data_1UHC # _entry.id 1UHC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1UHC pdb_00001uhc 10.2210/pdb1uhc/pdb RCSB RCSB005826 ? ? WWPDB D_1000005826 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-12-28 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1UHC _pdbx_database_status.recvd_initial_deposition_date 2003-06-28 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk002000986.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Abe, T.' 1 'Hirota, H.' 2 'Kobayashi, N.' 3 'Hayashi, F.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution Structure of RSGI RUH-002, a SH3 Domain of KIAA1010 protein [Homo sapiens]' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Abe, T.' 1 ? primary 'Hirota, H.' 2 ? primary 'Kobayashi, N.' 3 ? primary 'Hayashi, F.' 4 ? primary 'Yokoyama, S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'KIAA1010 protein' _entity.formula_weight 8573.360 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGSEAEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTESGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGSEAEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTESGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002000986.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 GLU n 1 10 ALA n 1 11 GLU n 1 12 GLY n 1 13 ASN n 1 14 GLN n 1 15 VAL n 1 16 TYR n 1 17 PHE n 1 18 ALA n 1 19 VAL n 1 20 TYR n 1 21 THR n 1 22 PHE n 1 23 LYS n 1 24 ALA n 1 25 ARG n 1 26 ASN n 1 27 PRO n 1 28 ASN n 1 29 GLU n 1 30 LEU n 1 31 SER n 1 32 VAL n 1 33 SER n 1 34 ALA n 1 35 ASN n 1 36 GLN n 1 37 LYS n 1 38 LEU n 1 39 LYS n 1 40 ILE n 1 41 LEU n 1 42 GLU n 1 43 PHE n 1 44 LYS n 1 45 ASP n 1 46 VAL n 1 47 THR n 1 48 GLY n 1 49 ASN n 1 50 THR n 1 51 GLU n 1 52 TRP n 1 53 TRP n 1 54 LEU n 1 55 ALA n 1 56 GLU n 1 57 VAL n 1 58 ASN n 1 59 GLY n 1 60 LYS n 1 61 LYS n 1 62 GLY n 1 63 TYR n 1 64 VAL n 1 65 PRO n 1 66 SER n 1 67 ASN n 1 68 TYR n 1 69 ILE n 1 70 ARG n 1 71 LYS n 1 72 THR n 1 73 GLU n 1 74 SER n 1 75 GLY n 1 76 PRO n 1 77 SER n 1 78 SER n 1 79 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'Kazusa cDNA hj05262' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P021015-01 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis system' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 TRP 52 52 52 TRP TRP A . n A 1 53 TRP 53 53 53 TRP TRP A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 GLY 79 79 79 GLY GLY A . n # _cell.entry_id 1UHC _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1UHC _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1UHC _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1UHC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1UHC _struct.title 'Solution Structure of RSGI RUH-002, a SH3 Domain of