data_1UW1 # _entry.id 1UW1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.308 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1UW1 PDBE EBI-14448 WWPDB D_1290014448 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1UW1 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2004-01-28 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lo Surdo, P.' 1 'Walsh, M.A.' 2 'Sollazzo, M.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'A Novel Adp- and Zinc-Binding Fold from Function-Directed in Vitro Evolution' Nat.Struct.Mol.Biol. 11 382 ? 2004 ? US 1545-9993 ? ? 15024384 10.1038/NSMB745 1 'Functional Proteins from a Random Sequence Library' Nature 410 715 ? 2001 NATUAS UK 0028-0836 0006 ? 11287961 10.1038/35070613 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lo Surdo, P.' 1 ? primary 'Walsh, M.A.' 2 ? primary 'Sollazzo, M.' 3 ? 1 'Keefe, A.D.' 4 ? 1 'Szostak, J.W.' 5 ? # _cell.entry_id 1UW1 _cell.length_a 71.077 _cell.length_b 71.077 _cell.length_c 54.883 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1UW1 _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ARTIFICIAL NUCLEOTIDE BINDING PROTEIN (ANBP)' 9605.979 1 ? ? 'NUCLEOTIDE BINDING DOMAIN' ;THIS IS A RANDOMLY GENERATED PROTEIN. THE PROTEIN WAS ISOLATED BY CYCLES OF IN VITRO EVOLUTIONARY SELECTION, FROM A RANDOM-SEQUENCE LIBRARY OF 6 X 10**12 MRNA-DISPLAYED PROTEINS. EVOLUTION OF THE PROTEINS PRODUCED WAS DIRECTED BY THE ABILITY TO BIND ATP ; 2 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE" 427.201 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 water nat water 18.015 99 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GAMDYKDDDDKKTNWLKRIYRVRPCVKCKVAPRNWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHDDWLMYADSKEISN _entity_poly.pdbx_seq_one_letter_code_can GAMDYKDDDDKKTNWLKRIYRVRPCVKCKVAPRNWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHDDWLMYADSKEISN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 ASP n 1 5 TYR n 1 6 LYS n 1 7 ASP n 1 8 ASP n 1 9 ASP n 1 10 ASP n 1 11 LYS n 1 12 LYS n 1 13 THR n 1 14 ASN n 1 15 TRP n 1 16 LEU n 1 17 LYS n 1 18 ARG n 1 19 ILE n 1 20 TYR n 1 21 ARG n 1 22 VAL n 1 23 ARG n 1 24 PRO n 1 25 CYS n 1 26 VAL n 1 27 LYS n 1 28 CYS n 1 29 LYS n 1 30 VAL n 1 31 ALA n 1 32 PRO n 1 33 ARG n 1 34 ASN n 1 35 TRP n 1 36 LYS n 1 37 VAL n 1 38 LYS n 1 39 ASN n 1 40 LYS n 1 41 HIS n 1 42 LEU n 1 43 ARG n 1 44 ILE n 1 45 TYR n 1 46 ASN n 1 47 MET n 1 48 CYS n 1 49 LYS n 1 50 THR n 1 51 CYS n 1 52 PHE n 1 53 ASN n 1 54 ASN n 1 55 SER n 1 56 ILE n 1 57 ASP n 1 58 ILE n 1 59 GLY n 1 60 ASP n 1 61 ASP n 1 62 THR n 1 63 TYR n 1 64 HIS n 1 65 GLY n 1 66 HIS n 1 67 ASP n 1 68 ASP n 1 69 TRP n 1 70 LEU n 1 71 MET n 1 72 TYR n 1 73 ALA n 1 74 ASP n 1 75 SER n 1 76 LYS n 1 77 GLU n 1 78 ILE n 1 79 SER n 1 80 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'SYNTHETIC CONSTRUCT' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'MODIFIED PET-24D WITH N-HIS-TEV CLEAVAGE SITE' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'SYNTHETIC