data_1U37 # _entry.id 1U37 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1U37 pdb_00001u37 10.2210/pdb1u37/pdb RCSB RCSB023187 ? ? WWPDB D_1000023187 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-07-26 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1U37 _pdbx_database_status.recvd_initial_deposition_date 2004-07-21 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1U38 'The same protein complex with C-peptide, 20 structures' unspecified PDB 1U39 'The same protein, PDZ2 domain, 20 structures' unspecified PDB 1U3B 'The same protein, PDZ12C domain, minimized average structure' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Feng, W.' 1 'Long, J.-F.' 2 'Chan, L.-N.' 3 'He, C.' 4 'Fu, A.' 5 'Xia, J.' 6 'Ip, N.Y.' 7 'Zhang, M.' 8 # _citation.id primary _citation.title 'Autoinhibition of X11/Mint scaffold proteins revealed by the closed conformation of the PDZ tandem' _citation.journal_abbrev Nat.Struct.Mol.Biol. _citation.journal_volume 12 _citation.page_first 722 _citation.page_last 728 _citation.year 2005 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1545-9993 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16007100 _citation.pdbx_database_id_DOI 10.1038/nsmb958 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Long, J.-F.' 1 ? primary 'Feng, W.' 2 ? primary 'Wang, R.' 3 ? primary 'Chan, L.-N.' 4 ? primary 'Ip, F.C.' 5 ? primary 'Xia, J.' 6 ? primary 'Ip, N.Y.' 7 ? primary 'Zhang, M.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'amyloid beta A4 precursor protein-binding, family A, member 1' _entity.formula_weight 9557.253 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'PDZ1 domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;X11alpha/Mint1, phosphotyrosine-binding/-interacting domain (PTB)-bearing protein, neuronal munc18-1-interacting protein 1, neuron-specific X11 protein, adaptor protein X11alpha ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EFKDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQ SRVKLNIVR ; _entity_poly.pdbx_seq_one_letter_code_can ;EFKDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQ SRVKLNIVR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 PHE n 1 3 LYS n 1 4 ASP n 1 5 VAL n 1 6 PHE n 1 7 ILE n 1 8 GLU n 1 9 LYS n 1 10 GLN n 1 11 LYS n 1 12 GLY n 1 13 GLU n 1 14 ILE n 1 15 LEU n 1 16 GLY n 1 17 VAL n 1 18 VAL n 1 19 ILE n 1 20 VAL n 1 21 GLU n 1 22 SER n 1 23 GLY n 1 24 TRP n 1 25 GLY n 1 26 SER n 1 27 ILE n 1 28 LEU n 1 29 PRO n 1 30 THR n 1 31 VAL n 1 32 ILE n 1 33 ILE n 1 34 ALA n 1 35 ASN n 1 36 MET n 1 37 MET n 1 38 HIS n 1 39 GLY n 1 40 GLY n 1 41 PRO n 1 42 ALA n 1 43 GLU n 1 44 LYS n 1 45 SER n 1 46 GLY n 1 47 LYS n 1 48 LEU n 1 49 ASN n 1 50 ILE n 1 51 GLY n 1 52 ASP n 1 53 GLN n 1 54 ILE n 1 55 MET n 1 56 SER n 1 57 ILE n 1 58 ASN n 1 59 GLY n 1 60 THR n 1 61 SER n 1 62 LEU n 1 63 VAL n 1 64 GLY n 1 65 LEU n 1 66 PRO n 1 67 LEU n 1 68 SER n 1 69 THR n 1 70 CYS n 1 71 GLN n 1 72 SER n 1 73 ILE n 1 74 ILE n 1 75 LYS n 1 76 GLY n 1 77 LEU n 1 78 LYS n 1 