KIAA1010 protein [Homo sapiens]' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1UHC _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text 'beta barrel, SH3, human cDNA, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DNMBP_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SEAEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTE _struct_ref.pdbx_align_begin 1248 _struct_ref.pdbx_db_accession Q6XZF7 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1UHC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 73 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6XZF7 _struct_ref_seq.db_align_beg 1248 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1313 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1UHC GLY A 1 ? UNP Q6XZF7 ? ? 'cloning artifact' 1 1 1 1UHC SER A 2 ? UNP Q6XZF7 ? ? 'cloning artifact' 2 2 1 1UHC SER A 3 ? UNP Q6XZF7 ? ? 'cloning artifact' 3 3 1 1UHC GLY A 4 ? UNP Q6XZF7 ? ? 'cloning artifact' 4 4 1 1UHC SER A 5 ? UNP Q6XZF7 ? ? 'cloning artifact' 5 5 1 1UHC SER A 6 ? UNP Q6XZF7 ? ? 'cloning artifact' 6 6 1 1UHC GLY A 7 ? UNP Q6XZF7 ? ? 'cloning artifact' 7 7 1 1UHC SER A 74 ? UNP Q6XZF7 ? ? 'cloning artifact' 74 8 1 1UHC GLY A 75 ? UNP Q6XZF7 ? ? 'cloning artifact' 75 9 1 1UHC PRO A 76 ? UNP Q6XZF7 ? ? 'cloning artifact' 76 10 1 1UHC SER A 77 ? UNP Q6XZF7 ? ? 'cloning artifact' 77 11 1 1UHC SER A 78 ? UNP Q6XZF7 ? ? 'cloning artifact' 78 12 1 1UHC GLY A 79 ? UNP Q6XZF7 ? ? 'cloning artifact' 79 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 61 ? PRO A 65 ? LYS A 61 PRO A 65 A 2 TRP A 52 ? GLU A 56 ? TRP A 52 GLU A 56 A 3 LYS A 37 ? GLU A 42 ? LYS A 37 GLU A 42 A 4 TYR A 16 ? ALA A 18 ? TYR A 16 ALA A 18 A 5 ILE A 69 ? LYS A 71 ? ILE A 69 LYS A 71 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 64 ? O VAL A 64 N TRP A 53 ? N TRP A 53 A 2 3 O LEU A 54 ? O LEU A 54 N GLU A 42 ? N GLU A 42 A 3 4 O LEU A 38 ? O LEU A 38 N TYR A 16 ? N TYR A 16 A 4 5 N PHE A 17 ? N PHE A 17 O ARG A 70 ? O ARG A 70 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A TRP 53 ? ? H A VAL 64 ? ? 1.52 2 1 H A TRP 53 ? ? O A VAL 64 ? ? 1.53 3 3 H A TRP 53 ? ? O A VAL 64 ? ? 1.52 4 3 O A TRP 53 ? ? H A VAL 64 ? ? 1.58 5 4 H A LEU 41 ? ? O A LEU 54 ? ? 1.52 6 4 O A TRP 53 ? ? H A VAL 64 ? ? 1.58 7 5 H A LEU 41 ? ? O A LEU 54 ? ? 1.53 8 5 O A ASN 28 ? ? H A TYR 63 ? ? 1.56 9 6 O A ALA 18 ? ? H A ASN 35 ? ? 1.50 10 9 H A ALA 18 ? ? O A GLN 36 ? ? 1.56 11 9 OD1 A ASP 45 ? ? H A ASN 49 ? ? 1.58 12 9 H A PHE 22 ? ? O A VAL 32 ? ? 1.60 13 11 H A LEU 41 ? ? O A LEU 54 ? ? 1.55 14 11 H A TRP 53 ? ? O A VAL 64 ? ? 1.57 15 11 O A TRP 53 ? ? H A VAL 64 ? ? 1.58 16 11 H A ASP 45 ? ? O A ASN 49 ? ? 1.58 17 12 H A LEU 41 ? ? O A LEU 54 ? ? 1.53 18 13 O A PRO 65 ? ? H A TYR 68 ? ? 