GENE' # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 1UW1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession 1UW1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1UW1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 80 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 1UW1 _struct_ref_seq.db_align_beg -2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 78 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -2 _struct_ref_seq.pdbx_auth_seq_align_end 78 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ADP non-polymer n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 1UW1 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 4.4 _exptl_crystal.density_percent_sol 72.1 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.50 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;USING THE HANGING-DROP VAPOR DIFFUSION TECHIQUE. 20MG/ML OF PROTEIN WAS MIXED IN EQUAL VOLUMES WITH A CRYSTALLIZATION BUFFER OF 0.1M TRIS/HCL PH 8.5, 0.2 M SODIUM CITRATE, 30% PEG 400) ; # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2002-11-15 _diffrn_detector.details 'BENT + TOROIDAL' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator SI111 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.95372 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE BM14' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline BM14 _diffrn_source.pdbx_wavelength 0.95372 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1UW1 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 30.000 _reflns.d_resolution_high 1.940 _reflns.number_obs 12124 _reflns.number_all ? _reflns.percent_possible_obs 99.5 _reflns.pdbx_Rmerge_I_obs 0.06900 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 32.0000 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 9.000 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.94 _reflns_shell.d_res_low 2.00 _reflns_shell.percent_possible_all 99.3 _reflns_shell.Rmerge_I_obs 0.47700 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 7.300 _reflns_shell.pdbx_redundancy 7.00 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1UW1 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 11530 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.00 _refine.ls_d_res_high 1.94 _refine.ls_percent_reflns_obs 99.6 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.200 _refine.ls_R_factor_R_free 0.228 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.800 _refine.ls_number_reflns_R_free 578 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.943 _refine.correlation_coeff_Fo_to_Fc_free 0.921 _refine.B_iso_mean 24.71 _refine.aniso_B[1][1] 1.27000 _refine.aniso_B[2][2] 1.27000 _refine.aniso_B[3][3] -1.90000 _refine.aniso_B[1][2] 0.63000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details 'BABINET MODEL PLUS MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. RESIDUES FROM BOTH THE N- AND C-TERMINII WERE NOT VISIBLE IN THE ELECTRON DENSITY. THESE RESIDUES WERE OMITTED FROM THE MODEL. THE REFINED MODEL