data_1V87
# 
_entry.id   1V87 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.383 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1V87         pdb_00001v87 10.2210/pdb1v87/pdb 
RCSB  RCSB006328   ?            ?                   
WWPDB D_1000006328 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-06-29 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-03-02 
5 'Structure model' 1 4 2023-12-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' database_2            
2  4 'Structure model' pdbx_nmr_software     
3  4 'Structure model' pdbx_nmr_spectrometer 
4  4 'Structure model' pdbx_struct_assembly  
5  4 'Structure model' pdbx_struct_oper_list 
6  4 'Structure model' struct_conn           
7  4 'Structure model' struct_ref_seq_dif    
8  4 'Structure model' struct_site           
9  5 'Structure model' chem_comp_atom        
10 5 'Structure model' chem_comp_bond        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                
2  4 'Structure model' '_database_2.pdbx_database_accession' 
3  4 'Structure model' '_pdbx_nmr_software.name'             
4  4 'Structure model' '_pdbx_nmr_spectrometer.model'        
5  4 'Structure model' '_struct_conn.pdbx_dist_value'        
6  4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'     
7  4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
8  4 'Structure model' '_struct_conn.ptnr1_label_asym_id'    
9  4 'Structure model' '_struct_conn.ptnr1_label_atom_id'    
10 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'    
11 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
12 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
13 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
14 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'    
15 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'    
16 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
17 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'     
18 4 'Structure model' '_struct_ref_seq_dif.details'         
19 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
20 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
21 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1V87 
_pdbx_database_status.recvd_initial_deposition_date   2003-12-29 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          mmt007011434.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Miyamoto, K.'                                           1 
'Muto, Y.'                                               2 
'Tochio, N.'                                             3 
'Koshiba, S.'                                            4 
'Inoue, M.'                                              5 
'Kigawa, T.'                                             6 
'Yokoyama, S.'                                           7 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 
# 
_citation.id                        primary 
_citation.title                     'Solution Structure of the Ring-H2 Finger Domain of Mouse Deltex Protein 2' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Miyamoto, K.' 1 ? 
primary 'Muto, Y.'     2 ? 
primary 'Tochio, N.'   3 ? 
primary 'Koshiba, S.'  4 ? 
primary 'Inoue, M.'    5 ? 
primary 'Kigawa, T.'   6 ? 
primary 'Yokoyama, S.' 7 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Deltex protein 2' 12230.006 1 ? ? 'Ring-H2 Finger Domain' ? 
2 non-polymer syn 'ZINC ION'         65.409    2 ? ? ?                       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Deltex-2, Deltex2, mDTX2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGEPEQVIRKYTEELKVAPEEDCIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKD
GSLQCPSCKTIYGEKTGTQPWGKMEVFRSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGEPEQVIRKYTEELKVAPEEDCIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKD
GSLQCPSCKTIYGEKTGTQPWGKMEVFRSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         mmt007011434.1 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'ZINC ION' 
_pdbx_entity_nonpoly.comp_id     ZN 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   GLU n 
1 9   PRO n 
1 10  GLU n 
1 11  GLN n 
1 12  VAL n 
1 13  ILE n 
1 14  ARG n 
1 15  LYS n 
1 16  TYR n 
1 17  THR n 
1 18  GLU n 
1 19  GLU n 
1 20  LEU n 
1 21  LYS n 
1 22  VAL n 
1 23  ALA n 