1.52 19 13 H A LEU 41 ? ? O A LEU 54 ? ? 1.55 20 14 H A LEU 41 ? ? O A LEU 54 ? ? 1.52 21 15 H A ALA 55 ? ? O A GLY 62 ? ? 1.49 22 15 O A TRP 53 ? ? H A VAL 64 ? ? 1.52 23 15 H A LEU 41 ? ? O A LEU 54 ? ? 1.54 24 15 H A TRP 53 ? ? O A VAL 64 ? ? 1.54 25 16 O A TRP 53 ? ? H A VAL 64 ? ? 1.52 26 16 H A LEU 41 ? ? O A LEU 54 ? ? 1.55 27 17 H A LEU 41 ? ? O A LEU 54 ? ? 1.52 28 17 O A VAL 57 ? ? H A LYS 60 ? ? 1.59 29 18 H A LEU 41 ? ? O A LEU 54 ? ? 1.54 30 18 H A PHE 22 ? ? O A VAL 32 ? ? 1.60 31 19 O A TRP 53 ? ? H A VAL 64 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? 63.63 80.10 2 1 SER A 8 ? ? -110.51 -72.81 3 1 GLU A 9 ? ? -131.25 -54.49 4 1 THR A 47 ? ? -96.90 40.47 5 1 VAL A 57 ? ? -93.44 -84.35 6 1 ASN A 58 ? ? -118.54 55.83 7 1 SER A 74 ? ? 175.78 148.25 8 1 SER A 78 ? ? -173.13 -58.83 9 2 SER A 2 ? ? 66.52 133.75 10 2 SER A 8 ? ? 178.15 -56.92 11 2 GLU A 9 ? ? -172.02 135.98 12 2 ILE A 40 ? ? -69.57 98.96 13 2 LEU A 41 ? ? -66.36 -70.14 14 2 ASN A 58 ? ? 74.23 -74.85 15 2 SER A 78 ? ? 64.84 128.07 16 3 SER A 2 ? ? 62.78 136.15 17 3 SER A 8 ? ? 63.16 128.90 18 3 GLU A 9 ? ? 179.51 84.67 19 3 ALA A 10 ? ? -173.55 123.03 20 3 ILE A 40 ? ? -67.90 98.76 21 3 ASP A 45 ? ? -65.94 -169.14 22 3 ASN A 58 ? ? 63.42 71.63 23 3 SER A 78 ? ? 66.11 129.67 24 4 SER A 2 ? ? 64.36 128.34 25 4 SER A 5 ? ? -176.00 -58.64 26 4 SER A 6 ? ? 44.62 78.32 27 4 VAL A 57 ? ? -92.65 -103.22 28 4 ASN A 58 ? ? -91.70 52.24 29 4 SER A 74 ? ? -174.65 139.14 30 4 SER A 77 ? ? 72.76 -67.32 31 4 SER A 78 ? ? -148.04 -58.01 32 5 SER A 5 ? ? -134.35 -45.88 33 5 SER A 6 ? ? 54.17 84.38 34 5 SER A 8 ? ? 59.81 167.21 35 5 GLU A 11 ? ? -158.93 81.31 36 5 ASN A 13 ? ? 49.77 96.56 37 5 PHE A 43 ? ? -87.75 39.82 38 5 ASP A 45 ? ? -97.95 -88.96 39 5 THR A 50 ? ? -97.31 49.01 40 5 GLU A 73 ? ? 64.37 122.34 41 5 SER A 74 ? ? -139.94 -57.99 42 5 SER A 77 ? ? 43.10 81.76 43 5 SER A 78 ? ? -179.83 91.87 44 6 GLU A 9 ? ? -170.23 143.75 45 6 GLU A 11 ? ? 53.95 81.48 46 6 GLN A 14 ? ? -46.42 154.80 47 6 VAL A 15 ? ? -175.61 127.78 48 6 ASN A 35 ? ? 83.57 -6.56 49 6 ILE A 40 ? ? -66.17 90.04 50 6 VAL A 46 ? ? -37.20 -75.36 51 6 ASN A 49 ? ? -46.01 170.09 52 6 VAL A 57 ? ? -85.94 -102.63 53 6 ASN A 58 ? ? -102.04 60.11 54 7 SER A 2 ? ? 65.22 126.39 55 7 SER A 3 ? ? 55.96 170.22 56 7 SER A 5 ? ? 44.82 90.88 57 7 SER A 6 ? ? 178.12 95.73 58 7 ALA A 10 ? ? 76.57 77.99 59 7 ASN A 13 ? ? -169.13 -68.15 60 7 GLN A 14 ? ? -47.59 150.22 61 7 ARG A 25 ? ? -166.59 -36.39 62 7 PRO A 27 ? ? -75.03 42.51 63 7 ASN A 28 ? ? -175.76 33.82 64 7 THR A 50 ? ? -87.36 44.26 65 7 ASN A 58 ? ? 58.79 73.25 66 7 GLU A 73 ? ? 56.62 104.70 67 7 SER A 77 ? ? -171.93 85.57 68 7 SER A 78 ? ? 63.00 124.02 69 8 SER A 5 ? ? 