CONTAINS RESIDUES 7- 73. RESIDUES 7-10 OF THE N-TERMINUS ARE NOT IN WELL DEFINED ELECTRON DENSITY. UNACCOUNTED SOLVENT DENSITY IS LOCATED CLOSE TO RESIDUES TYR18 AND TRP35 ; _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.112 _refine.pdbx_overall_ESU_R_Free 0.111 _refine.overall_SU_ML 0.058 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 1.981 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 568 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 99 _refine_hist.number_atoms_total 695 _refine_hist.d_res_high 1.94 _refine_hist.d_res_low 30.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.018 0.021 ? 612 'X-RAY DIFFRACTION' ? r_bond_other_d 0.002 0.020 ? 510 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.734 1.966 ? 830 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.964 3.000 ? 1195 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.054 5.000 ? 66 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_chiral_restr 0.108 0.200 ? 83 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.008 0.020 ? 642 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.005 0.020 ? 126 'X-RAY DIFFRACTION' ? r_nbd_refined 0.211 0.200 ? 128 'X-RAY DIFFRACTION' ? r_nbd_other 0.246 0.200 ? 586 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other 0.089 0.200 ? 359 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.267 0.200 ? 60 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.201 0.200 ? 2 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.297 0.200 ? 32 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.371 0.200 ? 19 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.286 1.500 ? 334 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.248 2.000 ? 542 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 3.187 3.000 ? 278 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 4.996 4.500 ? 288 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.94 _refine_ls_shell.d_res_low 1.99 _refine_ls_shell.number_reflns_R_work 819 _refine_ls_shell.R_factor_R_work 0.2280 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.2080 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 52 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 1UW1 _struct.title 'A Novel ADP- and Zinc-binding fold from function-directed in vitro evolution' _struct.pdbx_descriptor 'ARTIFICIAL NUCLEOTIDE BINDING PROTEIN (ANBP)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1UW1 _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' _struct_keywords.text 'ARTIFICIAL NUCLEOTIDE BINDING PROTEIN, NUCLEOTIDE BINDING PROTEIN, IN VITRO EVOLUTION, DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 10 ? VAL A 22 ? ASP A 8 VAL A 20 1 ? 13 HELX_P HELX_P2 2 CYS A 48 ? GLY A 59 ? CYS A 46 GLY A 57 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 28 SG ? ? A ZN 1075 A CYS 26 1_555 ? ? ? ? ? ? ? 2.398 ? metalc2 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 51 SG ? ? A ZN 1075 A CYS 49 1_555 ? ? ? ? ? ? ? 