data_1TZ5 # _entry.id 1TZ5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1TZ5 pdb_00001tz5 10.2210/pdb1tz5/pdb RCSB RCSB023044 ? ? WWPDB D_1000023044 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-07-05 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-01-01 5 'Structure model' 1 4 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Source and taxonomy' 7 4 'Structure model' 'Structure summary' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' 10 5 'Structure model' 'Derived calculations' 11 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' entity 2 4 'Structure model' entity_name_com 3 4 'Structure model' entity_src_gen 4 4 'Structure model' pdbx_nmr_software 5 4 'Structure model' pdbx_nmr_spectrometer 6 4 'Structure model' pdbx_struct_assembly 7 4 'Structure model' pdbx_struct_assembly_prop 8 4 'Structure model' pdbx_struct_oper_list 9 4 'Structure model' struct_conn 10 4 'Structure model' struct_ref 11 4 'Structure model' struct_ref_seq_dif 12 5 'Structure model' chem_comp_atom 13 5 'Structure model' chem_comp_bond 14 5 'Structure model' database_2 15 5 'Structure model' pdbx_entry_details 16 5 'Structure model' pdbx_modification_feature 17 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_entity.pdbx_description' 2 4 'Structure model' '_entity_name_com.name' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 4 'Structure model' '_struct_ref.db_code' 7 5 'Structure model' '_database_2.pdbx_DOI' 8 5 'Structure model' '_database_2.pdbx_database_accession' 9 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 10 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 11 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1TZ5 _pdbx_database_status.recvd_initial_deposition_date 2004-07-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1LJV 'bPP bound to DPC micelles' unspecified PDB 1F8P 'pNPY bound to DPC micelles' unspecified PDB 1TZ4 '[hPP19-23]-pNPY bound to DPC Micelles' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lerch, M.' 1 'Kamimori, H.' 2 'Folkers, G.' 3 'Aguilar, M.I.' 4 'Beck-Sickinger, A.G.' 5 'Zerbe, O.' 6 # _citation.id primary _citation.title ;Strongly Altered Receptor Binding Properties in PP and NPY Chimeras Are Accompanied by Changes in Structure and Membrane Binding ; _citation.journal_abbrev Biochemistry _citation.journal_volume 44 _citation.page_first 9255 _citation.page_last 9264 _citation.year 2005 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15966750 _citation.pdbx_database_id_DOI 10.1021/bi0501232 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lerch, M.' 1 ? primary 'Kamimori, H.' 2 ? primary 'Folkers, G.' 3 ? primary 'Aguilar, M.I.' 4 ? primary 'Beck-Sickinger, A.G.' 5 ? primary 'Zerbe, O.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Pancreatic prohormone,neuropeptide Y,Pancreatic prohormone' _entity.formula_weight 4277.887 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Pancreatic polypeptide,PP,Pancreatic polypeptide,PP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'APLEPVYPGDNATPEQMARYYSALRRYINMLTRPRY(NH2)' _entity_poly.pdbx_seq_one_letter_code_can APLEPVYPGDNATPEQMARYYSALRRYINMLTRPRYX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 PRO n 1 3 LEU n 1 4 GLU