data_1UFW
# 
_entry.id   1UFW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.383 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1UFW         pdb_00001ufw 10.2210/pdb1ufw/pdb 
RCSB  RCSB005783   ?            ?                   
WWPDB D_1000005783 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-12-10 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-03-02 
5 'Structure model' 1 4 2023-12-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2            
2 4 'Structure model' pdbx_nmr_software     
3 4 'Structure model' pdbx_nmr_spectrometer 
4 4 'Structure model' pdbx_struct_assembly  
5 4 'Structure model' pdbx_struct_oper_list 
6 4 'Structure model' struct_ref_seq_dif    
7 5 'Structure model' chem_comp_atom        
8 5 'Structure model' chem_comp_bond        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_pdbx_nmr_software.name'             
4 4 'Structure model' '_pdbx_nmr_spectrometer.model'        
5 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1UFW 
_pdbx_database_status.recvd_initial_deposition_date   2003-06-10 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk002000339.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'He, F.'                                                 1  
'Muto, Y.'                                               2  
'Ushikoshi, R.'                                          3  
'Shirouzu, M.'                                           4  
'Terada, T.'                                             5  
'Kigawa, T.'                                             6  
'Inoue, M.'                                              7  
'Yabuki, T.'                                             8  
'Aoki, M.'                                               9  
'Seki, E.'                                               10 
'Matsuda, T.'                                            11 
'Hirota, H.'                                             12 
'Yoshida, M.'                                            13 
'Kobayashi, N.'                                          14 
'Tanaka, A.'                                             15 
'Osanai, T.'                                             16 
'Matsuo, Y.'                                             17 
'Ohara, O.'                                              18 
'Nagase, T.'                                             19 
'Kikuno, R.'                                             20 
'Nakayama, M.'                                           21 
'Yokoyama, S.'                                           22 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 23 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of RNP domain in Synaptojanin 2' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'He, F.'        1  ? 
primary 'Muto, Y.'      2  ? 
primary 'Ushikoshi, R.' 3  ? 
primary 'Shirouzu, M.'  4  ? 
primary 'Terada, T.'    5  ? 
primary 'Kigawa, T.'    6  ? 
primary 'Inoue, M.'     7  ? 
primary 'Yabuki, T.'    8  ? 
primary 'Aoki, M.'      9  ? 
primary 'Seki, E.'      10 ? 
primary 'Matsuda, T.'   11 ? 
primary 'Hirota, H.'    12 ? 
primary 'Yoshida, M.'   13 ? 
primary 'Kobayashi, N.' 14 ? 
primary 'Tanaka, A.'    15 ? 
primary 'Osanai, T.'    16 ? 
primary 'Matsuo, Y.'    17 ? 
primary 'Ohara, O.'     18 ? 
primary 'Nagase, T.'    19 ? 
primary 'Kikuno, R.'    20 ? 
primary 'Nakayama, M.'  21 ? 
primary 'Yokoyama, S.'  22 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Synaptojanin 2' 
_entity.formula_weight             9935.116 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    3.1.3.36 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'RNP domain' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGSSFQGPLDATVVVNLQSPTLEEKNEFPEDLRTELMQTLGSYGTIVLVRINQGQMLVTFADSHSALSVLDVDGM
KVKGRAVKISGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGSSFQGPLDATVVVNLQSPTLEEKNEFPEDLRTELMQTLGSYGTIVLVRINQGQMLVTFADSHSALSVLDVDGM
KVKGRAVKISGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk002000339.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  SER n 
1 9  SER n 
1 10 PHE n 
1 11 GLN n 
1 12 GLY n 
1 13 PRO n 
1 14 LEU n 
1 15 ASP n 
1 16 ALA n 
1 17 THR n 
1 18 VAL n 
1 19 VAL n 
1 20 VAL n 
1 21 ASN n 
1 22 LEU n 
1 23 GLN n 
1 24 SER n 
1 25 PRO n 
1 26 THR n 
1 27 LEU n 
1 28 GLU n 
1 29 GLU n 
