data_1UJV # _entry.id 1UJV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1UJV pdb_00001ujv 10.2210/pdb1ujv/pdb RCSB RCSB005907 ? ? WWPDB D_1000005907 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-02-11 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1UJV _pdbx_database_status.recvd_initial_deposition_date 2003-08-11 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk002000688.3 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nameki, N.' 1 'Koshiba, S.' 2 'Kigawa, T.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Solution structure of the second PDZ domain of human membrane associated guanylate kinase inverted-2 (MAGI-2)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nameki, N.' 1 ? primary 'Koshiba, S.' 2 ? primary 'Kigawa, T.' 3 ? primary 'Yokoyama, S.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'MEMBRANE ASSOCIATED GUANYLATE KINASE INVERTED-2 (MAGI-2)' _entity.formula_weight 9916.074 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'PDZ domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'KIAA0705 PROTEIN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGQAELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCPIG SETSLIIHRGSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGQAELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCPIG SETSLIIHRGSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002000688.3 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLN n 1 9 ALA n 1 10 GLU n 1 11 LEU n 1 12 MET n 1 13 THR n 1 14 LEU n 1 15 THR n 1 16 ILE n 1 17 VAL n 1 18 LYS n 1 19 GLY n 1 20 ALA n 1 21 GLN n 1 22 GLY n 1 23 PHE n 1 24 GLY n 1 25 PHE n 1 26 THR n 1 27 ILE n 1 28 ALA n 1 29 ASP n 1 30 SER n 1 31 PRO n 1 32 THR n 1 33 GLY n 1 34 GLN n 1 35 ARG n 1 36 VAL n 1 37 LYS n 1 38 GLN n 1 39 ILE n 1 40 LEU n 1 41 ASP n 1 42 ILE n 1 43 GLN n 1 44 GLY n 1 45 CYS n 1 46 PRO n 1 47 GLY n 1 48 LEU n 1 49 CYS n 1 50 GLU n 1 51 GLY n 1 52 ASP n 1 53 LEU n 1 54 ILE n 1 55 VAL n 1 56 GLU n 1 57 ILE n 1 58 ASN n 1 59 GLN n 1 60 GLN n 1 61 ASN n 1 62 VAL n 1 63 GLN n 1 64 ASN n 1 65 LEU n 1 66 SER n 1 67 HIS n 1 68 THR n 1 69 GLU n 1 70 VAL n 1 71 VAL n 1 72 ASP n 1 73 ILE n 1 74 LEU n 1 75 LYS n 1 76 ASP n 1 77 CYS n 1 78 PRO n 1 79 ILE n 1 80 GLY n 1 81 SER n 1 82 GLU n 1 83 THR n 1 84 SER n 1 85 LEU n 1 86 ILE n 1 87 ILE n 1 88 HIS n 1 89 ARG n 1 90 GLY n 1 91 SER n 1 92 GLY n 1 93 PRO n 1 94 SER n 1 95 SER n 1 96 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'KAZUSA cDNA hg03359' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P021030-28 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 GLY 96 96 96 GLY GLY A . n # _exptl.entry_id 1UJV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1UJV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1UJV _struct.title 'Solution structure of the second PDZ domain of human membrane associated guanylate kinase inverted-2 (MAGI-2)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1UJV _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AIP1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QAELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCPIGSETSLII HRG ; _struct_ref.pdbx_align_begin 642 _struct_ref.pdbx_db_accession Q86UL8 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1UJV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 90 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q86UL8 _struct_ref_seq.db_align_beg 642 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 724 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 90 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1UJV GLY A 1 ? UNP Q86UL8 ? ? 'cloning artifact' 1 1 1 1UJV SER A 2 ? UNP Q86UL8 ? ? 'cloning artifact' 2 2 1 1UJV SER A 3 ? UNP Q86UL8 ? ? 'cloning artifact' 3 3 1 1UJV GLY A 4 ? UNP Q86UL8 ? ? 'cloning artifact' 4 4 1 1UJV SER A 5 ? UNP Q86UL8 ? ? 'cloning artifact' 5 5 1 1UJV SER A 6 ? UNP Q86UL8 ? ? 'cloning artifact' 6 6 1 1UJV GLY A 7 ? UNP Q86UL8 ? ? 'cloning artifact' 7 7 1 1UJV SER A 91 ? UNP Q86UL8 ? ? 'cloning artifact' 91 8 1 1UJV GLY A 92 ? UNP Q86UL8 ? ? 'cloning artifact' 92 9 1 1UJV PRO A 93 ? UNP Q86UL8 ? ? 'cloning artifact' 93 10 1 1UJV SER A 94 ? UNP Q86UL8 ? ? 'cloning artifact' 94 11 1 1UJV SER A 95 ? UNP Q86UL8 ? ? 'cloning artifact' 95 12 1 1UJV GLY A 96 ? UNP Q86UL8 ? ? 'cloning artifact' 96 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id HIS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 67 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 76 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id HIS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 67 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 76 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 12 ? VAL A 17 ? MET A 12 VAL A 17 A 2 GLU A 82 ? HIS A 88 ? GLU A 82 HIS A 88 A 3 LEU A 53 ? ILE A 57 ? LEU A 53 ILE A 57 A 4 GLN A 60 ? ASN A 61 ? GLN A 60 ASN A 61 B 1 PHE A 25 ? SER A 30 ? PHE A 25 SER A 30 B 2 GLY A 33 ? ILE A 39 ? GLY A 33 ILE A 39 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 14 ? N LEU A 14 O LEU A 85 ? O LEU A 85 A 2 3 O ILE A 86 ? O ILE A 86 N GLU A 56 ? N GLU A 56 A 3 4 N ILE A 57 ? N ILE A 57 O GLN A 60 ? O GLN A 60 B 1 2 N THR A 26 ? N THR A 26 O GLN A 38 ? O GLN A 38 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG A SER 30 ? ? O A GLY 33 ? ? 1.60 2 3 HG A SER 30 ? ? O A GLY 33 ? ? 1.55 3 4 HG A SER 30 ? ? O A GLY 33 ? ? 1.57 4 6 HG A SER 30 ? ? O A GLY 33 ? ? 