n 1 5 PRO n 1 6 VAL n 1 7 TYR n 1 8 PRO n 1 9 GLY n 1 10 ASP n 1 11 ASN n 1 12 ALA n 1 13 THR n 1 14 PRO n 1 15 GLU n 1 16 GLN n 1 17 MET n 1 18 ALA n 1 19 ARG n 1 20 TYR n 1 21 TYR n 1 22 SER n 1 23 ALA n 1 24 LEU n 1 25 ARG n 1 26 ARG n 1 27 TYR n 1 28 ILE n 1 29 ASN n 1 30 MET n 1 31 LEU n 1 32 THR n 1 33 ARG n 1 34 PRO n 1 35 ARG n 1 36 TYR n 1 37 NH2 n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 18 Human 'Homo, Sus' 'PPY, PNP' , ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? 'PUBK19-[pNPY19-23]-hPP-G' ? ? 1 2 sample 'Biological sequence' 19 23 Pig 'Homo, Sus' NPY , ? ? ? ? ? 'Sus scrofa' 9823 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? 'PUBK19-[pNPY19-23]-hPP-G' ? ? 1 3 sample 'Biological sequence' 24 37 Human 'Homo, Sus' 'PPY, PNP' , ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? 'PUBK19-[pNPY19-23]-hPP-G' ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 NH2 37 37 37 NH2 NH2 A . n # _exptl.entry_id 1TZ5 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1TZ5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1TZ5 _struct.title '[pNPY19-23]-hPP bound to DPC Micelles' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1TZ5 _struct_keywords.pdbx_keywords 'HORMONE/GROWTH FACTOR' _struct_keywords.text 'NPY-PP Chimera, HORMONE-GROWTH FACTOR COMPLEX' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PAHO_HUMAN P01298 ? 1 APLEPVYPGDNATPEQMA 30 2 UNP NPY_PIG P01304 ? 1 RYYSA 28 3 UNP PAHO_HUMAN P01298 ? 1 LRRYINMLTRPRY 53 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1TZ5 A 1 ? 18 ? P01298 30 ? 47 ? 1 18 2 2 1TZ5 A 19 ? 23 ? P01304 28 ? 32 ? 19 23 3 3 1TZ5 A 24 ? 36 ? P01298 53 ? 65 ? 24 36 # _struct_ref_seq_dif.align_id 3 _struct_ref_seq_dif.pdbx_pdb_id_code 1TZ5 _struct_ref_seq_dif.mon_id NH2 _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 37 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P01298 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details amidation _struct_ref_seq_dif.pdbx_auth_seq_num 37 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 100 ? 1 MORE 0 ? 1 'SSA (A^2)' 4720 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 13 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id THR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 32 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 13 _struct_conf.end_auth_comp_id THR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 32 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id TYR _struct_conn.ptnr1_label_seq_id 36 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id NH2 _struct_conn.ptnr2_label_seq_id 37 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id TYR _struct_conn.ptnr1_auth_seq_id 36 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id NH2 _struct_conn.ptnr2_auth_seq_id 37 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.320 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id NH2 _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 37 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id TYR _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 36 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id NH2 _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 37 