1 30 LYS n 
1 31 ASN n 
1 32 GLU n 
1 33 PHE n 
1 34 PRO n 
1 35 GLU n 
1 36 ASP n 
1 37 LEU n 
1 38 ARG n 
1 39 THR n 
1 40 GLU n 
1 41 LEU n 
1 42 MET n 
1 43 GLN n 
1 44 THR n 
1 45 LEU n 
1 46 GLY n 
1 47 SER n 
1 48 TYR n 
1 49 GLY n 
1 50 THR n 
1 51 ILE n 
1 52 VAL n 
1 53 LEU n 
1 54 VAL n 
1 55 ARG n 
1 56 ILE n 
1 57 ASN n 
1 58 GLN n 
1 59 GLY n 
1 60 GLN n 
1 61 MET n 
1 62 LEU n 
1 63 VAL n 
1 64 THR n 
1 65 PHE n 
1 66 ALA n 
1 67 ASP n 
1 68 SER n 
1 69 HIS n 
1 70 SER n 
1 71 ALA n 
1 72 LEU n 
1 73 SER n 
1 74 VAL n 
1 75 LEU n 
1 76 ASP n 
1 77 VAL n 
1 78 ASP n 
1 79 GLY n 
1 80 MET n 
1 81 LYS n 
1 82 VAL n 
1 83 LYS n 
1 84 GLY n 
1 85 ARG n 
1 86 ALA n 
1 87 VAL n 
1 88 LYS n 
1 89 ILE n 
1 90 SER n 
1 91 GLY n 
1 92 PRO n 
1 93 SER n 
1 94 SER n 
1 95 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'KAZUSA cDNA hg01551' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P021015-22 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  1  1  GLY GLY A . n 
A 1 2  SER 2  2  2  SER SER A . n 
A 1 3  SER 3  3  3  SER SER A . n 
A 1 4  GLY 4  4  4  GLY GLY A . n 
A 1 5  SER 5  5  5  SER SER A . n 
A 1 6  SER 6  6  6  SER SER A . n 
A 1 7  GLY 7  7  7  GLY GLY A . n 
A 1 8  SER 8  8  8  SER SER A . n 
A 1 9  SER 9  9  9  SER SER A . n 
A 1 10 PHE 10 10 10 PHE PHE A . n 
A 1 11 GLN 11 11 11 GLN GLN A . n 
A 1 12 GLY 12 12 12 GLY GLY A . n 
A 1 13 PRO 13 13 13 PRO PRO A . n 
A 1 14 LEU 14 14 14 LEU LEU A . n 
A 1 15 ASP 15 15 15 ASP ASP A . n 
A 1 16 ALA 16 16 16 ALA ALA A . n 
A 1 17 THR 17 17 17 THR THR A . n 
A 1 18 VAL 18 18 18 VAL VAL A . n 
A 1 19 VAL 19 19 19 VAL VAL A . n 
A 1 20 VAL 20 20 20 VAL VAL A . n 
A 1 21 ASN 21 21 21 ASN ASN A . n 
A 1 22 LEU 22 22 22 LEU LEU A . n 
A 1 23 GLN 23 23 23 GLN GLN A . n 
A 1 24 SER 24 24 24 SER SER A . n 
A 1 25 PRO 25 25 25 PRO PRO A . n 
A 1 26 THR 26 26 26 THR THR A . n 
A 1 27 LEU 27 27 27 LEU LEU A . n 
A 1 28 GLU 28 28 28 GLU GLU A . n 
A 1 29 GLU 29 29 29 GLU GLU A . n 
A 1 30 LYS 30 30 30 LYS LYS A . n 
A 1 31 ASN 31 31 31 ASN ASN A . n 
A 1 32 GLU 32 32 32 GLU GLU A . n 
A 1 33 PHE 33 33 33 PHE PHE A . n 
A 1 34 PRO 34 34 34 PRO PRO A . n 
A 1 35 GLU 35 35 35 GLU GLU A . n 
A 1 36 ASP 36 36 36 ASP ASP A . n 
A 1 37 LEU 37 37 37 LEU LEU A . n 
A 1 38 ARG 38 38 38 ARG ARG A . n 
A 1 39 THR 39 39 39 THR THR A . n 
A 1 40 GLU 40 40 40 GLU GLU A . n 
A 1 41 LEU 41 41 41 LEU LEU A . n 
A 1 42 MET 42 42 42 MET MET A . n 
A 1 43 GLN 43 43 43 GLN GLN A . n 
A 1 44 THR 44 44 44 THR THR A . n 
A 1 45 LEU 45 45 45 LEU LEU A . n 
A 1 46 GLY 46 46 46 GLY GLY A . n 
A 1 47 SER 47 47 47 SER SER A . n 
A 1 48 TYR 48 48 48 TYR TYR A . n 
A 1 49 GLY 49 49 49 GLY GLY A . n 
A 1 50 THR 50 50 50 THR THR A . n 
A 1 51 ILE 51 51 51 ILE ILE A . n 
A 1 52 VAL 52 52 52 VAL VAL A . n 
A 1 53 LEU 53 53 53 LEU LEU A . n 
A 1 54 VAL 54 54 54 VAL VAL A . n 
A 1 55 ARG 55 55 55 ARG ARG A . n 
A 1 56 ILE 56 56 56 ILE ILE A . n 
A 1 57 ASN 57 57 57 ASN ASN A . n 
A 1 58 GLN 58 58 58 GLN GLN A . n 
A 1 59 GLY 59 59 59 GLY GLY A . n 
A 1 60 GLN 60 60 60 GLN GLN A . n 
A 1 61 MET 61 61 61 MET MET A . n 
A 1 62 LEU 62 62 62 LEU LEU A . n 
A 1 63 VAL 63 63 63 VAL VAL A . n 
A 1 64 THR 64 64 64 THR THR A . n 
A 1 65 PHE 65 65 65 PHE PHE A . n 
A 1 66 ALA 66 66 66 ALA ALA A . n 
A 1 67 ASP 67 67 67 ASP ASP A . n 
A 1 68 SER 68 68 68 SER SER A . n 
A 1 69 HIS 69 69 69 HIS HIS A . n 
A 1 70 SER 70 70 70 SER SER A . n 
A 1 71 ALA 71 71 71 ALA ALA A . n 
A 1 72 LEU 72 72 72 LEU LEU A . n 
A 1 73 SER 73 73 73 SER SER A . n 
A 1 74 VAL 74 74 74 VAL VAL A . n 
A 1 75 LEU 75 75 75 LEU LEU A . n 
A 1 76 ASP 76 76 76 ASP ASP A . n 
A 1 77 VAL 77 77 77 VAL VAL A . n 
A 1 78 ASP 78 78 78 ASP ASP A . n 
A 1 79 GLY 79 79 79 GLY GLY A . n 
A 1 80 MET 80 80 80 MET MET A . n 
A 1 81 LYS 81 81 81 LYS LYS A . n 
A 1 82 VAL 82 82 82 VAL VAL A . n 
A 1 83 LYS 83 83 83 LYS LYS A . n 
A 1 84 GLY 84 84 84 GLY GLY A . n 
A 1 85 ARG 85 85 85 ARG ARG A . n 
A 1 86 ALA 86 86 86 ALA ALA A . n 
A 1 87 VAL 87 87 87 VAL VAL A . n 
A 1 88 LYS 88 88 88 LYS LYS A . n 
A 1 89 ILE 89 89 89 ILE ILE A . n 
A 1 90 SER 90 90 90 SER SER A . n 
A 1 91 GLY 91 91 91 GLY GLY A . n 
A 1 92 PRO 92 92 92 PRO PRO A . n 
A 1 93 SER 93 93 93 SER SER A . n 
A 1 94 SER 94 94 94 SER SER A . n 
A 1 95 GLY 95 95 95 GLY GLY A . n 