65.93 155.10 70 8 SER A 6 ? ? -167.89 104.10 71 8 SER A 8 ? ? -131.74 -60.65 72 8 GLU A 9 ? ? -138.30 -45.00 73 8 ALA A 10 ? ? 69.59 122.91 74 8 ASN A 13 ? ? 60.05 106.85 75 8 GLN A 14 ? ? 59.39 152.24 76 8 VAL A 15 ? ? -174.61 127.57 77 8 ILE A 40 ? ? -69.35 99.62 78 8 THR A 50 ? ? -83.21 49.42 79 8 VAL A 57 ? ? -91.35 -98.55 80 8 ASN A 58 ? ? -89.53 43.45 81 8 TYR A 68 ? ? -97.53 43.23 82 8 GLU A 73 ? ? -135.58 -55.80 83 8 SER A 74 ? ? 66.98 83.79 84 9 SER A 5 ? ? 61.55 93.71 85 9 SER A 8 ? ? 61.17 162.37 86 9 GLU A 9 ? ? 61.62 125.69 87 9 ALA A 10 ? ? -41.54 153.14 88 9 GLN A 14 ? ? 48.91 98.18 89 9 VAL A 19 ? ? -39.78 -30.36 90 9 THR A 50 ? ? -85.11 47.72 91 9 LYS A 60 ? ? -54.33 104.54 92 9 SER A 77 ? ? -107.80 -62.09 93 9 SER A 78 ? ? 60.71 117.45 94 10 SER A 3 ? ? -137.29 -58.82 95 10 SER A 8 ? ? 64.94 100.69 96 10 ASN A 13 ? ? 55.28 171.74 97 10 THR A 21 ? ? -58.16 103.78 98 10 THR A 47 ? ? -91.10 31.39 99 10 VAL A 57 ? ? -100.78 74.48 100 10 ASN A 58 ? ? 62.63 69.08 101 10 LYS A 60 ? ? -55.53 109.43 102 10 TYR A 68 ? ? -93.78 41.88 103 11 SER A 6 ? ? -166.16 102.92 104 11 SER A 8 ? ? 64.52 90.50 105 11 GLU A 9 ? ? -178.26 123.70 106 11 ALA A 10 ? ? 65.08 170.89 107 11 GLN A 14 ? ? 61.07 141.62 108 11 ASP A 45 ? ? -72.29 -155.88 109 11 THR A 47 ? ? -98.33 44.74 110 11 THR A 72 ? ? -89.39 33.89 111 11 GLU A 73 ? ? -49.84 -179.66 112 11 SER A 74 ? ? 179.41 -45.13 113 11 SER A 77 ? ? 59.21 97.78 114 12 SER A 2 ? ? -161.81 -58.50 115 12 GLU A 9 ? ? -112.86 73.13 116 12 ASN A 13 ? ? -59.40 -164.52 117 12 GLN A 14 ? ? 33.34 99.48 118 12 THR A 21 ? ? -57.07 102.73 119 12 THR A 50 ? ? 37.78 34.10 120 12 VAL A 57 ? ? -103.47 -103.42 121 12 SER A 74 ? ? 68.86 -65.99 122 13 SER A 2 ? ? 46.37 89.54 123 13 SER A 6 ? ? 62.36 111.84 124 13 GLU A 11 ? ? 58.46 113.28 125 13 GLN A 14 ? ? -42.76 155.96 126 13 ASN A 28 ? ? -166.42 -41.39 127 13 THR A 47 ? ? -90.39 32.53 128 13 THR A 50 ? ? -89.80 39.50 129 13 THR A 72 ? ? 33.48 -149.90 130 13 SER A 77 ? ? -164.66 85.21 131 14 SER A 2 ? ? -178.29 117.74 132 14 SER A 3 ? ? 63.32 159.76 133 14 SER A 8 ? ? -163.63 -58.01 134 14 GLU A 9 ? ? -175.75 130.87 135 14 GLU A 11 ? ? 52.76 84.19 136 14 ASN A 13 ? ? 60.42 100.23 137 14 GLN A 14 ? ? -48.07 157.97 138 14 THR A 47 ? ? -99.61 33.73 139 14 VAL A 57 ? ? -93.19 -98.50 140 14 ASN A 58 ? ? -103.51 55.73 141 14 SER A 74 ? ? 59.83 84.04 142 14 SER A 78 ? ? -164.26 93.09 143 15 SER A 2 ? ? 55.86 167.04 144 15 SER A 3 ? ? -147.03 -60.20 145 15 SER A 5 ? ? 178.51 133.37 146 15 ASN A 13 ? ? 59.80 171.51 147 15 THR A 21 ? ? -58.80 101.49 148 15 ARG A 25 ? ? -165.40 -36.77 149 15 ASN A 28 ? ? -174.39 -39.45 150 15 THR A 50 ? ? -96.02 41.45 151 15 VAL A 57 ? ? -88.27 -106.68 152 15 GLU A 73 ? ? -96.67 57.87 153 16 SER A 5 ? ? 57.45 104.70 154 16 ALA A 10 ? ? 