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id TYR _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 36 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id TYR _pdbx_modification_feature.ref_pcm_id 5 _pdbx_modification_feature.ref_comp_id NH2 _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Terminal amidation' # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NH2 _struct_site.pdbx_auth_seq_id 37 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 1 _struct_site.details 'BINDING SITE FOR RESIDUE NH2 A 37' # _struct_site_gen.id 1 _struct_site_gen.site_id AC1 _struct_site_gen.pdbx_num_res 1 _struct_site_gen.label_comp_id TYR _struct_site_gen.label_asym_id A _struct_site_gen.label_seq_id 36 _struct_site_gen.pdbx_auth_ins_code ? _struct_site_gen.auth_comp_id TYR _struct_site_gen.auth_asym_id A _struct_site_gen.auth_seq_id 36 _struct_site_gen.label_atom_id . _struct_site_gen.label_alt_id ? _struct_site_gen.symmetry 1_555 _struct_site_gen.details ? # _pdbx_entry_details.entry_id 1TZ5 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 13 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.34 120.30 3.04 0.50 N 2 18 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH1 A ARG 35 ? ? 123.43 120.30 3.13 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 3 ? ? -168.12 92.68 2 1 VAL A 6 ? ? 64.36 152.87 3 1 TYR A 7 ? ? 58.92 78.99 4 1 ASN A 11 ? ? 66.43 100.55 5 2 VAL A 6 ? ? 64.70 156.63 6 2 ASP A 10 ? ? 65.56 87.77 7 2 ALA A 12 ? ? 60.16 90.64 8 2 ARG A 35 ? ? -167.19 89.10 9 3 GLU A 4 ? ? -46.09 151.54 10 3 PRO A 5 ? ? -68.99 1.97 11 3 VAL A 6 ? ? 58.69 12.65 12 3 TYR A 7 ? ? -151.38 87.77 13 3 ASP A 10 ? ? 62.12 175.77 14 3 ASN A 11 ? ? -155.21 70.11 15 3 THR A 13 ? ? -172.23 142.23 16 3 ARG A 33 ? ? 63.12 146.72 17 4 LEU A 3 ? ? -161.66 116.28 18 4 TYR A 7 ? ? 51.28 77.37 19 4 ASN A 11 ? ? -59.29 -78.26 20 5 GLU A 4 ? ? 67.73 70.60 21 5 PRO A 5 ? ? -69.36 -168.23 22 5 VAL A 6 ? ? -46.30 154.99 23 5 TYR A 7 ? ? 62.32 163.11 24 5 ASP A 10 ? ? 63.19 177.78 25 5 ALA A 12 ? ? 55.43 -169.92 26 5 ARG A 35 ? ? -165.61 86.79 27 6 TYR A 7 ? ? -27.06 91.79 28 6 ASP A 10 ? ? 39.90 79.58 29 6 ASN A 11 ? ? 57.26 77.58 30 6 THR A 13 ? ? -52.89 103.72 31 6 ARG A 35 ? ? -164.32 -39.71 32 7 LEU A 3 ? ? 66.17 138.74 33 7 VAL A 6 ? ? 64.14 152.58 34 7 TYR A 7 ? ? 54.19 87.08 35 7 ARG A 35 ? ? 161.01 -75.63 36 8 PRO A 5 ? ? -69.53 -173.63 37 8 TYR A 7 ? ? -153.05 86.90 38 8 ASP A 10 ? ? 68.47 168.66 39 8 THR A 13 ? ? 84.96 155.51 40 8 THR A 32 ? ? -93.23 30.02 41 8 ARG A 35 ? ? -163.64 87.46 42 9 GLU A 15 ? ? 55.73 4.70 43 9 ARG A 35 ? ? -173.52 84.48 44 10 GLU A 4 ? ? 59.85 169.18 45 10 ASN A 11 ? ? -172.06 73.09 46 10 ALA A 12 ? ? 69.76 107.53 47 10 ARG A 33 ? ? -175.99 -60.21 48 10 ARG A 35 ? ? 165.22 -30.73 49 11 ASN A 11 ? ? 65.98 119.19 50 11 ALA A 12 ? ? -64.98 -170.40 51 11 GLU A 15 ? ? 61.41 -8.52 52 12 PRO A 2 ? ? -70.10 -79.05 53 12 LEU A 3 ? ? -169.14 38.28 54 12 VAL A 6 ? ? 47.36 -153.25 55 12 ARG A 33 ? ? -167.59 -55.31 56 12 ARG A 35 ? ? -174.28 -37.79 57 13 ASP A 10 ? ? 64.63 87.53 58 13 ARG A 35 ? ? 62.34 74.41 59 14 LEU A 3 ? ? 60.97 115.85 60 14 ASP A 10 ? ? 58.05 85.55 61 14 ASN A 11 ? ? -164.02 86.78 62 14 ARG A 33 ? ? 60.37 143.29 63 15 TYR A 7 ? ? -163.86 83.40 64 15 ASP A 10 ? ? 