# 
_cell.entry_id           1UFW 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1UFW 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_exptl.entry_id          1UFW 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_database_PDB_matrix.entry_id          1UFW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1UFW 
_struct.title                     'Solution structure of RNP domain in Synaptojanin 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1UFW 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
_struct_keywords.text            
'RNP domain, Synaptojanin 2, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA binding protein' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SYNJ2_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SSFQGPLDATVVVNLQSPTLEEKNEFPEDLRTELMQTLGSYGTIVLVRINQGQMLVTFADSHSALSVLDVDGMKVKGRAV
KI
;
_struct_ref.pdbx_align_begin           829 
_struct_ref.pdbx_db_accession          O15056 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1UFW 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 89 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O15056 
_struct_ref_seq.db_align_beg                  829 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  910 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       89 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1UFW GLY A 1  ? UNP O15056 ? ? 'cloning artifact' 1  1  
1 1UFW SER A 2  ? UNP O15056 ? ? 'cloning artifact' 2  2  
1 1UFW SER A 3  ? UNP O15056 ? ? 'cloning artifact' 3  3  
1 1UFW GLY A 4  ? UNP O15056 ? ? 'cloning artifact' 4  4  
1 1UFW SER A 5  ? UNP O15056 ? ? 'cloning artifact' 5  5  
1 1UFW SER A 6  ? UNP O15056 ? ? 'cloning artifact' 6  6  
1 1UFW GLY A 7  ? UNP O15056 ? ? 'cloning artifact' 7  7  
1 1UFW SER A 90 ? UNP O15056 ? ? 'cloning artifact' 90 8  
1 1UFW GLY A 91 ? UNP O15056 ? ? 'cloning artifact' 91 9  
1 1UFW PRO A 92 ? UNP O15056 ? ? 'cloning artifact' 92 10 
1 1UFW SER A 93 ? UNP O15056 ? ? 'cloning artifact' 93 11 
1 1UFW SER A 94 ? UNP O15056 ? ? 'cloning artifact' 94 12 
1 1UFW GLY A 95 ? UNP O15056 ? ? 'cloning artifact' 95 13 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 4  ? GLY A 7  ? GLY A 4  GLY A 7  1 ? 4  
HELX_P HELX_P2 2 LEU A 27 ? ASN A 31 ? LEU A 27 ASN A 31 1 ? 5  
HELX_P HELX_P3 3 GLU A 35 ? TYR A 48 ? GLU A 35 TYR A 48 1 ? 14 
HELX_P HELX_P4 4 HIS A 69 ? VAL A 77 ? HIS A 69 VAL A 77 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 53 ? ASN A 57 ? LEU A 53 ASN A 57 
A 2 GLN A 60 ? THR A 64 ? GLN A 60 THR A 64 
A 3 THR A 17 ? LEU A 22 ? THR A 17 LEU A 22 
A 4 ARG A 85 ? SER A 90 ? ARG A 85 SER A 90 
A 5 LYS A 81 ? VAL A 82 ? LYS A 81 VAL A 82 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 53 ? N LEU A 53 O THR A 64 ? O THR A 64 
A 2 3 O VAL A 63 ? O VAL A 63 N VAL A 18 ? N VAL A 18 
A 3 4 N ASN A 21 ? N ASN A 21 O LYS A 88 ? O LYS A 88 
A 4 5 O ARG A 85 ? O ARG A 85 N VAL A 82 ? N VAL A 82 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1  O A VAL 77 ? ? H   A MET 80 ? ? 1.51 
2  1  O A THR 39 ? ? H   A GLN 43 ? ? 1.52 
3  1  O A THR 26 ? ? H   A LYS 30 ? ? 1.55 
4  1  O A SER 73 ? ? H   A VAL 77 ? ? 1.55 
5  1  O A ARG 38 ? ? H   A MET 42 ? ? 1.58 
6  2  O A VAL 77 ? ? H   A MET 80 ? ? 1.51 
7  2  O A SER 73 ? ? H   A VAL 77 ? ? 1.53 
8  2  O A THR 26 ? ? H   A LYS 30 ? ? 1.55 
9  2  O A ARG 38 ? ? H   A MET 42 ? ? 1.56 
10 3  O A VAL 77 ? ? H   A MET 80 ? ? 1.51 
11 3  O A THR 26 ? ? H   A LYS 30 ? ? 1.54 
12 3  O A SER 3  ? ? H   A GLY 7  ? ? 1.59 
13 4  O A VAL 77 ? ? H   A MET 80 ? ? 1.52 
14 4  O A THR 39 ? ? H   A GLN 43 ? ? 1.54 
15 4  O A GLU 40 ? ? HG1 A THR 44 ? ? 1.55 
16 5  O A THR 26 ? ? H   A LYS 30 ? ? 1.55 
17 5  O A ARG 38 ? ? H   A MET 42 ? ? 1.57 
18 5  H A VAL 19 ? ? O   A SER 90 ? ? 1.59 
19 6  O A VAL 77 ? ? H   A MET 80 ? ? 1.49 
20 6  O A THR 26 ? ? H   A LYS 30 ? ? 1.53 
21 6  O A THR 39 ? ? H   A GLN 43 ? ? 1.53 
22 7  O A VAL 77 ? ? H   A MET 80 ? ? 1.55 
23 7  O A SER 73 ? ? H   A VAL 77 ? ? 1.55 
24 7  O A MET 42 ? ? H   A GLY 46 ? ? 1.60 
25 8  O A VAL 77 ? ? H   A MET 80 ? ? 1.53 
26 8  O A THR 26 ? ? H   A LYS 30 ? ? 1.58 
27 9  O A VAL 77 ? ? H   A MET 80 ? ? 1.50 
28 10 O A THR 26 ? ? H   A LYS 30 ? ? 1.50 
29 10 O A VAL 77 ? ? H   A MET 80 ? ? 1.55 