1.60 5 8 HG A SER 30 ? ? O A GLY 33 ? ? 1.55 6 9 HG A SER 30 ? ? O A GLY 33 ? ? 1.57 7 11 OE2 A GLU 10 ? ? HG A SER 91 ? ? 1.56 8 11 HG A SER 30 ? ? O A GLY 33 ? ? 1.59 9 13 HG A SER 30 ? ? O A GLY 33 ? ? 1.59 10 17 HG A SER 30 ? ? O A GLY 33 ? ? 1.56 11 19 HG A SER 30 ? ? O A GLY 33 ? ? 1.60 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 89 ? ? CZ A ARG 89 ? ? NH2 A ARG 89 ? ? 117.08 120.30 -3.22 0.50 N 2 2 NE A ARG 89 ? ? CZ A ARG 89 ? ? NH2 A ARG 89 ? ? 117.04 120.30 -3.26 0.50 N 3 9 CB A LEU 48 ? ? CG A LEU 48 ? ? CD2 A LEU 48 ? ? 121.98 111.00 10.98 1.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -123.19 -56.49 2 1 SER A 3 ? ? 44.30 -141.79 3 1 ALA A 20 ? ? -157.64 -62.41 4 1 GLN A 21 ? ? -65.10 6.40 5 1 PHE A 23 ? ? 63.54 173.06 6 1 CYS A 45 ? ? -150.23 57.99 7 1 GLU A 50 ? ? 66.20 152.30 8 1 VAL A 55 ? ? -124.78 -51.60 9 1 SER A 94 ? ? -166.82 118.23 10 2 SER A 5 ? ? 66.19 117.68 11 2 ALA A 9 ? ? -152.24 -8.71 12 2 GLU A 10 ? ? -59.46 109.34 13 2 ALA A 20 ? ? 54.27 -166.92 14 2 GLN A 21 ? ? 40.47 9.70 15 2 PHE A 23 ? ? 63.75 174.61 16 2 ASP A 52 ? ? -58.48 -173.32 17 2 VAL A 55 ? ? -124.28 -58.08 18 2 SER A 94 ? ? -147.89 -63.17 19 3 SER A 2 ? ? -61.82 97.82 20 3 SER A 5 ? ? 72.77 -81.39 21 3 SER A 6 ? ? 62.52 150.30 22 3 ALA A 20 ? ? -157.32 -62.44 23 3 PHE A 23 ? ? 84.90 -11.46 24 3 PHE A 25 ? ? -49.40 151.05 25 3 ASN A 58 ? ? 32.28 54.42 26 3 GLN A 59 ? ? 47.78 4.49 27 3 ASN A 61 ? ? 65.88 126.42 28 3 ARG A 89 ? ? -141.61 -45.76 29 3 SER A 91 ? ? 175.51 -41.10 30 3 SER A 94 ? ? 84.34 102.11 31 4 SER A 6 ? ? 53.70 -171.00 32 4 ALA A 20 ? ? -160.34 -58.11 33 4 PHE A 23 ? ? 69.69 -71.53 34 4 VAL A 55 ? ? -130.46 -52.24 35 4 GLN A 59 ? ? 72.77 -1.42 36 4 ARG A 89 ? ? -160.67 113.94 37 4 SER A 91 ? ? 74.17 152.31 38 4 SER A 94 ? ? 132.94 107.57 39 4 SER A 95 ? ? 80.40 142.57 40 5 SER A 3 ? ? 51.87 73.45 41 5 SER A 5 ? ? 54.32 117.64 42 5 SER A 6 ? ? -154.49 85.53 43 5 ALA A 9 ? ? 50.59 86.08 44 5 LEU A 11 ? ? 51.05 167.80 45 5 PHE A 23 ? ? 77.00 168.08 46 5 PRO A 31 ? ? -69.89 11.33 47 5 ASP A 52 ? ? -57.15 -174.99 48 5 GLN A 59 ? ? 65.64 -24.11 49 5 ARG A 89 ? ? -160.35 87.41 50 6 SER A 2 ? ? 73.11 93.43 51 6 SER A 5 ? ? 56.00 -63.36 52 6 GLN A 21 ? ? 55.71 -3.31 53 6 LYS A 37 ? ? -106.09 -64.59 54 6 LEU A 40 ? ? -122.26 -50.57 55 6 ASP A 52 ? ? -51.51 105.53 56 6 GLN A 59 ? ? 67.06 -18.78 57 6 SER A 91 ? ? 51.80 89.05 58 7 SER A 5 ? ? -175.13 83.60 59 7 LEU A 11 ? ? -69.83 -156.70 60 7 ALA A 20 ? ? -164.55 -52.87 61 7 GLU A 50 ? ? 65.29 150.96 62 7 VAL A 55 ? ? -128.49 -55.74 63 7 SER A 95 ? ? 71.82 105.00 64 8 SER A 2 ? ? -64.53 88.29 65 8 SER A 5 ? ? -54.24 104.63 66 8 LEU A 11 ? ? -68.53 -176.97 67 8 GLN A 21 ? ? 