data_1UYA # _entry.id 1UYA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1UYA pdb_00001uya 10.2210/pdb1uya/pdb WWPDB D_1000176995 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-03-18 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' pdbx_entry_details 8 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1UYA _pdbx_database_status.recvd_initial_deposition_date 1997-09-11 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Marx, U.C.' 1 'Adermann, K.' 2 'Forssmann, W.-G.' 3 'Roesch, P.' 4 # _citation.id primary _citation.title 'One peptide, two topologies: structure and interconversion dynamics of human uroguanylin isomers.' _citation.journal_abbrev J.Pept.Res. _citation.journal_volume 52 _citation.page_first 229 _citation.page_last 240 _citation.year 1998 _citation.journal_id_ASTM JPERFA _citation.country DK _citation.journal_id_ISSN 1397-002X _citation.journal_id_CSD 2150 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9774236 _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Marx, U.C.' 1 ? primary 'Klodt, J.' 2 ? primary 'Meyer, M.' 3 ? primary 'Gerlach, H.' 4 ? primary 'Rosch, P.' 5 ? primary 'Forssmann, W.G.' 6 ? primary 'Adermann, K.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'UROGUANYLIN-16, ISOMER A' _entity.formula_weight 1671.892 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code NDDCELCVNVACTGCL _entity_poly.pdbx_seq_one_letter_code_can NDDCELCVNVACTGCL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 ASP n 1 3 ASP n 1 4 CYS n 1 5 GLU n 1 6 LEU n 1 7 CYS n 1 8 VAL n 1 9 ASN n 1 10 VAL n 1 11 ALA n 1 12 CYS n 1 13 THR n 1 14 GLY n 1 15 CYS n 1 16 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 1 1 ASN ASN A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 LEU 16 16 16 LEU LEU A . n # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # _cell.entry_id 1UYA _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1UYA _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1UYA _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1UYA _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1UYA _struct.title 'THE SOLUTION STRUCTURE OF THE A-FORM OF UROGUANYLIN-16 NMR, 10 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1UYA _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text 'HORMONE, GUANYLYL CYCLASE C ACTIVATION, ISOMER A, PEPTIDE HORMONE, SOLUTION STRUCTURE, TOPOLOGICAL STEREOISOMER, UROGUANYLIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GUC2B_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q16661 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVC ASQEASSIFKTLRTIANDDCELCVNVACTGCL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1UYA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 16 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q16661 _struct_ref_seq.db_align_beg 97 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 112 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 16 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 12 SG ? ? A CYS 4 A CYS 12 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf2 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 15 SG ? ? A CYS 7 A CYS 15 1_555 ? ? ? ? ? ? ? 