1 24  PRO n 
1 25  GLU n 
1 26  GLU n 
1 27  ASP n 
1 28  CYS n 
1 29  ILE n 
1 30  ILE n 
1 31  CYS n 
1 32  MET n 
1 33  GLU n 
1 34  LYS n 
1 35  LEU n 
1 36  ALA n 
1 37  VAL n 
1 38  ALA n 
1 39  SER n 
1 40  GLY n 
1 41  TYR n 
1 42  SER n 
1 43  ASP n 
1 44  MET n 
1 45  THR n 
1 46  ASP n 
1 47  SER n 
1 48  LYS n 
1 49  ALA n 
1 50  LEU n 
1 51  GLY n 
1 52  PRO n 
1 53  MET n 
1 54  VAL n 
1 55  VAL n 
1 56  GLY n 
1 57  ARG n 
1 58  LEU n 
1 59  THR n 
1 60  LYS n 
1 61  CYS n 
1 62  SER n 
1 63  HIS n 
1 64  ALA n 
1 65  PHE n 
1 66  HIS n 
1 67  LEU n 
1 68  LEU n 
1 69  CYS n 
1 70  LEU n 
1 71  LEU n 
1 72  ALA n 
1 73  MET n 
1 74  TYR n 
1 75  CYS n 
1 76  ASN n 
1 77  GLY n 
1 78  ASN n 
1 79  LYS n 
1 80  ASP n 
1 81  GLY n 
1 82  SER n 
1 83  LEU n 
1 84  GLN n 
1 85  CYS n 
1 86  PRO n 
1 87  SER n 
1 88  CYS n 
1 89  LYS n 
1 90  THR n 
1 91  ILE n 
1 92  TYR n 
1 93  GLY n 
1 94  GLU n 
1 95  LYS n 
1 96  THR n 
1 97  GLY n 
1 98  THR n 
1 99  GLN n 
1 100 PRO n 
1 101 TRP n 
1 102 GLY n 
1 103 LYS n 
1 104 MET n 
1 105 GLU n 
1 106 VAL n 
1 107 PHE n 
1 108 ARG n 
1 109 SER n 
1 110 GLY n 
1 111 PRO n 
1 112 SER n 
1 113 SER n 
1 114 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 'RIKEN cDNA 2610524D08' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P030421-37 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   1   GLY GLY A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   SER 6   6   6   SER SER A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   GLU 8   8   8   GLU GLU A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  GLU 10  10  10  GLU GLU A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ILE 13  13  13  ILE ILE A . n 
A 1 14  ARG 14  14  14  ARG ARG A . n 
A 1 15  LYS 15  15  15  LYS LYS A . n 
A 1 16  TYR 16  16  16  TYR TYR A . n 
A 1 17  THR 17  17  17  THR THR A . n 
A 1 18  GLU 18  18  18  GLU GLU A . n 
A 1 19  GLU 19  19  19  GLU GLU A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  ALA 23  23  23  ALA ALA A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  ASP 27  27  27  ASP ASP A . n 
A 1 28  CYS 28  28  28  CYS CYS A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  ILE 30  30  30  ILE ILE A . n 
A 1 31  CYS 31  31  31  CYS CYS A . n 
A 1 32  MET 32  32  32  MET MET A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  LYS 34  34  34  LYS LYS A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  VAL 37  37  37  VAL VAL A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  SER 39  39  39  SER SER A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  TYR 41  41  41  TYR TYR A . n 
A 1 42  SER 42  42  42  SER SER A . n 
A 1 43  ASP 43  43  43  ASP ASP A . n 
A 1 44  MET 44  44  44  MET MET A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  ASP 46  46  46  ASP ASP A . n 
A 1 47  SER 47  47  47  SER SER A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  MET 53  53  53  MET MET A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  ARG 57  57  57  ARG ARG A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  CYS 61  61  61  CYS CYS A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  HIS 63  63  63  HIS HIS A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  HIS 66  66  66  HIS HIS A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  MET 73  73  73  MET MET A . n 
A 1 74  TYR 74  74  74  TYR TYR A . n 
A 1 75  CYS 75  75  75  CYS CYS A . n 
A 1 76  ASN 76  76  76  ASN ASN A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  ASN 78  78  78  ASN ASN A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  ASP 80  80  80  ASP ASP A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  GLN 84  84  84  GLN GLN A . n 
A 1 85  CYS 85  85  85  CYS CYS A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  SER 87  87  87  SER SER A . n 
A 1 88  CYS 88  88  88  CYS CYS A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 TRP 101 101 101 TRP TRP A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 MET 104 104 104 MET MET A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 PHE 107 107 107 PHE PHE A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 SER 112 112 112 SER SER A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN 1 201 201 ZN ZN A . 
C 2 ZN 1 401 401 ZN ZN A . 