48.78 80.25 65 15 ASN A 11 ? ? -76.26 -90.50 66 16 GLU A 4 ? ? 173.34 -54.17 67 16 TYR A 7 ? ? 54.88 83.36 68 16 THR A 13 ? ? 52.60 140.79 69 16 ARG A 35 ? ? 72.41 -7.08 70 17 GLU A 4 ? ? 157.04 -62.85 71 17 VAL A 6 ? ? 67.96 148.49 72 17 ASN A 11 ? ? -150.22 86.38 73 17 THR A 13 ? ? 52.74 141.14 74 17 ARG A 35 ? ? -160.56 85.86 75 18 TYR A 7 ? ? -36.40 96.93 76 18 ASP A 10 ? ? 58.75 92.25 77 18 ASN A 11 ? ? 58.54 94.81 78 18 ARG A 33 ? ? 63.70 145.81 79 19 GLU A 4 ? ? 69.57 82.36 80 19 ASP A 10 ? ? 58.06 162.67 81 19 ASN A 11 ? ? 47.01 85.10 82 19 THR A 13 ? ? 52.81 140.76 83 20 GLU A 4 ? ? -43.22 101.90 84 20 VAL A 6 ? ? 46.08 -144.83 85 20 TYR A 7 ? ? 54.91 76.59 86 20 ASN A 11 ? ? 156.35 -26.12 87 20 ALA A 12 ? ? 50.00 -164.74 88 20 GLU A 15 ? ? 60.47 -6.69 89 20 ARG A 33 ? ? 60.99 143.43 # _pdbx_nmr_ensemble.entry_id 1TZ5 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry, structures with favorable non-bond energy, structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1TZ5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '2mM [pNPY19-23]-hPP; 90% H2O, 10% D2O' '300mM D-38 DPC' 2 '2mM [pNPY19-23]-hPP; 99% D2O' '300mM D-38 DPC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 2 1 '2D NOESY' # _pdbx_nmr_refine.entry_id 1TZ5 _pdbx_nmr_refine.method 'Torsion angle dynamics followed by refinement in AMBER6' _pdbx_nmr_refine.details 'further refinement using the program AMBER (explicit solvent)' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection ? 1 XwinNMR 2.6 processing ? 2 XEASY 1.53 'data analysis' Bartels 3 DYANA 1.5 'structure solution' Guentert 4 DYANA 1.5 refinement Guentert 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 MET N N N N 167 MET CA C N S 168 MET C C N N 169 MET O O N N 170 MET CB C N N 171 MET CG C N N 172 MET SD S N N 173 MET CE C N N 174 MET OXT O N N 175 MET H H N N 176 MET H2 H N N 177 MET HA H N N 178 MET HB2 H N N 179 MET HB3 H N N 180 MET HG2 H N N 181 MET HG3 H N N 182 MET HE1 H N N 183 MET HE2 H N N 184 MET HE3 H N N 185 MET HXT H N N 186 NH2 N N N N 187 NH2 HN1 H N N 188 NH2 HN2 H N N 189 PRO N N N N 190 PRO CA C N S 191 PRO C C N N 192 PRO O O N N 193 PRO CB C N N 194 PRO CG C N N 195 PRO CD C N N 196 PRO OXT O N N 197 PRO H H N N 198 PRO HA H N N 199 PRO HB2 H N N 200 PRO HB3 H N N 201 PRO HG2 H N N 202 PRO HG3 H N N 203 PRO HD2 H N N 204 PRO HD3 H N N 205 PRO HXT H N N 206 SER N N N N 207 SER CA C N S 208 SER C C N N 209 SER O O N N 210 SER CB C N N 211 SER OG O N N 212 SER OXT O N N 213 SER H H N N 214 SER H2 H N N 215 SER HA H N N 216 SER HB2 H N N 217 SER HB3 H N N 218 SER HG H N N 219 SER HXT H N N 220 THR N N N N 221 THR CA C N S 222 THR C C N N 223 THR O O N N 224 THR CB C N R 225 THR OG1 O N N 226 THR CG2 C N N 227 THR OXT O N N 228 THR H H N N 229 THR H2 H N N 230 THR HA H N N 231 THR HB H N N 232 THR HG1 H N N 233 THR HG21 H N N 234 THR HG22 H N N 235 THR HG23 H N N 236 THR HXT H N N 237 TYR N N N N 238 TYR CA C N S 239 TYR C C N N 240 TYR O O N N 241 TYR CB C N N 242 TYR CG C Y N 243 TYR CD1 C Y N 244 TYR CD2 C Y N 245 TYR CE1 C Y N 246 TYR CE2 C Y N 247 TYR CZ C Y N 248 TYR OH O N N 249 TYR OXT O N N 250 TYR H H N N 251 TYR H2 H N N 252 TYR HA H N N 253 TYR HB2 H N