2.020 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 4 ? CYS A 12 ? CYS A 4 ? 1_555 CYS A 12 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 7 ? CYS A 15 ? CYS A 7 ? 1_555 CYS A 15 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 1UYA _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A ASN 9 ? ? H A ALA 11 ? ? 1.56 2 6 O A ASN 9 ? ? H A ALA 11 ? ? 1.58 3 8 O A ASN 9 ? ? H A ALA 11 ? ? 1.56 4 10 O A ASN 9 ? ? H A ALA 11 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -150.10 58.19 2 1 ASN A 9 ? ? -152.56 -150.87 3 1 THR A 13 ? ? -98.84 40.57 4 2 ASP A 3 ? ? -63.82 84.07 5 2 CYS A 4 ? ? -48.88 175.58 6 2 GLU A 5 ? ? -90.83 -81.53 7 2 LEU A 6 ? ? -113.35 66.14 8 2 VAL A 10 ? ? -65.61 60.39 9 2 ALA A 11 ? ? -157.41 34.46 10 2 THR A 13 ? ? -84.38 47.55 11 3 ASP A 3 ? ? -174.96 -157.50 12 3 CYS A 4 ? ? -39.68 127.44 13 3 ASN A 9 ? ? -151.41 -140.83 14 3 VAL A 10 ? ? -95.15 37.08 15 4 ASP A 2 ? ? -159.62 60.12 16 4 LEU A 6 ? ? -98.91 31.66 17 4 ASN A 9 ? ? 178.20 138.95 18 4 ALA A 11 ? ? -145.97 55.56 19 4 THR A 13 ? ? -98.71 43.62 20 4 CYS A 15 ? ? -177.58 72.30 21 5 ASN A 9 ? ? -146.82 -142.09 22 5 VAL A 10 ? ? -100.08 47.36 23 5 THR A 13 ? ? -95.70 33.43 24 6 CYS A 4 ? ? -39.04 128.24 25 6 GLU A 5 ? ? -99.97 -66.33 26 6 LEU A 6 ? ? -100.72 65.76 27 6 ASN A 9 ? ? 179.54 128.47 28 6 VAL A 10 ? ? -67.16 59.47 29 6 ALA A 11 ? ? -148.13 37.65 30 6 THR A 13 ? ? -94.09 44.89 31 6 CYS A 15 ? ? -140.67 53.74 32 7 ASP A 3 ? ? -164.67 75.15 33 7 ASN A 9 ? ? -123.23 -149.99 34 7 THR A 13 ? ? -93.51 31.95 35 7 CYS A 15 ? ? -149.35 38.24 36 8 ASP A 2 ? ? 179.23 71.95 37 8 CYS A 4 ? ? -46.87 164.26 38 8 VAL A 8 ? ? -88.10 30.31 39 8 ASN A 9 ? ? -177.10 128.74 40 8 VAL A 10 ? ? -66.26 59.80 41 8 ALA A 11 ? ? -154.30 30.45 42 8 CYS A 15 ? ? -142.28 47.59 43 9 ASN A 9 ? ? -119.68 -147.47 44 9 ALA A 11 ? ? -94.56 32.50 45 9 THR A 13 ? ? -95.06 32.91 46 10 ASP A 2 ? ? -144.12 44.62 47 10 ASP A 3 ? ? 44.41 74.70 48 10 ASN A 9 ? ? 176.94 125.65 49 10 VAL A 10 ? ? -67.51 60.18 50 10 CYS A 15 ? ? -162.44 63.85 # _pdbx_nmr_ensemble.entry_id 1UYA _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'ENERGY, AGREEMENT WITH EXPERIMENTAL DATA' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 284 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 3.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_refine.entry_id 1UYA _pdbx_nmr_refine.method 'SIMULATED ANNEALING, RESTRAINED MOLECULAR DYNAMICS' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' NDEE ? ? 1 'structure solution' X-PLOR ? ? 2 refinement X-PLOR ? ? 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLU N N N N 61 GLU CA C N S 62 GLU C C N N 63 GLU O O N N 64 GLU CB C N N 65 GLU CG C N N 66 GLU CD C N N 67 GLU OE1 O N N 68 GLU OE2 O N N 69 GLU OXT O N N 70 GLU H H N N 71 GLU H2 H N N 72 GLU HA H N N 73 GLU HB2 H N N 74 GLU HB3 H N N 75 GLU HG2 H N N 76 GLU HG3 H N N 77 GLU HE2 H N N 78 GLU HXT H N N 79 GLY N N N N 80 GLY CA C N N 81 GLY C C N N 82 GLY O O N N 83 GLY OXT O N N 84 GLY H H N N 85 GLY H2 H N N 86 GLY HA2 H N N 87 GLY HA3 H N N 88 GLY