63.15 151.02 155 16 ARG A 25 ? ? -164.42 -36.59 156 16 THR A 47 ? ? -38.02 -35.95 157 16 VAL A 57 ? ? -77.70 -106.97 158 17 SER A 5 ? ? 65.61 159.74 159 17 ASN A 28 ? ? -166.14 -41.91 160 17 GLU A 29 ? ? -51.78 177.58 161 17 THR A 50 ? ? -91.90 39.77 162 17 SER A 74 ? ? 55.47 89.34 163 17 SER A 77 ? ? 59.07 86.59 164 18 SER A 2 ? ? -158.22 -58.47 165 18 SER A 3 ? ? 60.99 167.25 166 18 SER A 5 ? ? -163.23 -55.21 167 18 SER A 6 ? ? 61.93 140.31 168 18 SER A 8 ? ? 177.71 117.99 169 18 GLU A 9 ? ? 62.93 127.30 170 18 ALA A 10 ? ? -169.14 73.93 171 18 ASN A 13 ? ? 174.54 164.34 172 18 GLN A 14 ? ? 59.29 151.86 173 18 VAL A 15 ? ? -175.44 127.17 174 18 ALA A 24 ? ? -27.52 138.59 175 18 ASN A 28 ? ? -167.08 -41.40 176 18 ASN A 35 ? ? 82.98 -2.49 177 18 THR A 50 ? ? -86.26 45.54 178 18 SER A 74 ? ? 43.51 85.62 179 18 SER A 78 ? ? -172.53 84.34 180 19 SER A 2 ? ? -132.64 -58.39 181 19 SER A 3 ? ? -140.03 -58.45 182 19 GLU A 9 ? ? -160.28 78.13 183 19 THR A 21 ? ? -49.48 105.19 184 19 ASP A 45 ? ? -72.42 -169.32 185 19 THR A 50 ? ? -89.19 37.93 186 19 ASN A 58 ? ? 83.35 26.07 187 19 TYR A 68 ? ? -104.59 47.10 188 19 THR A 72 ? ? -56.44 101.84 189 19 SER A 77 ? ? 62.64 167.99 190 19 SER A 78 ? ? 62.96 105.88 191 20 SER A 3 ? ? -175.61 81.16 192 20 SER A 8 ? ? -178.55 105.19 193 20 ASN A 35 ? ? 48.34 29.62 194 20 VAL A 57 ? ? -114.21 74.30 195 20 ASN A 58 ? ? 61.19 68.30 196 20 SER A 74 ? ? -176.95 83.66 197 20 SER A 77 ? ? 58.81 162.26 198 20 SER A 78 ? ? 70.43 -66.12 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 1UHC _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy,target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1UHC _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'the structure with the lowest energy and score of target function was selected.' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM RSGI RUH-002 U-15N, 13C; 20mM phosphate buffer Na; 100mM NaCl; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_details.entry_id 1UHC _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_refine.entry_id 1UHC _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR 6.1C collection Varian 1 NMRPipe 20020425 processing 'Delaglio, F.' 2 NMRView 5.0.4 'data analysis' 'Johnson, B.A.' 3 KUJIRA 0.816 'data analysis' 'Kobayashi, N.' 4 CYANA 1.0.7 refinement 'Guentert, P' 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 PHE N N N N 192 PHE CA C N S 193 PHE C C N N 194 PHE O O N N 195 PHE CB C N N 196 PHE CG C Y N 197 PHE CD1 C Y N 198 PHE CD2 C Y N 199 PHE CE1 C Y N 200 PHE CE2 C Y N 201 PHE CZ C Y N 202 PHE OXT O N N 203 PHE H H N N 204 PHE H2 H N N 205 PHE HA H N N 206 PHE HB2 H N N 207 PHE HB3 H N N 208 PHE HD1 H N N 209 PHE HD2 H N N 210 PHE HE1 H N N 211 PHE HE2 H N N 212 PHE HZ H N N 213 PHE HXT H