2.399 ? metalc3 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 48 SG ? ? A ZN 1075 A CYS 46 1_555 ? ? ? ? ? ? ? 2.450 ? metalc4 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 25 SG ? ? A ZN 1075 A CYS 23 1_555 ? ? ? ? ? ? ? 2.452 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 TRP A 35 ? LYS A 38 ? TRP A 33 LYS A 36 AA 2 HIS A 41 ? TYR A 45 ? HIS A 39 TYR A 43 AA 3 HIS A 66 ? LEU A 70 ? HIS A 64 LEU A 68 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N LYS A 38 ? N LYS A 36 O HIS A 41 ? O HIS A 39 AA 2 3 N ILE A 44 ? N ILE A 42 O ASP A 67 ? O ASP A 65 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1075' AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE ADP A 1074' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 25 ? CYS A 23 . ? 1_555 ? 2 AC1 4 CYS A 28 ? CYS A 26 . ? 1_555 ? 3 AC1 4 CYS A 48 ? CYS A 46 . ? 1_555 ? 4 AC1 4 CYS A 51 ? CYS A 49 . ? 1_555 ? 5 AC2 17 LYS A 36 ? LYS A 34 . ? 1_555 ? 6 AC2 17 LYS A 38 ? LYS A 36 . ? 1_555 ? 7 AC2 17 ARG A 43 ? ARG A 41 . ? 1_555 ? 8 AC2 17 TYR A 45 ? TYR A 43 . ? 1_555 ? 9 AC2 17 ASN A 46 ? ASN A 44 . ? 1_555 ? 10 AC2 17 MET A 47 ? MET A 45 . ? 1_555 ? 11 AC2 17 PHE A 52 ? PHE A 50 . ? 1_555 ? 12 AC2 17 TYR A 63 ? TYR A 61 . ? 1_555 ? 13 AC2 17 HIS A 64 ? HIS A 62 . ? 1_555 ? 14 AC2 17 GLY A 65 ? GLY A 63 . ? 1_555 ? 15 AC2 17 HIS A 66 ? HIS A 64 . ? 1_555 ? 16 AC2 17 HOH D . ? HOH A 2093 . ? 1_555 ? 17 AC2 17 HOH D . ? HOH A 2094 . ? 1_555 ? 18 AC2 17 HOH D . ? HOH A 2095 . ? 1_555 ? 19 AC2 17 HOH D . ? HOH A 2096 . ? 1_555 ? 20 AC2 17 HOH D . ? HOH A 2097 . ? 1_555 ? 21 AC2 17 HOH D . ? HOH A 2098 . ? 1_555 ? # _database_PDB_matrix.entry_id 1UW1 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1UW1 _atom_sites.fract_transf_matrix[1][1] 0.014069 _atom_sites.fract_transf_matrix[1][2] 0.008123 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016246 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018220 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 ALA 2 -1 ? ? ? A . n A 1 3 MET 3 1 ? ? ? A . n A 1 4 ASP 4 2 ? ? ? A . n A 1 5 TYR 5 3 ? ? ? A . n A 1 6 LYS 6 4 ? ? ? A . n A 1 7 ASP 7 5 ? ? ? A . n A 1 8 ASP 8 6 ? ? ? A . n A 1 9 ASP 9 7 7 ASP ASP A . n A 1 10 ASP 10 8 8 ASP ASP A . n A 1 11 LYS 11 9 9 LYS LYS A . n A 1 12 LYS 12 10 10 LYS LYS A . n A 1 13 THR 13 11 11 THR THR A . n A 1 14 ASN 14 12 12 ASN ASN A . n A 1 15 TRP 15 13 13 TRP TRP A . n A 1 16 LEU 16 14 14 LEU LEU A . n A 1 17 LYS 17 15 15 LYS LYS A . n A 1 18 ARG 18 16 16 ARG ARG A . n A 1 19 ILE 19 17 17 ILE ILE A . n A 1 20 TYR 20 18 18 TYR TYR A . n A 1 21 ARG 21 19 19 ARG ARG A . n A 1 22 VAL 22 20 20 VAL VAL A . n A 1 23 ARG 23 21 21 ARG ARG A . n A 1 24 PRO 24 22 22 PRO PRO A . n A 1 25 CYS 25 23 23 CYS CYS A . n A 1 26 VAL 26 24 24 VAL VAL A . n A 1 27 LYS 27 25 25 LYS LYS A . n A 1 28 CYS 28 26 26 CYS CYS A . n A 1 29 LYS 29 27 27 LYS LYS A . n A 1 30 VAL 30 28 28 VAL VAL A . n A 1 31 ALA 31 29 29 ALA ALA A . n A 1 32 PRO 32 30 30 PRO PRO A . n A 1 33 ARG 33 31 31 ARG ARG A . n A 1 34 ASN 34 32 32 ASN ASN A . n A 1 35 TRP 35 