# 
_exptl.entry_id          1V87 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_database_PDB_matrix.entry_id          1V87 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1V87 
_struct.title                     'Solution Structure of the Ring-H2 Finger Domain of Mouse Deltex Protein 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1V87 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            
;Ring-H2 Domain, Zinc-Binding Domain, Notch signaling, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DTX2_MOUSE 
_struct_ref.pdbx_db_accession          Q8R3P2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EPEQVIRKYTEELKVAPEEDCIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPS
CKTIYGEKTGTQPWGKMEVFR
;
_struct_ref.pdbx_align_begin           389 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1V87 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 108 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8R3P2 
_struct_ref_seq.db_align_beg                  389 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  489 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       108 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1V87 GLY A 1   ? UNP Q8R3P2 ? ? 'cloning artifact' 1   1  
1 1V87 SER A 2   ? UNP Q8R3P2 ? ? 'cloning artifact' 2   2  
1 1V87 SER A 3   ? UNP Q8R3P2 ? ? 'cloning artifact' 3   3  
1 1V87 GLY A 4   ? UNP Q8R3P2 ? ? 'cloning artifact' 4   4  
1 1V87 SER A 5   ? UNP Q8R3P2 ? ? 'cloning artifact' 5   5  
1 1V87 SER A 6   ? UNP Q8R3P2 ? ? 'cloning artifact' 6   6  
1 1V87 GLY A 7   ? UNP Q8R3P2 ? ? 'cloning artifact' 7   7  
1 1V87 SER A 109 ? UNP Q8R3P2 ? ? 'cloning artifact' 109 8  
1 1V87 GLY A 110 ? UNP Q8R3P2 ? ? 'cloning artifact' 110 9  
1 1V87 PRO A 111 ? UNP Q8R3P2 ? ? 'cloning artifact' 111 10 
1 1V87 SER A 112 ? UNP Q8R3P2 ? ? 'cloning artifact' 112 11 
1 1V87 SER A 113 ? UNP Q8R3P2 ? ? 'cloning artifact' 113 12 
1 1V87 GLY A 114 ? UNP Q8R3P2 ? ? 'cloning artifact' 114 13 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 9  ? TYR A 16 ? PRO A 9  TYR A 16 1 ? 8  
HELX_P HELX_P2 2 LEU A 67 ? ASN A 76 ? LEU A 67 ASN A 76 1 ? 10 
HELX_P HELX_P3 3 TYR A 41 ? THR A 45 ? TYR A 41 THR A 45 1 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A CYS 28 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 28 A ZN 201 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc2 metalc ? ? A CYS 31 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 31 A ZN 201 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc3 metalc ? ? A CYS 61 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 61 A ZN 401 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc4 metalc ? ? A HIS 63 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 63 A ZN 401 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc5 metalc ? ? A HIS 66 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 66 A ZN 201 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc6 metalc ? ? A CYS 69 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 69 A ZN 201 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc7 metalc ? ? A CYS 85 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 85 A ZN 401 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc8 metalc ? ? A CYS 88 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 88 A ZN 401 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG  ? A CYS 31 ? A CYS 31 ? 1_555 93.5  ? 
2  SG  ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 66 ? A HIS 66 ? 1_555 91.2  ? 
3  SG  ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 66 ? A HIS 66 ? 1_555 111.0 ? 
4  SG  ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG  ? A CYS 69 ? A CYS 69 ? 1_555 119.3 ? 
5  SG  ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG  ? A CYS 69 ? A CYS 69 ? 1_555 117.3 ? 
6  ND1 ? A HIS 66 ? A HIS 66 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG  ? A CYS 69 ? A CYS 69 ? 1_555 119.2 ? 