61.64 -35.68 68 8 PRO A 31 ? ? -67.96 12.73 69 8 THR A 32 ? ? -144.17 -3.72 70 8 ASP A 41 ? ? -154.68 69.58 71 8 ASN A 58 ? ? 38.92 54.92 72 8 GLN A 59 ? ? 61.66 -6.89 73 8 ARG A 89 ? ? -151.51 -70.04 74 8 SER A 95 ? ? 46.74 78.87 75 9 SER A 6 ? ? 61.46 121.09 76 9 GLN A 8 ? ? -161.98 86.20 77 9 ALA A 20 ? ? 72.07 -42.43 78 9 PHE A 23 ? ? 65.91 149.92 79 9 ASP A 52 ? ? -65.90 -170.80 80 9 ASN A 61 ? ? 54.95 133.19 81 9 SER A 94 ? ? 64.66 -178.37 82 10 SER A 2 ? ? 59.71 -174.22 83 10 SER A 5 ? ? -157.14 -59.83 84 10 GLU A 10 ? ? -43.66 98.22 85 10 ALA A 20 ? ? 60.52 154.21 86 10 GLN A 21 ? ? 47.78 -0.17 87 10 PHE A 25 ? ? -64.47 -179.13 88 10 SER A 95 ? ? 72.27 -176.35 89 11 SER A 3 ? ? 51.09 -166.72 90 11 GLN A 8 ? ? -32.36 100.66 91 11 GLU A 10 ? ? 43.56 76.60 92 11 ALA A 20 ? ? -147.82 -60.34 93 11 GLN A 21 ? ? -82.74 44.73 94 11 PHE A 23 ? ? 62.09 -86.85 95 11 PRO A 31 ? ? -62.17 1.45 96 11 ASP A 52 ? ? -64.57 -167.17 97 11 VAL A 55 ? ? -122.68 -56.90 98 11 ARG A 89 ? ? -159.12 -51.56 99 11 SER A 91 ? ? -69.69 -70.73 100 11 SER A 95 ? ? 65.20 168.91 101 12 SER A 3 ? ? 60.14 168.52 102 12 SER A 5 ? ? 74.97 125.03 103 12 GLN A 8 ? ? 66.80 -176.44 104 12 ALA A 20 ? ? -153.21 -73.50 105 12 GLN A 21 ? ? -76.41 36.22 106 12 ASP A 52 ? ? -58.63 -177.00 107 12 ASN A 58 ? ? 67.82 -54.42 108 12 GLN A 59 ? ? 165.27 13.85 109 12 HIS A 88 ? ? -108.81 74.86 110 12 ARG A 89 ? ? -108.45 68.70 111 13 SER A 2 ? ? -145.53 -38.86 112 13 SER A 5 ? ? 60.92 174.60 113 13 LEU A 11 ? ? 56.45 -162.69 114 13 PHE A 23 ? ? 61.13 -175.97 115 13 LEU A 40 ? ? -123.67 -58.20 116 13 VAL A 55 ? ? -130.20 -53.62 117 14 SER A 2 ? ? 52.32 -178.52 118 14 SER A 3 ? ? -142.72 -23.30 119 14 GLU A 10 ? ? -160.58 115.23 120 14 ALA A 20 ? ? 62.23 152.83 121 14 GLN A 21 ? ? 65.42 -25.42 122 14 LYS A 37 ? ? -70.60 -74.18 123 14 GLU A 50 ? ? 62.60 151.22 124 14 GLN A 59 ? ? 59.94 -7.12 125 14 SER A 91 ? ? -145.02 -105.88 126 15 GLN A 8 ? ? 64.09 136.62 127 15 ALA A 20 ? ? 46.97 -84.58 128 15 VAL A 55 ? ? -122.45 -57.04 129 15 GLN A 59 ? ? 57.51 4.54 130 15 GLN A 63 ? ? -59.72 -6.69 131 15 ARG A 89 ? ? -159.63 -145.67 132 16 SER A 6 ? ? 59.76 174.73 133 16 GLU A 10 ? ? 65.41 97.78 134 16 PRO A 31 ? ? -64.09 10.52 135 16 LEU A 40 ? ? -123.13 -54.52 136 16 CYS A 45 ? ? -118.84 60.50 137 16 ASN A 58 ? ? 35.89 57.11 138 16 GLN A 63 ? ? -51.57 -9.98 139 16 PRO A 93 ? ? -78.32 -164.17 140 16 SER A 95 ? ? -67.34 -175.69 141 17 SER A 5 ? ? 109.83 159.93 142 17 GLN A 21 ? ? 60.87 -16.45 143 17 THR A 32 ? ? -147.63 -2.64 144 17 ASP A 52 ? ? -64.44 -159.78 145 17 ASN A 58 ? ? 65.68 -36.96 146 17 GLN A 59 ? ? 162.31 -7.54 147 17 SER A 94 ? ? -178.30 149.34 148 17 SER A 95 ? ? 63.42 177.99 149 18 SER A 3 ? ? 55.01 173.63 150 18 SER A 6 ? ? 57.16 85.66 151 18 LEU A 11 ? ? 