33 33 TRP TRP A . n A 1 36 LYS 36 34 34 LYS LYS A . n A 1 37 VAL 37 35 35 VAL VAL A . n A 1 38 LYS 38 36 36 LYS LYS A . n A 1 39 ASN 39 37 37 ASN ASN A . n A 1 40 LYS 40 38 38 LYS LYS A . n A 1 41 HIS 41 39 39 HIS HIS A . n A 1 42 LEU 42 40 40 LEU LEU A . n A 1 43 ARG 43 41 41 ARG ARG A . n A 1 44 ILE 44 42 42 ILE ILE A . n A 1 45 TYR 45 43 43 TYR TYR A . n A 1 46 ASN 46 44 44 ASN ASN A . n A 1 47 MET 47 45 45 MET MET A . n A 1 48 CYS 48 46 46 CYS CYS A . n A 1 49 LYS 49 47 47 LYS LYS A . n A 1 50 THR 50 48 48 THR THR A . n A 1 51 CYS 51 49 49 CYS CYS A . n A 1 52 PHE 52 50 50 PHE PHE A . n A 1 53 ASN 53 51 51 ASN ASN A . n A 1 54 ASN 54 52 52 ASN ASN A . n A 1 55 SER 55 53 53 SER SER A . n A 1 56 ILE 56 54 54 ILE ILE A . n A 1 57 ASP 57 55 55 ASP ASP A . n A 1 58 ILE 58 56 56 ILE ILE A . n A 1 59 GLY 59 57 57 GLY GLY A . n A 1 60 ASP 60 58 58 ASP ASP A . n A 1 61 ASP 61 59 59 ASP ASP A . n A 1 62 THR 62 60 60 THR THR A . n A 1 63 TYR 63 61 61 TYR TYR A . n A 1 64 HIS 64 62 62 HIS HIS A . n A 1 65 GLY 65 63 63 GLY GLY A . n A 1 66 HIS 66 64 64 HIS HIS A . n A 1 67 ASP 67 65 65 ASP ASP A . n A 1 68 ASP 68 66 66 ASP ASP A . n A 1 69 TRP 69 67 67 TRP TRP A . n A 1 70 LEU 70 68 68 LEU LEU A . n A 1 71 MET 71 69 69 MET MET A . n A 1 72 TYR 72 70 70 TYR TYR A . n A 1 73 ALA 73 71 71 ALA ALA A . n A 1 74 ASP 74 72 72 ASP ASP A . n A 1 75 SER 75 73 73 SER SER A . n A 1 76 LYS 76 74 ? ? ? A . n A 1 77 GLU 77 75 ? ? ? A . n A 1 78 ILE 78 76 ? ? ? A . n A 1 79 SER 79 77 ? ? ? A . n A 1 80 ASN 80 78 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ADP 1 1074 1074 ADP ADP A . C 3 ZN 1 1075 1075 ZN ZN A . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . D 4 HOH 21 2021 2021 HOH HOH A . D 4 HOH 22 2022 2022 HOH HOH A . D 4 HOH 23 2023 2023 HOH HOH A . D 4 HOH 24 2024 2024 HOH HOH A . D 4 HOH 25 2025 2025 HOH HOH A . D 4 HOH 26 2026 2026 HOH HOH A . D 4 HOH 27 2027 2027 HOH HOH A . D 4 HOH 28 2028 2028 HOH HOH A . D 4 HOH 29 2029 2029 HOH HOH A . D 4 HOH 30 2030 2030 HOH HOH A . D 4 HOH 31 2031 2031 HOH HOH A . D 4 HOH 32 2032 2032 HOH HOH A . D 4 HOH 33 2033 2033 HOH HOH A . D 4 HOH 34 2034 2034 HOH HOH A . D 4 HOH 35 2035 2035 HOH HOH A . D 4 HOH 36 2036 2036 HOH HOH A . D 4 HOH 37 2037 2037 HOH HOH A . D 4 HOH 38 2038 2038 HOH HOH A . D 4 HOH 39 2039 2039 HOH HOH A . D 4 HOH 40 2040 2040 HOH HOH A . D 4 HOH 41 2041 2041 HOH HOH A . D 4 HOH 42 2042 2042 HOH HOH A . D 4 HOH 43 2043 2043 HOH HOH A . D 4 HOH 44 2044 2044 HOH HOH A . D 4 HOH 45 2045 2045 HOH HOH A . D 4 HOH 46 2046 2046 HOH HOH A . D 4 HOH 47 2047 2047 HOH HOH A . D 4 HOH 48 2048 2048 HOH HOH A . D 4 HOH 49 2049 2049 HOH HOH A . D 4 HOH 50 2050 2050 HOH HOH A . D 4 HOH 51 2051 2051 HOH HOH A . D 4 HOH 52 2052 2052 HOH HOH A . D 4 HOH 53 2053 2053 HOH HOH A . D 4 HOH 54 2054 2054 HOH HOH A . D 4 HOH 55 2055 2055 HOH HOH A . D 4 HOH 56 2056 2056 HOH HOH A . D 4 HOH 57 2057 2057 HOH HOH A . D 4 HOH 58 2058 2058 HOH HOH A . D 4 HOH 59 2059 2059 HOH HOH A . D 4 HOH 60 2060 2060 HOH HOH A . D 4 HOH 61 2061 