7  SG  ? A CYS 61 ? A CYS 61 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 63 ? A HIS 63 ? 1_555 96.0  ? 
8  SG  ? A CYS 61 ? A CYS 61 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 85 ? A CYS 85 ? 1_555 115.1 ? 
9  ND1 ? A HIS 63 ? A HIS 63 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 85 ? A CYS 85 ? 1_555 118.9 ? 
10 SG  ? A CYS 61 ? A CYS 61 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 88 ? A CYS 88 ? 1_555 87.0  ? 
11 ND1 ? A HIS 63 ? A HIS 63 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 88 ? A CYS 88 ? 1_555 119.3 ? 
12 SG  ? A CYS 85 ? A CYS 85 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 88 ? A CYS 88 ? 1_555 113.8 ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 17 ? GLU A 19 ? THR A 17 GLU A 19 
A 2 GLY A 56 ? LEU A 58 ? GLY A 56 LEU A 58 
A 3 ALA A 64 ? PHE A 65 ? ALA A 64 PHE A 65 
B 1 ASP A 27 ? CYS A 28 ? ASP A 27 CYS A 28 
B 2 GLU A 33 ? LYS A 34 ? GLU A 33 LYS A 34 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 18 ? N GLU A 18 O ARG A 57 ? O ARG A 57 
A 2 3 N GLY A 56 ? N GLY A 56 O PHE A 65 ? O PHE A 65 
B 1 2 N CYS A 28 ? N CYS A 28 O GLU A 33 ? O GLU A 33 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' 
AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 28 ? CYS A 28 . ? 1_555 ? 
2 AC1 4 CYS A 31 ? CYS A 31 . ? 1_555 ? 
3 AC1 4 HIS A 66 ? HIS A 66 . ? 1_555 ? 
4 AC1 4 CYS A 69 ? CYS A 69 . ? 1_555 ? 
5 AC2 4 CYS A 61 ? CYS A 61 . ? 1_555 ? 
6 AC2 4 HIS A 63 ? HIS A 63 . ? 1_555 ? 
7 AC2 4 CYS A 85 ? CYS A 85 . ? 1_555 ? 
8 AC2 4 CYS A 88 ? CYS A 88 . ? 1_555 ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  PRO A 24  ? ? -69.80  -166.28 
2   1  GLU A 25  ? ? -98.39  33.35   
3   1  SER A 42  ? ? -36.40  -36.26  
4   1  LEU A 58  ? ? -58.32  175.88  
5   1  LYS A 60  ? ? -95.09  -73.63  
6   1  HIS A 66  ? ? -50.36  101.01  
7   1  LEU A 67  ? ? -36.18  -33.09  
8   1  ASN A 78  ? ? -69.55  80.41   
9   1  PRO A 86  ? ? -69.72  7.63    
10  1  SER A 87  ? ? -106.85 -69.30  
11  1  GLU A 94  ? ? -32.58  -76.01  
12  1  THR A 98  ? ? -41.39  163.36  
13  2  GLU A 8   ? ? -42.76  150.23  
14  2  GLU A 25  ? ? -92.25  32.49   
15  2  ALA A 38  ? ? -57.09  176.00  
16  2  SER A 42  ? ? -38.72  -27.63  
17  2  LYS A 60  ? ? -100.52 -71.35  
18  2  HIS A 66  ? ? -56.47  102.44  
19  2  LEU A 67  ? ? -37.26  -27.84  
20  2  PRO A 86  ? ? -69.78  2.37    
21  2  GLU A 94  ? ? -175.21 133.61  
22  2  THR A 98  ? ? -175.07 142.03  
23  2  LYS A 103 ? ? -89.87  41.73   
24  2  SER A 113 ? ? -172.62 118.28  
25  3  GLU A 19  ? ? -38.13  139.11  
26  3  LYS A 21  ? ? -39.23  -39.35  
27  3  PRO A 24  ? ? -69.77  -165.10 
28  3  ALA A 38  ? ? -58.39  170.56  
29  3  ASP A 46  ? ? -99.04  40.23   