30 11 O A ARG 38 ? ? H   A MET 42 ? ? 1.52 
31 11 O A VAL 77 ? ? H   A MET 80 ? ? 1.53 
32 11 H A VAL 19 ? ? O   A SER 90 ? ? 1.57 
33 12 O A VAL 77 ? ? H   A MET 80 ? ? 1.49 
34 12 O A SER 73 ? ? H   A VAL 77 ? ? 1.52 
35 13 O A VAL 77 ? ? H   A MET 80 ? ? 1.48 
36 13 O A ARG 38 ? ? H   A MET 42 ? ? 1.49 
37 13 O A THR 26 ? ? H   A LYS 30 ? ? 1.55 
38 14 O A VAL 77 ? ? H   A MET 80 ? ? 1.51 
39 14 O A ARG 38 ? ? H   A MET 42 ? ? 1.60 
40 15 O A VAL 77 ? ? H   A MET 80 ? ? 1.55 
41 15 O A THR 26 ? ? H   A LYS 30 ? ? 1.55 
42 16 O A VAL 77 ? ? H   A MET 80 ? ? 1.50 
43 16 O A THR 26 ? ? H   A LYS 30 ? ? 1.51 
44 17 O A VAL 77 ? ? H   A MET 80 ? ? 1.50 
45 17 O A ARG 38 ? ? H   A MET 42 ? ? 1.54 
46 17 O A THR 26 ? ? H   A LYS 30 ? ? 1.57 
47 18 O A SER 73 ? ? H   A VAL 77 ? ? 1.50 
48 18 O A VAL 77 ? ? H   A MET 80 ? ? 1.57 
49 18 O A ARG 38 ? ? H   A MET 42 ? ? 1.58 
50 19 O A VAL 77 ? ? H   A MET 80 ? ? 1.49 
51 20 O A VAL 77 ? ? H   A MET 80 ? ? 1.49 
52 20 O A THR 26 ? ? H   A LYS 30 ? ? 1.51 
53 20 O A ARG 38 ? ? H   A MET 42 ? ? 1.52 
54 20 O A GLU 28 ? ? H   A GLU 32 ? ? 1.54 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  PHE A 10 ? ? 45.92   94.74   
2   1  GLN A 11 ? ? -171.80 107.82  
3   1  ALA A 16 ? ? 71.22   43.41   
4   1  GLU A 32 ? ? -174.32 132.13  
5   1  PHE A 33 ? ? -39.02  132.50  
6   1  ARG A 38 ? ? -38.38  -75.22  
7   1  MET A 61 ? ? -151.78 89.94   
8   1  MET A 80 ? ? -45.06  169.93  
9   1  SER A 94 ? ? -168.33 116.42  
10  2  SER A 8  ? ? 62.39   87.05   
11  2  PHE A 10 ? ? 50.13   100.56  
12  2  GLN A 11 ? ? -140.43 -52.90  
13  2  ALA A 16 ? ? 81.68   36.41   
14  2  ARG A 38 ? ? -39.21  -75.19  
15  2  LEU A 53 ? ? 174.26  149.07  
16  2  GLN A 58 ? ? -26.07  -47.14  
17  2  SER A 93 ? ? 72.55   155.30  
18  3  SER A 2  ? ? -119.34 75.25   
19  3  SER A 3  ? ? -96.41  -61.35  
20  3  PHE A 10 ? ? 51.95   175.18  
21  3  GLN A 11 ? ? 59.50   86.51   
22  3  ALA A 16 ? ? 80.85   38.72   
23  3  ARG A 38 ? ? -41.18  -73.12  
24  3  TYR A 48 ? ? -37.77  -38.70  
25  3  LEU A 53 ? ? 173.48  148.32  
26  3  GLN A 60 ? ? 179.73  -173.33 
27  3  MET A 61 ? ? -167.62 103.34  
28  3  SER A 94 ? ? 67.14   86.00   
29  4  SER A 9  ? ? -96.74  -62.13  
30  4  PHE A 10 ? ? 40.40   74.62   
31  4  GLN A 11 ? ? -173.80 138.54  
32  4  ALA A 16 ? ? 79.59   37.76   
33  4  GLU A 32 ? ? -175.46 139.75  
34  4  ARG A 38 ? ? -66.58  -75.45  
35  4  THR A 44 ? ? -67.19  -71.51  
36  4  ILE A 51 ? ? -63.28  94.20   
37  4  GLN A 58 ? ? -26.14  -51.38  
38  4  MET A 80 ? ? -49.92  173.18  
39  4  PRO A 92 ? ? -74.97  -165.69 
40  4  SER A 94 ? ? 56.99   162.69  
41  5  SER A 8  ? ? -169.78 95.04   
42  5  PHE A 10 ? ? -168.15 -42.52  
43  5  ALA A 16 ? ? 71.26   57.27   
44  5  ARG A 38 ? ? -37.31  -75.42  
45  5  ILE A 51 ? ? -61.86  97.22   
46  5  LEU A 53 ? ? 174.13  152.84  
47  5  GLN A 58 ? ? -22.93  -51.98  
48  5  MET A 80 ? ? -40.34  160.04  
49  6  SER A 2  ? ? 178.44  -58.05  
50  6  SER A 8  ? ? -178.63 115.96  
51  6  PHE A 10 ? ? -171.89 143.85  
52  6  LEU A 14 ? ? -93.74  -63.97  
53  6  GLU A 32 ? ? 178.51  135.60  
54  6  ARG A 38 ? ? -37.63  -75.46  
55  6  THR A 44 ? ? -76.09  -74.06  
56  6  ILE A 51 ? ? -64.11  97.93   
57  6  GLN A 58 ? ? -20.93  -54.74  
58  6  MET A 80 ? ? -49.83  164.28  
59  6  PRO A 92 ? ? -74.98  -84.10  
60  7  SER A 2  ? ? -178.57 91.53   
61  7  SER A 8  ? ? 57.98   84.80   
62  7  PHE A 10 ? ? 58.53   109.14  
63  7  GLN A 11 ? ? 62.54   133.47  
64  7  ALA A 16 ? ? 71.08   48.40   
65  7  THR A 26 ? ? -113.79 -160.84 
66  7  GLU A 32 ? ? 177.77  137.91  
67  7  THR A 44 ? ? -59.71  -71.94  
68  7  LEU A 53 ? ? 178.04  149.21  
69  7  GLN A 58 ? ? -29.56  -42.25  
70  7  MET A 80 ? ? -39.55  160.18  
71  8  GLN A 11 ? ? -163.18 115.37  
72  8  ALA A 16 ? ? 75.15   72.54   
73  8  ARG A 38 ? ? -42.53  -74.37  
74  8  LEU A 53 ? ? 178.11  149.80  
75  8  GLN A 58 ? ? -29.83  -42.68  
76  8  MET A 80 ? ? -38.94  140.29  
77  9  SER A 8  ? ? 49.87   93.43   
78  9  PHE A 10 ? ? -177.26 120.73  
79  9  GLU A 32 ? ? -173.59 144.36  
80  9  ARG A 38 ? ? -58.30  -75.24  
81  9  GLN A 58 ? ? -19.12  -56.62  
82  9  MET A 80 ? ? -52.69  173.21  
83  9  SER A 93 ? ? -124.82 -67.66  
84  10 SER A 8  ? ? 47.79   79.48   
85  10 PHE A 10 ? ? 53.20   173.38  