2061 HOH HOH A . D 4 HOH 62 2062 2062 HOH HOH A . D 4 HOH 63 2063 2063 HOH HOH A . D 4 HOH 64 2064 2064 HOH HOH A . D 4 HOH 65 2065 2065 HOH HOH A . D 4 HOH 66 2066 2066 HOH HOH A . D 4 HOH 67 2067 2067 HOH HOH A . D 4 HOH 68 2068 2068 HOH HOH A . D 4 HOH 69 2069 2069 HOH HOH A . D 4 HOH 70 2070 2070 HOH HOH A . D 4 HOH 71 2071 2071 HOH HOH A . D 4 HOH 72 2072 2072 HOH HOH A . D 4 HOH 73 2073 2073 HOH HOH A . D 4 HOH 74 2074 2074 HOH HOH A . D 4 HOH 75 2075 2075 HOH HOH A . D 4 HOH 76 2076 2076 HOH HOH A . D 4 HOH 77 2077 2077 HOH HOH A . D 4 HOH 78 2078 2078 HOH HOH A . D 4 HOH 79 2079 2079 HOH HOH A . D 4 HOH 80 2080 2080 HOH HOH A . D 4 HOH 81 2081 2081 HOH HOH A . D 4 HOH 82 2082 2082 HOH HOH A . D 4 HOH 83 2083 2083 HOH HOH A . D 4 HOH 84 2084 2084 HOH HOH A . D 4 HOH 85 2085 2085 HOH HOH A . D 4 HOH 86 2086 2086 HOH HOH A . D 4 HOH 87 2087 2087 HOH HOH A . D 4 HOH 88 2088 2088 HOH HOH A . D 4 HOH 89 2089 2089 HOH HOH A . D 4 HOH 90 2090 2090 HOH HOH A . D 4 HOH 91 2091 2091 HOH HOH A . D 4 HOH 92 2092 2092 HOH HOH A . D 4 HOH 93 2093 2093 HOH HOH A . D 4 HOH 94 2094 2094 HOH HOH A . D 4 HOH 95 2095 2095 HOH HOH A . D 4 HOH 96 2096 2096 HOH HOH A . D 4 HOH 97 2097 2097 HOH HOH A . D 4 HOH 98 2098 2098 HOH HOH A . D 4 HOH 99 2099 2099 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2590 ? 1 MORE -13.0 ? 1 'SSA (A^2)' 8730 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_675 x-y+1,-y+2,-z+1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 123.1089752496 0.0000000000 0.0000000000 -1.0000000000 18.2943333333 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 2090 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 28 ? A CYS 26 ? 1_555 ZN ? C ZN . ? A ZN 1075 ? 1_555 SG ? A CYS 51 ? A CYS 49 ? 1_555 111.5 ? 2 SG ? A CYS 28 ? A CYS 26 ? 1_555 ZN ? C ZN . ? A ZN 1075 ? 1_555 SG ? A CYS 48 ? A CYS 46 ? 1_555 118.5 ? 3 SG ? A CYS 51 ? A CYS 49 ? 1_555 ZN ? C ZN . ? A ZN 1075 ? 1_555 SG ? A CYS 48 ? A CYS 46 ? 1_555 100.7 ? 4 SG ? A CYS 28 ? A CYS 26 ? 1_555 ZN ? C ZN . ? A ZN 1075 ? 1_555 SG ? A CYS 25 ? A CYS 23 ? 1_555 104.9 ? 5 SG ? A CYS 51 ? A CYS 49 ? 1_555 ZN ? C ZN . ? A ZN 1075 ? 1_555 SG ? A CYS 25 ? A CYS 23 ? 1_555 109.9 ? 6 SG ? A CYS 48 ? A CYS 46 ? 1_555 ZN ? C ZN . ? A ZN 1075 ? 1_555 SG ? A CYS 25 ? A CYS 23 ? 1_555 111.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-03-26 2 'Structure model' 1 1 2015-10-21 3 'Structure model' 1 2 2019-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Derived calculations' 2 2 'Structure model' 'Non-polymer description' 3 2 'Structure model' Other 4 2 'Structure model' 'Source and taxonomy' 5 2 'Structure model' 'Structure summary' 6 2 'Structure model' 'Version format compliance' 7 3 'Structure model' 'Data collection' 8 3 'Structure model' 'Experimental preparation' 9 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' exptl_crystal_grow 2 3 'Structure model' pdbx_database_proc 3 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_exptl_crystal_grow.method' 2 3 'Structure model' '_pdbx_database_status.recvd_author_approval' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.1.24 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 SHELXD phasing . ? 