49.50 -160.75 152 18 PHE A 25 ? ? -58.56 170.25 153 18 PRO A 31 ? ? -67.63 4.14 154 18 LYS A 37 ? ? -75.36 -70.57 155 18 CYS A 45 ? ? -153.03 67.15 156 18 ILE A 57 ? ? -111.41 -157.03 157 18 ASN A 58 ? ? -53.25 76.56 158 19 SER A 3 ? ? -171.47 100.61 159 19 ALA A 20 ? ? -156.90 -70.68 160 19 ASP A 41 ? ? -164.55 81.41 161 19 ASN A 58 ? ? 39.95 47.99 162 19 HIS A 88 ? ? -75.29 -120.32 163 19 ARG A 89 ? ? 59.28 -107.22 164 20 SER A 2 ? ? 67.72 173.12 165 20 SER A 5 ? ? 45.08 -81.46 166 20 ALA A 9 ? ? 65.06 161.66 167 20 LYS A 18 ? ? -53.64 109.17 168 20 ALA A 20 ? ? 59.56 162.41 169 20 GLN A 21 ? ? 52.32 -10.29 170 20 ASN A 58 ? ? 33.57 56.66 171 20 ARG A 89 ? ? -83.88 -155.67 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 14 GLY A 1 ? ? SER A 2 ? ? -138.91 2 14 VAL A 17 ? ? LYS A 18 ? ? -145.66 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 4 ARG A 89 ? ? 0.078 'SIDE CHAIN' 2 9 PHE A 25 ? ? 0.082 'SIDE CHAIN' 3 10 ARG A 35 ? ? 0.092 'SIDE CHAIN' 4 16 ARG A 35 ? ? 0.109 'SIDE CHAIN' # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX Determination method: author determined ; # _pdbx_nmr_ensemble.entry_id 1UJV _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1UJV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.3mM PDZ domain U-15N, 13C; 20mM d-Tris-HCl (pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.entry_id 1UJV _pdbx_nmr_refine.method 'torsion angle dynamics, restrained molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 NMRPipe 20020425 processing 'Delaglio, F.' 2 NMRView 5.0.4 'data analysis' 'Johnson, B.A.' 3 KUJIRA 0.811 'data analysis' 'Kobayashi, N.' 4 CYANA 1.0.7 'structure solution' 'Guentert, P.' 5 OPALp ? refinement 'Koradi, R., Billeter, M., Guentert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 VAL N N N N 318 VAL CA C N S 319 VAL C C N N 320 VAL O O N N 321 VAL CB C N N 322 VAL CG1 C N N 323 VAL CG2 C N N 324 VAL OXT O N N 325 VAL H H N N 326 VAL H2 H N N 327 VAL HA H N N 328 VAL HB H N N 329 VAL HG11 H N N 330 VAL HG12 H N N 331 VAL HG13 H N N 332 VAL HG21 H N N 333 VAL HG22 H N N 334 VAL HG23 H N N 335 VAL HXT H N N 336 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 VAL N CA sing N N 304 VAL N H sing N N 305 VAL N H2 sing N N 306 VAL CA C sing N N 307 VAL CA CB sing N N 308 VAL CA HA sing N N 309 VAL C O doub N N 310 VAL C OXT sing N N 311 VAL CB CG1 sing N N 312 VAL CB CG2 sing N N 313 VAL CB HB sing N N 314 VAL CG1 HG11 sing N N 315 VAL CG1 HG12 sing N N 316 VAL CG1 HG13 sing N N 317 VAL CG2 HG21 sing N N 318 VAL CG2 HG22 sing N N 319 VAL CG2 HG23 sing N N 320 VAL OXT HXT sing N N 321 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 1UJV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_