79 ASN n 1 80 GLN n 1 81 SER n 1 82 ARG n 1 83 VAL n 1 84 LYS n 1 85 LEU n 1 86 ASN n 1 87 ILE n 1 88 VAL n 1 89 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET32a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 17 17 GLU GLU A . n A 1 2 PHE 2 18 18 PHE PHE A . n A 1 3 LYS 3 19 19 LYS LYS A . n A 1 4 ASP 4 20 20 ASP ASP A . n A 1 5 VAL 5 21 21 VAL VAL A . n A 1 6 PHE 6 22 22 PHE PHE A . n A 1 7 ILE 7 23 23 ILE ILE A . n A 1 8 GLU 8 24 24 GLU GLU A . n A 1 9 LYS 9 25 25 LYS LYS A . n A 1 10 GLN 10 26 26 GLN GLN A . n A 1 11 LYS 11 27 27 LYS LYS A . n A 1 12 GLY 12 28 28 GLY GLY A . n A 1 13 GLU 13 29 29 GLU GLU A . n A 1 14 ILE 14 30 30 ILE ILE A . n A 1 15 LEU 15 31 31 LEU LEU A . n A 1 16 GLY 16 32 32 GLY GLY A . n A 1 17 VAL 17 33 33 VAL VAL A . n A 1 18 VAL 18 34 34 VAL VAL A . n A 1 19 ILE 19 35 35 ILE ILE A . n A 1 20 VAL 20 36 36 VAL VAL A . n A 1 21 GLU 21 37 37 GLU GLU A . n A 1 22 SER 22 38 38 SER SER A . n A 1 23 GLY 23 39 39 GLY GLY A . n A 1 24 TRP 24 40 40 TRP TRP A . n A 1 25 GLY 25 41 41 GLY GLY A . n A 1 26 SER 26 42 42 SER SER A . n A 1 27 ILE 27 43 43 ILE ILE A . n A 1 28 LEU 28 44 44 LEU LEU A . n A 1 29 PRO 29 45 45 PRO PRO A . n A 1 30 THR 30 46 46 THR THR A . n A 1 31 VAL 31 47 47 VAL VAL A . n A 1 32 ILE 32 48 48 ILE ILE A . n A 1 33 ILE 33 49 49 ILE ILE A . n A 1 34 ALA 34 50 50 ALA ALA A . n A 1 35 ASN 35 51 51 ASN ASN A . n A 1 36 MET 36 52 52 MET MET A . n A 1 37 MET 37 53 53 MET MET A . n A 1 38 HIS 38 54 54 HIS HIS A . n A 1 39 GLY 39 55 55 GLY GLY A . n A 1 40 GLY 40 56 56 GLY GLY A . n A 1 41 PRO 41 57 57 PRO PRO A . n A 1 42 ALA 42 58 58 ALA ALA A . n A 1 43 GLU 43 59 59 GLU GLU A . n A 1 44 LYS 44 60 60 LYS LYS A . n A 1 45 SER 45 61 61 SER SER A . n A 1 46 GLY 46 62 62 GLY GLY A . n A 1 47 LYS 47 63 63 LYS LYS A . n A 1 48 LEU 48 64 64 LEU LEU A . n A 1 49 ASN 49 65 65 ASN ASN A . n A 1 50 ILE 50 66 66 ILE ILE A . n A 1 51 GLY 51 67 67 GLY GLY A . n A 1 52 ASP 52 68 68 ASP ASP A . n A 1 53 GLN 53 69 69 GLN GLN A . n A 1 54 ILE 54 70 70 ILE ILE A . n A 1 55 MET 55 71 71 MET MET A . n A 1 56 SER 56 72 72 SER SER A . n A 1 57 ILE 57 73 73 ILE ILE A . n A 1 58 ASN 58 74 74 ASN ASN A . n A 1 59 GLY 59 75 75 GLY GLY A . n A 1 60 THR 60 76 76 THR THR A . n A 1 61 SER 61 77 77 SER SER A . n A 1 62 LEU 62 78 78 LEU LEU A . n A 1 63 VAL 63 79 79 VAL VAL A . n A 1 64 GLY 64 80 80 GLY GLY A . n A 1 65 LEU 65 81 81 LEU LEU A . n A 1 66 PRO 66 82 82 PRO PRO A . n A 1 67 LEU 67 83 83 LEU LEU A . n A 1 68 SER 68 84 84 SER SER A . n A 1 69 THR 69 85 85 THR THR A . n A 1 70 CYS 70 86 86 CYS CYS A . n A 1 71 GLN 71 87 87 GLN GLN A . n A 1 72 SER 72 88 88 SER SER A . n A 1 73 ILE 73 89 89 ILE ILE A . n A 1 74 ILE 74 90 90 ILE ILE A . n A 1 75 LYS 75 91 91 LYS LYS A . n A 1 76 GLY 76 92 92 GLY GLY A . n A 1 77 LEU 77 93 93 LEU LEU A . n A 1 78 LYS 78 94 94 LYS LYS A . n A 1 79 ASN 79 95 95 ASN ASN A . n A 1 80 GLN 80 96 96 GLN GLN A . n A 1 81 SER 81 97 97 SER SER A . n A 1 82 ARG 82 98 98 ARG ARG A . n A 1 83 VAL 83 99 99 VAL VAL A . n A 1 84 LYS 84 100 100 LYS LYS A . n A 1 85 LEU 85 101 101 LEU LEU A . n A 1 86 ASN 86 102 102 ASN ASN A . n A 1 87 ILE 87 103 103 ILE ILE A . n A 1 88 VAL 88 104 104 VAL VAL A . n A 1 89 ARG 89 105 105 ARG ARG A . n # _exptl.entry_id 1U37 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1U37 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1U37 _struct.title 'Auto-inhibition Mechanism of X11s/Mints Family Scaffold Proteins Revealed by the Closed Conformation of the Tandem PDZ Domains' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1U37 _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' _struct_keywords.text 'X11s/Mints, PDZ domain, scaffold protein, protein trafficking, PROTEIN TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code APBA1_HUMAN _struct_ref.pdbx_db_accession Q02410 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQSR VKLNIVR ; _struct_ref.pdbx_align_begin 655 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1U37 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q02410 _struct_ref_seq.db_align_beg 655 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 741 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 19 _struct_ref_seq.pdbx_auth_seq_align_end 105 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1U37 GLU A 1 ? UNP Q02410 ? ? 'cloning artifact' 17 1 1 1U37 PHE A 2 ? UNP Q02410 ? ? 'cloning artifact' 18 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 40 ? GLY A 46 ? GLY A 56 GLY A 62 1 ? 7 HELX_P HELX_P2 2 PRO A 66 ? GLY A 76 ? PRO A 82 GLY A 92 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 2 ? GLU A 8 ? PHE A 18 GLU A 24 A 2 ARG A 82 ? VAL A 88 ? ARG A 98 VAL A 104 A 3 GLN A 53 ? ILE A 57 ? GLN A 69 ILE A 73 A 4 THR A 60 ? SER A 61 ? THR A 76 SER A 77 B 1 VAL A 17 ? VAL A 20 ? VAL A 33 VAL A 36 B 2 ILE A 32 ? MET A 36 ? ILE A 48 MET A 52 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 5 ? N VAL A 21 O LEU A 85 ? O LEU A 101 A 2 3 O VAL A 88 ? O VAL A 104 N GLN A 53 ? N GLN A 69 A 3 4 N ILE A 57 ? N ILE A 73 O THR A 60 ? O THR A 76 B 1 2 N VAL A 18 ? N VAL A 34 O ASN A 35 ? O ASN A 51 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 37 ? ? -55.96 95.83 2 1 TRP A 40 ? ? -66.49 -179.74 3 1 ILE A 43 ? ? 45.55 -169.85 4 1 THR A 46 ? ? -162.50 -61.78 5 1 ILE A 49 ? ? -61.42 71.53 6 1 HIS A 54 ? ? -66.93 75.38 7 1 ILE A 66 ? ? -13.61 114.56 8 1 ASN A 74 ? ? 49.36 26.99 9 1 PRO A 82 ? ? -63.86 -176.37 10 1 LEU A 93 ? ? -93.16 36.29 11 1 ASN A 95 ? ? -116.82 61.38 12 1 SER A 97 ? ? 90.16 -19.07 13 2 ILE A 43 ? ? 49.33 -177.26 14 2 THR A 46 ? ? -148.91 -71.77 15 2 ILE A 49 ? ? -63.49 71.36 16 2 MET A 52 ? ? -171.86 129.51 17 2 LYS A 63 ? ? -136.39 -47.71 18 2 ILE A 66 ? ? -36.74 114.91 19 2 ASN A 74 ? ? 45.98 29.14 20 2 LEU A 93 ? ? -91.24 38.47 21 2 SER A 97 ? ? 81.49 -10.79 22 3 ILE A 43 ? ? 44.72 -168.07 23 3 THR A 46 ? ? -170.69 -62.42 24 3 ILE A 49 ? ? -61.42 70.81 25 3 HIS A 54 ? ? -67.42 75.53 26 3 ILE A 66 ? ? -35.14 116.09 27 3 VAL A 79 ? ? -59.54 109.26 28 3 LEU A 93 ? ? -92.51 41.51 29 3 ASN A 95 ? ? -116.74 61.71 30 3 SER A 97 ? ? 