1 sing N N 293 TRP CE2 CZ2 sing Y N 294 TRP CE3 CZ3 doub Y N 295 TRP CE3 HE3 sing N N 296 TRP CZ2 CH2 doub Y N 297 TRP CZ2 HZ2 sing N N 298 TRP CZ3 CH2 sing Y N 299 TRP CZ3 HZ3 sing N N 300 TRP CH2 HH2 sing N N 301 TRP OXT HXT sing N N 302 TYR N CA sing N N 303 TYR N H sing N N 304 TYR N H2 sing N N 305 TYR CA C sing N N 306 TYR CA CB sing N N 307 TYR CA HA sing N N 308 TYR C O doub N N 309 TYR C OXT sing N N 310 TYR CB CG sing N N 311 TYR CB HB2 sing N N 312 TYR CB HB3 sing N N 313 TYR CG CD1 doub Y N 314 TYR CG CD2 sing Y N 315 TYR CD1 CE1 sing Y N 316 TYR CD1 HD1 sing N N 317 TYR CD2 CE2 doub Y N 318 TYR CD2 HD2 sing N N 319 TYR CE1 CZ doub Y N 320 TYR CE1 HE1 sing N N 321 TYR CE2 CZ sing Y N 322 TYR CE2 HE2 sing N N 323 TYR CZ OH sing N N 324 TYR OH HH sing N N 325 TYR OXT HXT sing N N 326 VAL N CA sing N N 327 VAL N H sing N N 328 VAL N H2 sing N N 329 VAL CA C sing N N 330 VAL CA CB sing N N 331 VAL CA HA sing N N 332 VAL C O doub N N 333 VAL C OXT sing N N 334 VAL CB CG1 sing N N 335 VAL CB CG2 sing N N 336 VAL CB HB sing N N 337 VAL CG1 HG11 sing N N 338 VAL CG1 HG12 sing N N 339 VAL CG1 HG13 sing N N 340 VAL CG2 HG21 sing N N 341 VAL CG2 HG22 sing N N 342 VAL CG2 HG23 sing N N 343 VAL OXT HXT sing N N 344 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 600 2 ? Bruker AMX 500 # _atom_sites.entry_id 1TOT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_