86  10 ALA A 16 ? ? 74.93   43.76   
87  10 GLU A 32 ? ? -177.98 135.71  
88  10 ARG A 38 ? ? -41.68  -75.61  
89  10 LEU A 53 ? ? -176.11 148.49  
90  10 GLN A 58 ? ? -29.72  -44.76  
91  10 GLN A 60 ? ? -172.25 -175.18 
92  10 ASP A 78 ? ? -36.80  -37.26  
93  10 LYS A 83 ? ? 63.29   -68.49  
94  10 SER A 93 ? ? 61.88   76.40   
95  10 SER A 94 ? ? -59.31  109.00  
96  11 SER A 8  ? ? 57.39   79.59   
97  11 SER A 9  ? ? -91.86  -61.53  
98  11 PHE A 10 ? ? 48.10   97.75   
99  11 ILE A 51 ? ? -58.75  98.79   
100 11 LEU A 53 ? ? 177.57  157.04  
101 11 GLN A 58 ? ? -27.17  -46.54  
102 11 SER A 93 ? ? 46.81   90.70   
103 12 SER A 8  ? ? -116.83 77.05   
104 12 PHE A 10 ? ? -120.88 -55.39  
105 12 GLN A 11 ? ? -177.78 -58.35  
106 12 ASP A 15 ? ? -90.14  -64.43  
107 12 ALA A 16 ? ? 175.07  41.36   
108 12 THR A 44 ? ? -68.17  -71.78  
109 12 GLN A 58 ? ? -17.66  -57.92  
110 12 MET A 80 ? ? -50.85  176.91  
111 13 SER A 8  ? ? 53.25   88.28   
112 13 PHE A 10 ? ? 48.22   94.67   
113 13 ALA A 16 ? ? 78.25   44.21   
114 13 LEU A 37 ? ? -94.89  -60.26  
115 13 LEU A 53 ? ? 171.04  148.89  
116 13 GLN A 58 ? ? -24.20  -57.14  
117 13 MET A 80 ? ? -38.60  151.22  
118 13 SER A 93 ? ? 165.83  -45.02  
119 13 SER A 94 ? ? 169.61  72.49   
120 14 SER A 2  ? ? 41.40   81.78   
121 14 SER A 8  ? ? 51.25   83.31   
122 14 PHE A 10 ? ? 38.10   91.51   
123 14 GLN A 11 ? ? 58.28   162.71  
124 14 ALA A 16 ? ? 176.53  42.72   
125 14 GLU A 32 ? ? -177.24 140.21  
126 14 ARG A 38 ? ? -43.76  -73.40  
127 14 TYR A 48 ? ? -43.20  -76.96  
128 14 ILE A 51 ? ? -59.41  97.10   
129 14 LEU A 53 ? ? 171.19  151.92  
130 14 GLN A 58 ? ? -18.97  -56.35  
131 14 MET A 80 ? ? -39.84  150.52  
132 14 SER A 90 ? ? -116.23 -165.37 
133 14 SER A 93 ? ? 69.25   -72.16  
134 15 SER A 2  ? ? 59.52   108.92  
135 15 SER A 8  ? ? -157.68 79.62   
136 15 PHE A 10 ? ? -154.45 -55.52  
137 15 GLN A 11 ? ? 39.68   80.40   
138 15 ALA A 16 ? ? 76.49   41.47   
139 15 ARG A 38 ? ? -37.91  -74.85  
140 15 LEU A 53 ? ? 178.27  154.39  
141 15 GLN A 58 ? ? -21.54  -52.93  
142 15 ASP A 78 ? ? -34.94  -36.06  
143 15 MET A 80 ? ? -44.63  170.32  
144 15 SER A 94 ? ? -165.30 85.93   
145 16 SER A 8  ? ? 56.32   85.90   
146 16 PHE A 10 ? ? 41.85   93.11   
147 16 GLN A 11 ? ? -107.46 78.89   
148 16 ALA A 16 ? ? 80.79   41.64   
149 16 GLU A 32 ? ? -178.42 145.35  
150 16 LEU A 53 ? ? 173.40  142.39  
151 16 GLN A 60 ? ? 179.60  -171.84 
152 16 MET A 80 ? ? -45.59  172.56  
153 16 SER A 93 ? ? -176.71 -62.58  
154 16 SER A 94 ? ? 174.65  82.27   
155 17 SER A 2  ? ? -166.58 96.61   
156 17 SER A 8  ? ? 39.83   84.28   
157 17 SER A 9  ? ? -96.44  -61.25  
158 17 PHE A 10 ? ? 50.86   101.06  
159 17 LEU A 14 ? ? -93.47  -65.32  
160 17 GLU A 32 ? ? -178.20 136.85  
161 17 LEU A 37 ? ? -95.49  -60.23  
162 17 LEU A 53 ? ? -174.43 130.01  
163 17 GLN A 58 ? ? -28.35  -44.31  
164 17 MET A 80 ? ? -45.53  167.75  
165 17 SER A 93 ? ? 60.50   70.04   
166 17 SER A 94 ? ? -154.45 -56.75  
167 18 SER A 8  ? ? 59.63   78.48   
168 18 ALA A 16 ? ? 83.89   31.15   
169 18 PRO A 25 ? ? -75.03  -168.91 
170 18 PHE A 33 ? ? -37.87  140.23  
171 18 LEU A 37 ? ? -95.49  -62.20  
172 18 LEU A 53 ? ? -172.92 141.11  
173 18 GLN A 58 ? ? -26.79  -46.83  
174 18 PRO A 92 ? ? -75.07  -165.10 
175 19 SER A 2  ? ? 40.85   89.06   
176 19 SER A 8  ? ? 62.30   82.26   
177 19 PHE A 10 ? ? 54.34   94.70   
178 19 GLN A 11 ? ? 175.17  166.24  
179 19 LEU A 14 ? ? -94.11  -69.61  
180 19 ALA A 16 ? ? 174.20  40.32   
181 19 THR A 26 ? ? -87.69  -156.87 
182 19 GLU A 32 ? ? -176.26 126.35  
183 19 THR A 50 ? ? -151.01 19.22   
184 19 ILE A 51 ? ? 36.08   89.12   
185 19 LEU A 53 ? ? 177.48  152.79  
186 19 GLN A 58 ? ? -21.38  -54.47  
187 19 SER A 93 ? ? -177.84 -172.24 
188 20 PHE A 10 ? ? 52.72   88.07   
189 20 GLN A 11 ? ? 179.46  98.24   
190 20 ALA A 16 ? ? 64.85   71.13   
191 20 THR A 26 ? ? -102.18 -168.55 
192 20 GLU A 32 ? ? -177.88 133.69  
193 20 PHE A 33 ? ? -37.72  136.78  
194 20 ARG A 38 ? ? -38.22  -75.82  
195 20 LEU A 53 ? ? 179.71  148.75  
196 20 GLN A 58 ? ? -26.73  -46.96  
197 20 SER A 70 ? ? -57.90  -71.82  
198 20 ALA A 71 ? ? -38.45  -38.50  
199 20 MET A 80 ? ? -44.42  168.93  
200 20 SER A 94 ? ? -161.74 -44.30  