4 # _pdbx_entry_details.entry_id 1UW1 _pdbx_entry_details.compound_details ;THE ORIGINAL FUNCTIONAL PROTEIN ISOLATED BY KEEFE AND SZOSTAK (NCBI: AAK50879, GI:13958624) CONSISTED OF 109 AMINO ACID RESIDUES.A SERIES OF CONSTRUCTS WERE PRODUCED TO IDENTIFY THE FUNCTIONAL CORE OF THE PROTEIN TO AID STRUCTURAL STUDIES. THIS IS A RANDOMLY GENERATED PROTEIN. THE PROTEON WAS ISOLATED BY CYCLES OF IN VITRO EVOLUTIONARY SELECTION FROM A RANDOM-SEQUENCE LIBRARY OF 6 X 10**12 MRNA-DISPLAYED PROTEINS. EVOLUTION OF THE PROTEINS PRODUCED WAS DIRECTED BY THE ABILITY TO BIND ATP. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THE ORIGINAL FUNCTIONAL PROTEIN ISOLATED BY KEEFE AND SZOSTAK (NCBI: AAK50879, GI:13958624) CONSISTED OF 109 AMINO ACID RESIDUES.A SERIES OF CONSTRUCTS WERE PRODUCED TO IDENTIFY THE FUNCTIONAL CORE OF THE PROTEIN TO AID STRUCTURAL STUDIES. THIS ENTRY CORRESPONDS TO CONSTRUCT REFERRED TO AS ANBP. THE ANBP CONSTRUCT CONSISTS OF RESIDUES 1-78 WHICH WAS EXPRESSED WITH AN N-TERMINAL 6-HIS TAG THAT WAS REMOVED BY CLEAVAGE WITH TEV PROTEASE BEFORE BEING CRYSTALLIZED. THIS GIVES AN INSERTION OF TWO RESIDUES, GA, AT THE N-TER). THIS IS A RANDOMLY GENERATED PROTEIN. THE PROTEON WAS ISOLATED BY CYCLES OF IN VITRO EVOLUTIONARY SELECTION FROM A RANDOM-SEQUENCE LIBRARY OF 6 X 10**12 MRNA-DISPLAYED PROTEINS. EVOLUTION OF THE PROTEINS PRODUCED WAS DIRECTED BY THE ABILITY TO BIND ATP. THERE IS NO UNIPROT ID ASSOCIATED WITH THE SEQUENCE PRESENT IN THIS ENTRY AND THEREFORE, THE DBREF RECORDS INDICATE THAT THE SEQUENCE IS MAPPED TO ITSELF. ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 2011 ? ? O A HOH 2012 ? ? 1.52 2 1 O A HOH 2011 ? ? O A HOH 2013 ? ? 1.91 3 1 O A HOH 2038 ? ? O A HOH 2039 ? ? 2.11 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 2007 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 2007 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 5_675 _pdbx_validate_symm_contact.dist 1.99 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 8 ? ? -26.38 -26.91 2 1 LYS A 25 ? ? -90.12 -60.03 3 1 LYS A 27 ? ? 59.45 10.90 4 1 VAL A 28 ? ? -121.87 -52.70 5 1 ASN A 37 ? ? 56.76 -110.37 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 2007 ? 8.52 . 2 1 O ? A HOH 2008 ? 8.92 . 3 1 O ? A HOH 2009 ? 9.06 . 4 1 O ? A HOH 2010 ? 8.08 . 5 1 O ? A HOH 2017 ? 6.22 . 6 1 O ? A HOH 2018 ? 7.42 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A ALA -1 ? A ALA 2 3 1 Y 1 A MET 1 ? A MET 3 4 1 Y 1 A ASP 2 ? A ASP 4 5 1 Y 1 A TYR 3 ? A TYR 5 6 1 Y 1 A LYS 4 ? A LYS 6 7 1 Y 1 A ASP 5 ? A ASP 7 8 1 Y 1 A ASP 6 ? A ASP 8 9 1 Y 1 A LYS 74 ? A LYS 76 10 1 Y 1 A GLU 75 ? A GLU 77 11 1 Y 1 A ILE 76 ? A ILE 78 12 1 Y 1 A SER 77 ? A SER 79 13 1 Y 1 A ASN 78 ? A ASN 80 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "ADENOSINE-5'-DIPHOSPHATE" ADP 3 'ZINC ION' ZN 4 water HOH #