N N 214 PRO N N N N 215 PRO CA C N S 216 PRO C C N N 217 PRO O O N N 218 PRO CB C N N 219 PRO CG C N N 220 PRO CD C N N 221 PRO OXT O N N 222 PRO H H N N 223 PRO HA H N N 224 PRO HB2 H N N 225 PRO HB3 H N N 226 PRO HG2 H N N 227 PRO HG3 H N N 228 PRO HD2 H N N 229 PRO HD3 H N N 230 PRO HXT H N N 231 SER N N N N 232 SER CA C N S 233 SER C C N N 234 SER O O N N 235 SER CB C N N 236 SER OG O N N 237 SER OXT O N N 238 SER H H N N 239 SER H2 H N N 240 SER HA H N N 241 SER HB2 H N N 242 SER HB3 H N N 243 SER HG H N N 244 SER HXT H N N 245 THR N N N N 246 THR CA C N S 247 THR C C N N 248 THR O O N N 249 THR CB C N R 250 THR OG1 O N N 251 THR CG2 C N N 252 THR OXT O N N 253 THR H H N N 254 THR H2 H N N 255 THR HA H N N 256 THR HB H N N 257 THR HG1 H N N 258 THR HG21 H N N 259 THR HG22 H N N 260 THR HG23 H N N 261 THR HXT H N N 262 TRP N N N N 263 TRP CA C N S 264 TRP C C N N 265 TRP O O N N 266 TRP CB C N N 267 TRP CG C Y N 268 TRP CD1 C Y N 269 TRP CD2 C Y N 270 TRP NE1 N Y N 271 TRP CE2 C Y N 272 TRP CE3 C Y N 273 TRP CZ2 C Y N 274 TRP CZ3 C Y N 275 TRP CH2 C Y N 276 TRP OXT O N N 277 TRP H H N N 278 TRP H2 H N N 279 TRP HA H N N 280 TRP HB2 H N N 281 TRP HB3 H N N 282 TRP HD1 H N N 283 TRP HE1 H N N 284 TRP HE3 H N N 285 TRP HZ2 H N N 286 TRP HZ3 H N N 287 TRP HH2 H N N 288 TRP HXT H N N 289 TYR N N N N 290 TYR CA C N S 291 TYR C C N N 292 TYR O O N N 293 TYR CB C N N 294 TYR CG C Y N 295 TYR CD1 C Y N 296 TYR CD2 C Y N 297 TYR CE1 C Y N 298 TYR CE2 C Y N 299 TYR CZ C Y N 300 TYR OH O N N 301 TYR OXT O N N 302 TYR H H N N 303 TYR H2 H N N 304 TYR HA H N N 305 TYR HB2 H N N 306 TYR HB3 H N N 307 TYR HD1 H N N 308 TYR HD2 H N N 309 TYR HE1 H N N 310 TYR HE2 H N N 311 TYR HH H N N 312 TYR HXT H N N 313 VAL N N N N 314 VAL CA C N S 315 VAL C C N N 316 VAL O O N N 317 VAL CB C N N 318 VAL CG1 C N N 319 VAL CG2 C N N 320 VAL OXT O N N 321 VAL H H N N 322 VAL H2 H N N 323 VAL HA H N N 324 VAL HB H N N 325 VAL HG11 H N N 326 VAL HG12 H N N 327 VAL HG13 H N N 328 VAL HG21 H N N 329 VAL HG22 H N N 330 VAL HG23 H N N 331 VAL HXT H N N 332 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 PHE N CA sing N N 182 PHE N H sing N N 183 PHE N H2 sing N N 184 PHE CA C sing N N 185 PHE CA CB sing N N 186 PHE CA HA sing N N 187 PHE C O doub N N 188 PHE C OXT sing N N 189 PHE CB CG sing N N 190 PHE CB HB2 sing N N 191 PHE CB HB3 sing N N 192 PHE CG CD1 doub Y N 193 PHE CG CD2 sing Y N 194 PHE CD1 CE1 sing Y N 195 PHE CD1 HD1 sing N N 196 PHE CD2 CE2 doub Y N 197 PHE CD2 HD2 sing N N 198 PHE CE1 CZ doub Y N 199 PHE CE1 HE1 sing N N 200 PHE CE2 CZ sing Y N 201 PHE CE2 HE2 sing N N 202 PHE CZ HZ sing N N 203 PHE OXT HXT sing N N 204 PRO N CA sing N N 205 PRO N CD sing N N 206 PRO N H sing N N 207 PRO CA C sing N N 208 PRO CA