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'RIKEN Structural Genomics/Proteomics Initiative' 
_pdbx_SG_project.initial_of_center     RSGI 
# 
_pdbx_database_remark.id     650 
_pdbx_database_remark.text   
;HELIX
determination method: author determined
;
# 
_pdbx_nmr_ensemble.entry_id                                      1UFW 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations, structures with the lowest energy, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1UFW 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.1mM RNP domain U-15N, 13C; 20mM phosphate buffer NA(pH 6.0); 100mM NaCl; 0.02% NaN3; 90% H2O, 10% D2O;' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_15N-separated_NOESY 
2 1 1 3D_13C-separated_NOESY 
# 
_pdbx_nmr_refine.entry_id           1UFW 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XwinNMR 2.6      collection           Bruker          1 
NMRPipe 20020425 processing           'Delaglio, F.'  2 
NMRView 5.0.4    'data analysis'      'Johnson, B.A.' 3 
KUJIRA  0.811    'data analysis'      'Kobayashi, N.' 4 
CYANA   1.0.7    'structure solution' 'Guentert, P.'  5 
CYANA   1.0.7    refinement           'Guentert, P.'  6 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
GLN N    N N N 74  
GLN CA   C N S 75  
GLN C    C N N 76  
GLN O    O N N 77  
GLN CB   C N N 78  
GLN CG   C N N 79  
GLN CD   C N N 80  
GLN OE1  O N N 81  
GLN NE2  N N N 82  
GLN OXT  O N N 83  
GLN H    H N N 84  
GLN H2   H N N 85  
GLN HA   H N N 86  
GLN HB2  H N N 87  
GLN HB3  H N N 88  
GLN HG2  H N N 89  
GLN HG3  H N N 90  
GLN HE21 H N N 91  
GLN HE22 H N N 92  
GLN HXT  H N N 93  
GLU N    N N N 94  
GLU CA   C N S 95  
GLU C    C N N 96  
GLU O    O N N 97  
GLU CB   C N N 98  
GLU CG   C N N 99  
GLU CD   C N N 100 
GLU OE1  O N N 101 
GLU OE2  O N N 102 
GLU OXT  O N N 103 
GLU H    H N N 104 
GLU H2   H N N 105 
GLU HA   H N N 106 
GLU HB2  H N N 107 
GLU HB3  H N N 108 
GLU HG2  H N N 109 
GLU HG3  H N N 110 
GLU HE2  H N N 111 
GLU HXT  H N N 112 
GLY N    N N N 113 
GLY CA   C N N 114 
GLY C    C N N 115 
GLY O    O N N 116 
GLY OXT  O N N 117 
GLY H    H N N 118 
GLY H2   H N N 119 
GLY HA2  H N N 120 
GLY HA3  H N N 121 
GLY HXT  H N N 122 
HIS N    N N N 123 
HIS CA   C N S 124 
HIS C    C N N 125 
HIS O    O N N 126 
HIS CB   C N N 127 
HIS CG   C Y N 128 
HIS ND1  N Y N 129 
HIS CD2  C Y N 130 
HIS CE1  C Y N 131 
HIS NE2  N Y N 132 
HIS OXT  O N N 133 
HIS H    H N N 134 
HIS H2   H N N 135 
HIS HA   H N N 136 
HIS HB2  H N N 137 
HIS HB3  H N N 138 
HIS HD1  H N N 139 
HIS HD2  H N N 140 
HIS HE1  H N N 141 
HIS HE2  H N N 142 
HIS HXT  H N N 143 
ILE N    N N N 144 
ILE CA   C N S 145 
ILE C    C N N 146 
ILE O    O N N 147 
ILE CB   C N S 148 
ILE CG1  C N N 149 
ILE CG2  C N N 150 
ILE CD1  C N N 151 
ILE OXT  O N N 152 
ILE H    H N N 153 
ILE H2   H N N 154 
ILE HA   H N N 155 
ILE HB   H N N 156 
ILE HG12 H N N 157 
ILE HG13 H N N 158 
ILE HG21 H N N 159 
ILE HG22 H N N 160 
ILE HG23 H N N 161 
ILE HD11 H N N 162 
ILE HD12 H N N 163 
ILE HD13 H N N 164 
ILE HXT  H N N 165 
LEU N    N N N 166 
LEU CA   C N S 167 
LEU C    C N N 168 
LEU O    O N N 169 
LEU CB   C N N 170 
LEU CG   C N N 171 
LEU CD1  C N N 172 
LEU CD2  C N N 173 
LEU OXT  O N N 174 
LEU H    H N N 175 
LEU H2   H N N 176 
LEU HA   H N N 177 
LEU HB2  H N N 178 
LEU HB3  H N N 179 
LEU HG   H N N 180 
LEU HD11 H N N 181 
LEU HD12 H N N 182 
LEU HD13 H N N 183 
LEU HD21 H N N 184 
LEU HD22 H N N 185 
LEU HD23 H N N 186 
LEU HXT  H N N 187 
LYS N    N N N 188 
LYS CA   C N S 189 
LYS C    C N N 190 
LYS O    O N N 191 
LYS CB   C N N 192 
LYS CG   C N N 193 
LYS CD   C N N 194 
LYS CE   C N N 195 
LYS NZ   N N N 196 
LYS OXT  O N N 197 
LYS H    H N N 198 
LYS H2   H N N 199 
LYS HA   H N N 200 
LYS HB2  H N N 201 
LYS HB3  H N N 202 
LYS HG2  H N N 203 
LYS HG3  H N N 204 
LYS HD2  H N N 205 
LYS HD3  H N N 206 
LYS HE2  H N N 207 
LYS HE3  H N N 208 
LYS HZ1  H N N 209 
LYS HZ2  H N N 210 
LYS HZ3  H N N 211 
LYS HXT  H N N 212 
MET N    N N N 213 
MET CA   C N S 214 
MET C    C N N 215 
MET O    O N N 216 
MET CB   C N N 217 
MET CG   C N N 218 
MET SD   S N N 219 
MET CE   C N N 220 
MET OXT  O N N 221 
MET H    H N N 222 
MET H2   H N N 223 
MET HA   H N N 224 
MET HB2  H N N 225 