N 254 TYR HB3 H N N 255 TYR HD1 H N N 256 TYR HD2 H N N 257 TYR HE1 H N N 258 TYR HE2 H N N 259 TYR HH H N N 260 TYR HXT H N N 261 VAL N N N N 262 VAL CA C N S 263 VAL C C N N 264 VAL O O N N 265 VAL CB C N N 266 VAL CG1 C N N 267 VAL CG2 C N N 268 VAL OXT O N N 269 VAL H H N N 270 VAL H2 H N N 271 VAL HA H N N 272 VAL HB H N N 273 VAL HG11 H N N 274 VAL HG12 H N N 275 VAL HG13 H N N 276 VAL HG21 H N N 277 VAL HG22 H N N 278 VAL HG23 H N N 279 VAL HXT H N N 280 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 MET N CA sing N N 158 MET N H sing N N 159 MET N H2 sing N N 160 MET CA C sing N N 161 MET CA CB sing N N 162 MET CA HA sing N N 163 MET C O doub N N 164 MET C OXT sing N N 165 MET CB CG sing N N 166 MET CB HB2 sing N N 167 MET CB HB3 sing N N 168 MET CG SD sing N N 169 MET CG HG2 sing N N 170 MET CG HG3 sing N N 171 MET SD CE sing N N 172 MET CE HE1 sing N N 173 MET CE HE2 sing N N 174 MET CE HE3 sing N N 175 MET OXT HXT sing N N 176 NH2 N HN1 sing N N 177 NH2 N HN2 sing N N 178 PRO N CA sing N N 179 PRO N CD sing N N 180 PRO N H sing N N 181 PRO CA C sing N N 182 PRO CA CB sing N N 183 PRO CA HA sing N N 184 PRO C O doub N N 185 PRO C OXT sing N N 186 PRO CB CG sing N N 187 PRO CB HB2 sing N N 188 PRO CB HB3 sing N N 189 PRO CG CD sing N N 190 PRO CG HG2 sing N N 191 PRO CG HG3 sing N N 192 PRO CD HD2 sing N N 193 PRO CD HD3 sing N N 194 PRO OXT HXT sing N N 195 SER N CA sing N N 196 SER N H sing N N 197 SER N H2 sing N N 198 SER CA C sing N N 199 SER CA CB sing N N 200 SER CA HA sing N N 201 SER C O doub N N 202 SER C OXT sing N N 203 SER CB OG sing N N 204 SER CB HB2 sing N N 205 SER CB HB3 sing N N 206 SER OG HG sing N N 207 SER OXT HXT sing N N 208 THR N CA sing N N 209 THR N H sing N N 210 THR N H2 sing N N 211 THR CA C sing N N 212 THR CA CB sing N N 213 THR CA HA sing N N 214 THR C O doub N N 215 THR C OXT sing N N 216 THR CB OG1 sing N N 217 THR CB CG2 sing N N 218 THR CB HB sing N N 219 THR OG1 HG1 sing N N 220 THR CG2 HG21 sing N N 221 THR CG2 HG22 sing N N 222 THR CG2 HG23 sing N N 223 THR OXT HXT sing N N 224 TYR N CA sing N N 225 TYR N H sing N N 226 TYR N H2 sing N N 227 TYR CA C sing N N 228 TYR CA CB sing N N 229 TYR CA HA sing N N 230 TYR C O doub N N 231 TYR C OXT sing N N 232 TYR CB CG sing N N 233 TYR CB HB2 sing N N 234 TYR CB HB3 sing N N 235 TYR CG CD1 doub Y N 236 TYR CG CD2 sing Y N 237 TYR CD1 CE1 sing Y N 238 TYR CD1 HD1 sing N N 239 TYR CD2 CE2 doub Y N 240 TYR CD2 HD2 sing N N 241 TYR CE1 CZ doub Y N 242 TYR CE1 HE1 sing N N 243 TYR CE2 CZ sing Y N 244 TYR CE2 HE2 sing N N 245 TYR CZ OH sing N N 246 TYR OH HH sing N N 247 TYR OXT HXT sing N N 248 VAL N CA sing N N 249 VAL N H sing N N 250 VAL N H2 sing N N 251 VAL CA C sing N N 252 VAL CA CB sing N N 253 VAL CA HA sing N N 254 VAL C O doub N N 255 VAL C OXT sing N N 256 VAL CB CG1 sing N N 257 VAL CB CG2 sing N N 258 VAL CB HB sing N N 259 VAL CG1 HG11 sing N N 260 VAL CG1 HG12 sing N N 261 VAL CG1 HG13 sing N N 262 VAL CG2 HG21 sing N N 263 VAL CG2 HG22 sing N N 264 VAL CG2 HG23 sing N N 265 VAL OXT HXT sing N N 266 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 600 2 ? Bruker AVANCE 700 # _atom_sites.entry_id 1TZ5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_