HXT H N N 89 LEU N N N N 90 LEU CA C N S 91 LEU C C N N 92 LEU O O N N 93 LEU CB C N N 94 LEU CG C N N 95 LEU CD1 C N N 96 LEU CD2 C N N 97 LEU OXT O N N 98 LEU H H N N 99 LEU H2 H N N 100 LEU HA H N N 101 LEU HB2 H N N 102 LEU HB3 H N N 103 LEU HG H N N 104 LEU HD11 H N N 105 LEU HD12 H N N 106 LEU HD13 H N N 107 LEU HD21 H N N 108 LEU HD22 H N N 109 LEU HD23 H N N 110 LEU HXT H N N 111 THR N N N N 112 THR CA C N S 113 THR C C N N 114 THR O O N N 115 THR CB C N R 116 THR OG1 O N N 117 THR CG2 C N N 118 THR OXT O N N 119 THR H H N N 120 THR H2 H N N 121 THR HA H N N 122 THR HB H N N 123 THR HG1 H N N 124 THR HG21 H N N 125 THR HG22 H N N 126 THR HG23 H N N 127 THR HXT H N N 128 VAL N N N N 129 VAL CA C N S 130 VAL C C N N 131 VAL O O N N 132 VAL CB C N N 133 VAL CG1 C N N 134 VAL CG2 C N N 135 VAL OXT O N N 136 VAL H H N N 137 VAL H2 H N N 138 VAL HA H N N 139 VAL HB H N N 140 VAL HG11 H N N 141 VAL HG12 H N N 142 VAL HG13 H N N 143 VAL HG21 H N N 144 VAL HG22 H N N 145 VAL HG23 H N N 146 VAL HXT H N N 147 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLU N CA sing N N 57 GLU N H sing N N 58 GLU N H2 sing N N 59 GLU CA C sing N N 60 GLU CA CB sing N N 61 GLU CA HA sing N N 62 GLU C O doub N N 63 GLU C OXT sing N N 64 GLU CB CG sing N N 65 GLU CB HB2 sing N N 66 GLU CB HB3 sing N N 67 GLU CG CD sing N N 68 GLU CG HG2 sing N N 69 GLU CG HG3 sing N N 70 GLU CD OE1 doub N N 71 GLU CD OE2 sing N N 72 GLU OE2 HE2 sing N N 73 GLU OXT HXT sing N N 74 GLY N CA sing N N 75 GLY N H sing N N 76 GLY N H2 sing N N 77 GLY CA C sing N N 78 GLY CA HA2 sing N N 79 GLY CA HA3 sing N N 80 GLY C O doub N N 81 GLY C OXT sing N N 82 GLY OXT HXT sing N N 83 LEU N CA sing N N 84 LEU N H sing N N 85 LEU N H2 sing N N 86 LEU CA C sing N N 87 LEU CA CB sing N N 88 LEU CA HA sing N N 89 LEU C O doub N N 90 LEU C OXT sing N N 91 LEU CB CG sing N N 92 LEU CB HB2 sing N N 93 LEU CB HB3 sing N N 94 LEU CG CD1 sing N N 95 LEU CG CD2 sing N N 96 LEU CG HG sing N N 97 LEU CD1 HD11 sing N N 98 LEU CD1 HD12 sing N N 99 LEU CD1 HD13 sing N N 100 LEU CD2 HD21 sing N N 101 LEU CD2 HD22 sing N N 102 LEU CD2 HD23 sing N N 103 LEU OXT HXT sing N N 104 THR N CA sing N N 105 THR N H sing N N 106 THR N H2 sing N N 107 THR CA C sing N N 108 THR CA CB sing N N 109 THR CA HA sing N N 110 THR C O doub N N 111 THR C OXT sing N N 112 THR CB OG1 sing N N 113 THR CB CG2 sing N N 114 THR CB HB sing N N 115 THR OG1 HG1 sing N N 116 THR CG2 HG21 sing N N 117 THR CG2 HG22 sing N N 118 THR CG2 HG23 sing N N 119 THR OXT HXT sing N N 120 VAL N CA sing N N 121 VAL N H sing N N 122 VAL N H2 sing N N 123 VAL CA C sing N N 124 VAL CA CB sing N N 125 VAL CA HA sing N N 126 VAL C O doub N N 127 VAL C OXT sing N N 128 VAL CB CG1 sing N N 129 VAL CB CG2 sing N N 130 VAL CB HB sing N N 131 VAL CG1 HG11 sing N N 132 VAL CG1 HG12 sing N N 133 VAL CG1 HG13 sing N N 134 VAL CG2 HG21 sing N N 135 VAL CG2 HG22 sing N N 136 VAL CG2 HG23 sing N N 137 VAL OXT HXT sing N N 138 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AMX600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1UYA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_