MET HB3  H N N 226 
MET HG2  H N N 227 
MET HG3  H N N 228 
MET HE1  H N N 229 
MET HE2  H N N 230 
MET HE3  H N N 231 
MET HXT  H N N 232 
PHE N    N N N 233 
PHE CA   C N S 234 
PHE C    C N N 235 
PHE O    O N N 236 
PHE CB   C N N 237 
PHE CG   C Y N 238 
PHE CD1  C Y N 239 
PHE CD2  C Y N 240 
PHE CE1  C Y N 241 
PHE CE2  C Y N 242 
PHE CZ   C Y N 243 
PHE OXT  O N N 244 
PHE H    H N N 245 
PHE H2   H N N 246 
PHE HA   H N N 247 
PHE HB2  H N N 248 
PHE HB3  H N N 249 
PHE HD1  H N N 250 
PHE HD2  H N N 251 
PHE HE1  H N N 252 
PHE HE2  H N N 253 
PHE HZ   H N N 254 
PHE HXT  H N N 255 
PRO N    N N N 256 
PRO CA   C N S 257 
PRO C    C N N 258 
PRO O    O N N 259 
PRO CB   C N N 260 
PRO CG   C N N 261 
PRO CD   C N N 262 
PRO OXT  O N N 263 
PRO H    H N N 264 
PRO HA   H N N 265 
PRO HB2  H N N 266 
PRO HB3  H N N 267 
PRO HG2  H N N 268 
PRO HG3  H N N 269 
PRO HD2  H N N 270 
PRO HD3  H N N 271 
PRO HXT  H N N 272 
SER N    N N N 273 
SER CA   C N S 274 
SER C    C N N 275 
SER O    O N N 276 
SER CB   C N N 277 
SER OG   O N N 278 
SER OXT  O N N 279 
SER H    H N N 280 
SER H2   H N N 281 
SER HA   H N N 282 
SER HB2  H N N 283 
SER HB3  H N N 284 
SER HG   H N N 285 
SER HXT  H N N 286 
THR N    N N N 287 
THR CA   C N S 288 
THR C    C N N 289 
THR O    O N N 290 
THR CB   C N R 291 
THR OG1  O N N 292 
THR CG2  C N N 293 
THR OXT  O N N 294 
THR H    H N N 295 
THR H2   H N N 296 
THR HA   H N N 297 
THR HB   H N N 298 
THR HG1  H N N 299 
THR HG21 H N N 300 
THR HG22 H N N 301 
THR HG23 H N N 302 
THR HXT  H N N 303 
TYR N    N N N 304 
TYR CA   C N S 305 
TYR C    C N N 306 
TYR O    O N N 307 
TYR CB   C N N 308 
TYR CG   C Y N 309 
TYR CD1  C Y N 310 
TYR CD2  C Y N 311 
TYR CE1  C Y N 312 
TYR CE2  C Y N 313 
TYR CZ   C Y N 314 
TYR OH   O N N 315 
TYR OXT  O N N 316 
TYR H    H N N 317 
TYR H2   H N N 318 
TYR HA   H N N 319 
TYR HB2  H N N 320 
TYR HB3  H N N 321 
TYR HD1  H N N 322 
TYR HD2  H N N 323 
TYR HE1  H N N 324 
TYR HE2  H N N 325 
TYR HH   H N N 326 
TYR HXT  H N N 327 
VAL N    N N N 328 
VAL CA   C N S 329 
VAL C    C N N 330 
VAL O    O N N 331 
VAL CB   C N N 332 
VAL CG1  C N N 333 
VAL CG2  C N N 334 
VAL OXT  O N N 335 
VAL H    H N N 336 
VAL H2   H N N 337 
VAL HA   H N N 338 
VAL HB   H N N 339 
VAL HG11 H N N 340 
VAL HG12 H N N 341 
VAL HG13 H N N 342 
VAL HG21 H N N 343 
VAL HG22 H N N 344 
VAL HG23 H N N 345 
VAL HXT  H N N 346 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HIS N   CA   sing N N 116 
HIS N   H    sing N N 117 
HIS N   H2   sing N N 118 
HIS CA  C    sing N N 119 
HIS CA  CB   sing N N 120 
HIS CA  HA   sing N N 121 
HIS C   O    doub N N 122 
HIS C   OXT  sing N N 123 
HIS CB  CG   sing N N 124 
HIS CB  HB2  sing N N 125 
HIS CB  HB3  sing N N 126 
HIS CG  ND1  sing Y N 127 
HIS CG  CD2  doub Y N 128 
HIS ND1 CE1  doub Y N 129 
HIS ND1 HD1  sing N N 130 
HIS CD2 NE2  sing Y N 131 
HIS CD2 HD2  sing N N 132 
HIS CE1 NE2  sing Y N 133 
HIS CE1 HE1  sing N N 134 
HIS NE2 HE2  sing N N 135 
HIS OXT HXT  sing N N 136 
ILE N   CA   sing N N 137 
ILE N   H    sing N N 138 
ILE N   H2   sing N N 139 
ILE CA  C    sing N N 140 
ILE CA  CB   sing N N 141 
ILE CA  HA   sing N N 142 
ILE C   O    doub N N 143 
ILE C   OXT  sing N N 144 
ILE CB  CG1  sing N N 145 
ILE CB  CG2  sing N N 146 
ILE CB  HB   sing N N 147 
ILE CG1 CD1  sing N N 148 
ILE CG1 HG12 sing N N 149 
ILE CG1 HG13 sing N N 150 
ILE CG2 HG21 sing N N 151 
ILE CG2 HG22 sing N N 152 
ILE CG2 HG23 sing N N 153 
ILE CD1 HD11 sing N N 154 
ILE CD1 HD12 sing N N 155 
ILE CD1 HD13 sing N N 156 
ILE OXT HXT  sing N N 157 
LEU N   CA   sing N N 158 
LEU N   H    sing N N 159 
LEU N   H2   sing N N 160 
LEU CA  C    sing N N 161 
LEU CA  CB   sing N N 162 
LEU CA  HA   sing N N 163 
LEU C   O    doub N N 164 
LEU C   OXT  sing N N 165 
LEU CB  CG   sing N N 166 
LEU CB  HB2  sing N N 167 
LEU CB  HB3  sing N N 168 
LEU CG  CD1  sing N N 169 
LEU CG  CD2  sing N N 170 
LEU CG  HG   sing N N 171 
LEU CD1 HD11 sing N N 172 
LEU CD1 HD12 sing N N 173 
LEU CD1 HD13 sing N N 174 
LEU CD2 HD21 sing N N 175 
LEU CD2 HD22 sing N N 176 
LEU CD2 HD23 sing N N 177 
LEU OXT HXT  sing N N 178 
LYS N   CA   sing N N 179 
LYS N   H    sing N N 180 
LYS N   H2   sing N N 181 
LYS CA  C    sing N N 182 