CB sing N N 209 PRO CA HA sing N N 210 PRO C O doub N N 211 PRO C OXT sing N N 212 PRO CB CG sing N N 213 PRO CB HB2 sing N N 214 PRO CB HB3 sing N N 215 PRO CG CD sing N N 216 PRO CG HG2 sing N N 217 PRO CG HG3 sing N N 218 PRO CD HD2 sing N N 219 PRO CD HD3 sing N N 220 PRO OXT HXT sing N N 221 SER N CA sing N N 222 SER N H sing N N 223 SER N H2 sing N N 224 SER CA C sing N N 225 SER CA CB sing N N 226 SER CA HA sing N N 227 SER C O doub N N 228 SER C OXT sing N N 229 SER CB OG sing N N 230 SER CB HB2 sing N N 231 SER CB HB3 sing N N 232 SER OG HG sing N N 233 SER OXT HXT sing N N 234 THR N CA sing N N 235 THR N H sing N N 236 THR N H2 sing N N 237 THR CA C sing N N 238 THR CA CB sing N N 239 THR CA HA sing N N 240 THR C O doub N N 241 THR C OXT sing N N 242 THR CB OG1 sing N N 243 THR CB CG2 sing N N 244 THR CB HB sing N N 245 THR OG1 HG1 sing N N 246 THR CG2 HG21 sing N N 247 THR CG2 HG22 sing N N 248 THR CG2 HG23 sing N N 249 THR OXT HXT sing N N 250 TRP N CA sing N N 251 TRP N H sing N N 252 TRP N H2 sing N N 253 TRP CA C sing N N 254 TRP CA CB sing N N 255 TRP CA HA sing N N 256 TRP C O doub N N 257 TRP C OXT sing N N 258 TRP CB CG sing N N 259 TRP CB HB2 sing N N 260 TRP CB HB3 sing N N 261 TRP CG CD1 doub Y N 262 TRP CG CD2 sing Y N 263 TRP CD1 NE1 sing Y N 264 TRP CD1 HD1 sing N N 265 TRP CD2 CE2 doub Y N 266 TRP CD2 CE3 sing Y N 267 TRP NE1 CE2 sing Y N 268 TRP NE1 HE1 sing N N 269 TRP CE2 CZ2 sing Y N 270 TRP CE3 CZ3 doub Y N 271 TRP CE3 HE3 sing N N 272 TRP CZ2 CH2 doub Y N 273 TRP CZ2 HZ2 sing N N 274 TRP CZ3 CH2 sing Y N 275 TRP CZ3 HZ3 sing N N 276 TRP CH2 HH2 sing N N 277 TRP OXT HXT sing N N 278 TYR N CA sing N N 279 TYR N H sing N N 280 TYR N H2 sing N N 281 TYR CA C sing N N 282 TYR CA CB sing N N 283 TYR CA HA sing N N 284 TYR C O doub N N 285 TYR C OXT sing N N 286 TYR CB CG sing N N 287 TYR CB HB2 sing N N 288 TYR CB HB3 sing N N 289 TYR CG CD1 doub Y N 290 TYR CG CD2 sing Y N 291 TYR CD1 CE1 sing Y N 292 TYR CD1 HD1 sing N N 293 TYR CD2 CE2 doub Y N 294 TYR CD2 HD2 sing N N 295 TYR CE1 CZ doub Y N 296 TYR CE1 HE1 sing N N 297 TYR CE2 CZ sing Y N 298 TYR CE2 HE2 sing N N 299 TYR CZ OH sing N N 300 TYR OH HH sing N N 301 TYR OXT HXT sing N N 302 VAL N CA sing N N 303 VAL N H sing N N 304 VAL N H2 sing N N 305 VAL CA C sing N N 306 VAL CA CB sing N N 307 VAL CA HA sing N N 308 VAL C O doub N N 309 VAL C OXT sing N N 310 VAL CB CG1 sing N N 311 VAL CB CG2 sing N N 312 VAL CB HB sing N N 313 VAL CG1 HG11 sing N N 314 VAL CG1 HG12 sing N N 315 VAL CG1 HG13 sing N N 316 VAL CG2 HG21 sing N N 317 VAL CG2 HG22 sing N N 318 VAL CG2 HG23 sing N N 319 VAL OXT HXT sing N N 320 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 1UHC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_