91.29 -18.51 31 4 THR A 46 ? ? -170.30 -64.69 32 4 ILE A 49 ? ? -62.59 70.64 33 4 HIS A 54 ? ? -55.41 103.39 34 4 ILE A 66 ? ? -38.01 126.20 35 4 ASN A 74 ? ? 36.42 34.76 36 4 VAL A 79 ? ? -55.94 107.05 37 4 LEU A 93 ? ? -99.56 38.94 38 5 ILE A 43 ? ? 44.98 -166.90 39 5 THR A 46 ? ? -144.82 -74.27 40 5 ILE A 49 ? ? -62.21 72.55 41 5 HIS A 54 ? ? -56.88 90.86 42 5 ILE A 66 ? ? -37.86 107.43 43 5 ASN A 74 ? ? 45.88 29.82 44 5 PRO A 82 ? ? -54.81 170.43 45 5 LEU A 93 ? ? -93.83 37.82 46 6 THR A 46 ? ? -175.14 -64.85 47 6 ILE A 49 ? ? -61.10 72.33 48 6 MET A 53 ? ? -54.00 98.70 49 6 ILE A 66 ? ? -30.61 113.03 50 6 PRO A 82 ? ? -52.03 -176.05 51 6 LEU A 93 ? ? -93.17 39.86 52 6 SER A 97 ? ? 76.68 -2.12 53 7 THR A 46 ? ? -141.14 -72.36 54 7 ILE A 49 ? ? -60.98 72.66 55 7 MET A 52 ? ? -166.77 117.86 56 7 ILE A 66 ? ? -28.38 114.98 57 7 ASN A 74 ? ? 46.97 29.04 58 7 LEU A 93 ? ? -88.15 46.84 59 8 LEU A 44 ? ? -55.72 109.21 60 8 THR A 46 ? ? -135.98 -70.69 61 8 ILE A 49 ? ? -64.75 70.64 62 8 ILE A 66 ? ? -34.76 124.78 63 8 PRO A 82 ? ? -52.04 -174.98 64 8 LEU A 93 ? ? -90.93 43.68 65 8 ASN A 95 ? ? -112.47 57.56 66 9 GLU A 37 ? ? -53.14 93.07 67 9 SER A 38 ? ? -61.58 83.51 68 9 SER A 42 ? ? -176.81 142.02 69 9 ILE A 43 ? ? 51.44 178.76 70 9 THR A 46 ? ? -141.59 -66.67 71 9 ILE A 49 ? ? -62.60 72.54 72 9 ILE A 66 ? ? -37.09 131.03 73 9 ASN A 74 ? ? 48.30 28.25 74 9 PRO A 82 ? ? -52.34 -176.34 75 9 LEU A 93 ? ? -93.92 37.49 76 10 THR A 46 ? ? -142.01 -72.19 77 10 ILE A 49 ? ? -61.52 73.61 78 10 MET A 52 ? ? -173.10 144.34 79 10 HIS A 54 ? ? -61.00 87.80 80 10 ILE A 66 ? ? -39.44 108.25 81 10 VAL A 79 ? ? -58.66 103.40 82 10 LEU A 93 ? ? -91.23 31.81 83 10 ASN A 95 ? ? -118.74 62.56 84 10 SER A 97 ? ? 78.90 -2.57 85 11 THR A 46 ? ? -155.83 -67.53 86 11 ILE A 49 ? ? -61.86 74.36 87 11 MET A 52 ? ? -171.55 128.93 88 11 ILE A 66 ? ? -36.38 109.25 89 11 LEU A 93 ? ? -93.69 33.67 90 12 TRP A 40 ? ? -113.65 -169.84 91 12 ILE A 43 ? ? 45.68 -168.96 92 12 THR A 46 ? ? -159.45 -58.89 93 12 ILE A 49 ? ? -60.27 72.43 94 12 HIS A 54 ? ? -62.77 83.16 95 12 LEU A 93 ? ? -94.06 37.36 96 12 SER A 97 ? ? 77.62 -2.34 97 13 LEU A 44 ? ? -57.45 109.16 98 13 THR A 46 ? ? -142.85 -75.04 99 13 ILE A 49 ? ? -64.18 73.25 100 13 ASN A 95 ? ? -119.79 62.70 101 13 SER A 97 ? ? 79.55 -3.24 102 14 LYS A 25 ? ? -129.89 -169.63 103 14 SER A 38 ? ? -61.61 97.36 104 14 THR A 46 ? ? -156.41 -66.20 105 14 ILE A 49 ? ? -60.54 71.26 106 14 ASN A 51 ? ? -177.46 145.00 107 14 HIS A 54 ? ? -64.00 81.28 108 14 ASN A 95 ? ? -119.83 62.43 109 14 SER A 97 ? ? 79.46 -2.06 110 15 LEU A 44 ? ? -57.14 109.12 111 15 THR A 46 ? ? -158.02 -59.82 112 15 ILE A 49 ? ? -62.70 71.85 113 15 ILE A 66 ? ? -33.34 122.36 114 15 ASN A 74 ? ? 46.13 29.56 115 15 SER A 97 ? ? 77.95 -0.55 116 16 GLU A 37 ? ? -54.79 93.68 117 16 ILE A 43 ? ? 45.72 -171.05 118 16 THR A 46 ? ? -141.64 -73.81 119 16 ILE A 49 ? ? -62.83 72.42 120 16 MET A 52 ? ? -171.76 131.78 121 16 LYS A 63 ? ? -121.12 -52.70 122 16 ILE A 66 ? ? -32.40 117.07 123 16 ASN A 74 ? ? 