LYS CA  CB   sing N N 183 
LYS CA  HA   sing N N 184 
LYS C   O    doub N N 185 
LYS C   OXT  sing N N 186 
LYS CB  CG   sing N N 187 
LYS CB  HB2  sing N N 188 
LYS CB  HB3  sing N N 189 
LYS CG  CD   sing N N 190 
LYS CG  HG2  sing N N 191 
LYS CG  HG3  sing N N 192 
LYS CD  CE   sing N N 193 
LYS CD  HD2  sing N N 194 
LYS CD  HD3  sing N N 195 
LYS CE  NZ   sing N N 196 
LYS CE  HE2  sing N N 197 
LYS CE  HE3  sing N N 198 
LYS NZ  HZ1  sing N N 199 
LYS NZ  HZ2  sing N N 200 
LYS NZ  HZ3  sing N N 201 
LYS OXT HXT  sing N N 202 
MET N   CA   sing N N 203 
MET N   H    sing N N 204 
MET N   H2   sing N N 205 
MET CA  C    sing N N 206 
MET CA  CB   sing N N 207 
MET CA  HA   sing N N 208 
MET C   O    doub N N 209 
MET C   OXT  sing N N 210 
MET CB  CG   sing N N 211 
MET CB  HB2  sing N N 212 
MET CB  HB3  sing N N 213 
MET CG  SD   sing N N 214 
MET CG  HG2  sing N N 215 
MET CG  HG3  sing N N 216 
MET SD  CE   sing N N 217 
MET CE  HE1  sing N N 218 
MET CE  HE2  sing N N 219 
MET CE  HE3  sing N N 220 
MET OXT HXT  sing N N 221 
PHE N   CA   sing N N 222 
PHE N   H    sing N N 223 
PHE N   H2   sing N N 224 
PHE CA  C    sing N N 225 
PHE CA  CB   sing N N 226 
PHE CA  HA   sing N N 227 
PHE C   O    doub N N 228 
PHE C   OXT  sing N N 229 
PHE CB  CG   sing N N 230 
PHE CB  HB2  sing N N 231 
PHE CB  HB3  sing N N 232 
PHE CG  CD1  doub Y N 233 
PHE CG  CD2  sing Y N 234 
PHE CD1 CE1  sing Y N 235 
PHE CD1 HD1  sing N N 236 
PHE CD2 CE2  doub Y N 237 
PHE CD2 HD2  sing N N 238 
PHE CE1 CZ   doub Y N 239 
PHE CE1 HE1  sing N N 240 
PHE CE2 CZ   sing Y N 241 
PHE CE2 HE2  sing N N 242 
PHE CZ  HZ   sing N N 243 
PHE OXT HXT  sing N N 244 
PRO N   CA   sing N N 245 
PRO N   CD   sing N N 246 
PRO N   H    sing N N 247 
PRO CA  C    sing N N 248 
PRO CA  CB   sing N N 249 
PRO CA  HA   sing N N 250 
PRO C   O    doub N N 251 
PRO C   OXT  sing N N 252 
PRO CB  CG   sing N N 253 
PRO CB  HB2  sing N N 254 
PRO CB  HB3  sing N N 255 
PRO CG  CD   sing N N 256 
PRO CG  HG2  sing N N 257 
PRO CG  HG3  sing N N 258 
PRO CD  HD2  sing N N 259 
PRO CD  HD3  sing N N 260 
PRO OXT HXT  sing N N 261 
SER N   CA   sing N N 262 
SER N   H    sing N N 263 
SER N   H2   sing N N 264 
SER CA  C    sing N N 265 
SER CA  CB   sing N N 266 
SER CA  HA   sing N N 267 
SER C   O    doub N N 268 
SER C   OXT  sing N N 269 
SER CB  OG   sing N N 270 
SER CB  HB2  sing N N 271 
SER CB  HB3  sing N N 272 
SER OG  HG   sing N N 273 
SER OXT HXT  sing N N 274 
THR N   CA   sing N N 275 
THR N   H    sing N N 276 
THR N   H2   sing N N 277 
THR CA  C    sing N N 278 
THR CA  CB   sing N N 279 
THR CA  HA   sing N N 280 
THR C   O    doub N N 281 
THR C   OXT  sing N N 282 
THR CB  OG1  sing N N 283 
THR CB  CG2  sing N N 284 
THR CB  HB   sing N N 285 
THR OG1 HG1  sing N N 286 
THR CG2 HG21 sing N N 287 
THR CG2 HG22 sing N N 288 
THR CG2 HG23 sing N N 289 
THR OXT HXT  sing N N 290 
TYR N   CA   sing N N 291 
TYR N   H    sing N N 292 
TYR N   H2   sing N N 293 
TYR CA  C    sing N N 294 
TYR CA  CB   sing N N 295 
TYR CA  HA   sing N N 296 
TYR C   O    doub N N 297 
TYR C   OXT  sing N N 298 
TYR CB  CG   sing N N 299 
TYR CB  HB2  sing N N 300 
TYR CB  HB3  sing N N 301 
TYR CG  CD1  doub Y N 302 
TYR CG  CD2  sing Y N 303 
TYR CD1 CE1  sing Y N 304 
TYR CD1 HD1  sing N N 305 
TYR CD2 CE2  doub Y N 306 
TYR CD2 HD2  sing N N 307 
TYR CE1 CZ   doub Y N 308 
TYR CE1 HE1  sing N N 309 
TYR CE2 CZ   sing Y N 310 
TYR CE2 HE2  sing N N 311 
TYR CZ  OH   sing N N 312 
TYR OH  HH   sing N N 313 
TYR OXT HXT  sing N N 314 
VAL N   CA   sing N N 315 
VAL N   H    sing N N 316 
VAL N   H2   sing N N 317 
VAL CA  C    sing N N 318 
VAL CA  CB   sing N N 319 
VAL CA  HA   sing N N 320 
VAL C   O    doub N N 321 
VAL C   OXT  sing N N 322 
VAL CB  CG1  sing N N 323 
VAL CB  CG2  sing N N 324 
VAL CB  HB   sing N N 325 
VAL CG1 HG11 sing N N 326 
VAL CG1 HG12 sing N N 327 
VAL CG1 HG13 sing N N 328 
VAL CG2 HG21 sing N N 329 
VAL CG2 HG22 sing N N 330 
VAL CG2 HG23 sing N N 331 
VAL OXT HXT  sing N N 332 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             AVANCE 
_pdbx_nmr_spectrometer.field_strength    800 
# 
_atom_sites.entry_id                    1UFW 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_