46.29 29.23 124 16 PRO A 82 ? ? -68.27 -179.58 125 17 ILE A 43 ? ? 47.96 -174.01 126 17 THR A 46 ? ? -163.73 -60.48 127 17 ILE A 49 ? ? -63.25 74.04 128 17 MET A 52 ? ? -170.85 122.71 129 17 ILE A 66 ? ? -37.17 110.50 130 17 ASN A 74 ? ? 46.46 28.74 131 17 LEU A 93 ? ? -91.93 38.28 132 17 SER A 97 ? ? 77.58 -4.14 133 18 SER A 38 ? ? -61.34 84.66 134 18 SER A 42 ? ? -174.68 147.26 135 18 ILE A 43 ? ? 44.83 -167.58 136 18 THR A 46 ? ? -161.80 -62.78 137 18 ILE A 49 ? ? -60.17 72.68 138 18 MET A 52 ? ? -171.66 125.41 139 18 ILE A 66 ? ? -33.69 113.70 140 18 ASN A 74 ? ? 48.01 28.34 141 18 LEU A 93 ? ? -99.57 31.70 142 19 THR A 46 ? ? -168.27 -61.76 143 19 ILE A 49 ? ? -61.38 71.58 144 19 ASN A 74 ? ? 48.59 27.89 145 19 PRO A 82 ? ? -61.19 -174.41 146 20 LEU A 44 ? ? -56.85 108.64 147 20 THR A 46 ? ? -130.62 -72.68 148 20 ILE A 49 ? ? -63.56 74.91 149 20 ILE A 66 ? ? -34.82 119.08 150 20 PRO A 82 ? ? -64.17 -179.84 151 20 LEU A 93 ? ? -92.59 30.91 152 20 ASN A 95 ? ? -143.91 58.08 153 20 SER A 97 ? ? 79.51 -4.73 # _pdbx_nmr_ensemble.entry_id 1U37 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1U37 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1.0mM unlabelled PDZ1 in 99.9% D2O; 100mM potassium phosphate' '99.9% D2O' 2 '1.0mM uniformly 15N labelled PDZ1 in 90% H2O, 10% D2O; 100mM potassium phosphate' '90% H2O/10% D2O' 3 '1.0mM uniformly 15N/13C labelled PDZ1 in 90% H2O, 10% D2O; 100mM potassium phosphate' '90% H2O/10% D2O' 4 '1.0mM uniformly 15N/13C labelled PDZ1 in 99.9% D2O; 100mM potassium phosphate' '99.9% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM potassium phosphate' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 2 1 3D_15N-separated_NOESY 3 3 1 'HNCO, HNCACB, CBCA(CO)NH' 4 4 1 3D_13C-separated_NOESY # _pdbx_nmr_refine.entry_id 1U37 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal CNS 1.1 'structure solution' 'Brunger, A.T.' 1 CNS 1.1 refinement 'Brunger, A.T.' 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 VAL N N N N 345 VAL CA C N S 346 VAL C C N N 347 VAL O O N N 348 VAL CB C N N 349 VAL CG1 C N N 350 VAL CG2 C N N 351 VAL OXT O N N 352 VAL H H N N 353 VAL H2 H N N 354 VAL HA H N N 355 VAL HB H N N 356 VAL HG11 H N N 357 VAL HG12 H N N 358 VAL HG13 H N N 359 VAL HG21 H N N 360 VAL HG22 H N N 361 VAL HG23 H N N 362 VAL HXT H N N 363 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 VAL N CA sing N N 332 VAL N H sing N N 333 VAL N H2 sing N N 334 VAL CA C sing N N 335 VAL CA CB sing N N 336 VAL CA HA sing N N 337 VAL C O doub N N 338 VAL C OXT sing N N 339 VAL CB CG1 sing N N 340 VAL CB CG2 sing N N 341 VAL CB HB sing N N 342 VAL CG1 HG11 sing N N 343 VAL CG1 HG12 sing N N 344 VAL CG1 HG13 sing N N 345 VAL CG2 HG21 sing N N 346 VAL CG2 HG22 sing N N 347 VAL CG2 HG23 sing N N 348 VAL OXT HXT sing N N 349 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 750 # _atom_sites.entry_id 1U37 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_