30  3  LYS A 60  ? ? -124.11 -59.82  
31  3  HIS A 66  ? ? -49.35  103.63  
32  3  LEU A 67  ? ? -38.55  -27.17  
33  3  LYS A 79  ? ? -69.58  68.51   
34  3  PRO A 86  ? ? -69.72  3.92    
35  3  LYS A 89  ? ? 35.88   45.52   
36  3  LYS A 95  ? ? -124.40 -60.45  
37  3  LYS A 103 ? ? -168.55 118.18  
38  3  SER A 109 ? ? -107.75 42.06   
39  3  SER A 113 ? ? -122.21 -59.08  
40  4  LYS A 21  ? ? -37.30  -37.13  
41  4  ALA A 23  ? ? -37.14  130.54  
42  4  PRO A 24  ? ? -69.80  -179.07 
43  4  GLU A 25  ? ? -88.75  33.80   
44  4  ALA A 38  ? ? -62.70  -179.47 
45  4  ASP A 46  ? ? -95.32  33.28   
46  4  LEU A 58  ? ? -51.11  173.88  
47  4  LYS A 60  ? ? -90.24  -62.45  
48  4  HIS A 66  ? ? -51.06  104.44  
49  4  LEU A 67  ? ? -39.86  -26.39  
50  4  PRO A 86  ? ? -69.70  3.06    
51  4  PRO A 100 ? ? -69.72  2.81    
52  4  TRP A 101 ? ? -124.65 -63.08  
53  5  GLU A 8   ? ? -41.34  156.12  
54  5  VAL A 12  ? ? -36.76  -37.70  
55  5  LYS A 21  ? ? -39.24  -34.93  
56  5  PRO A 24  ? ? -69.75  -166.01 
57  5  LEU A 35  ? ? -36.97  -33.43  
58  5  MET A 44  ? ? -58.91  -70.14  
59  5  LEU A 58  ? ? -47.60  171.42  
60  5  HIS A 66  ? ? -53.92  101.65  
61  5  LEU A 67  ? ? -37.85  -28.89  
62  5  ASN A 78  ? ? -58.15  88.36   
63  5  LYS A 79  ? ? -43.49  -75.28  
64  5  ASP A 80  ? ? 39.64   41.90   
65  5  PRO A 86  ? ? -69.76  3.68    
66  5  LYS A 89  ? ? 39.15   46.22   
67  5  GLU A 94  ? ? -77.85  46.23   
68  5  LYS A 95  ? ? -133.76 -50.76  
69  5  ARG A 108 ? ? -57.63  176.61  
70  6  PRO A 24  ? ? -69.79  -172.54 
71  6  GLU A 25  ? ? -95.59  32.65   
72  6  LEU A 35  ? ? -38.18  -34.77  
73  6  SER A 42  ? ? -35.40  -30.89  
74  6  LYS A 60  ? ? -97.80  -73.61  
75  6  SER A 62  ? ? 73.48   44.62   
76  6  HIS A 66  ? ? -50.56  103.54  
77  6  LEU A 67  ? ? -38.48  -26.23  
78  6  ASN A 78  ? ? 73.39   44.73   
79  6  LYS A 79  ? ? -91.76  44.58   
80  6  PRO A 86  ? ? -69.80  3.90    
81  6  LYS A 89  ? ? 37.02   41.06   
82  6  THR A 96  ? ? -67.20  92.98   
83  6  PRO A 100 ? ? -69.78  -174.13 
84  6  MET A 104 ? ? -125.50 -70.46  
85  6  SER A 113 ? ? -37.54  112.91  
86  7  SER A 6   ? ? -55.79  100.49  
87  7  PRO A 24  ? ? -69.78  -174.65 
88  7  GLU A 25  ? ? -94.59  30.32   
89  7  ASP A 46  ? ? -96.49  36.60   
90  7  LEU A 58  ? ? -49.48  167.60  
91  7  LYS A 60  ? ? -95.91  -68.99  
92  7  HIS A 66  ? ? -54.98  104.45  
93  7  LEU A 67  ? ? -39.80  -30.14  
94  7  LYS A 79  ? ? -94.35  44.05   
95  7  PRO A 86  ? ? -69.70  2.19    
96  7  SER A 87  ? ? -102.78 -62.97  
97  7  LYS A 95  ? ? -168.38 111.93  
98  7  GLN A 99  ? ? -169.32 106.26  
99  7  PRO A 100 ? ? -69.82  -172.73 
100 8  VAL A 12  ? ? -36.16  -36.64  
101 8  LYS A 21  ? ? -39.34  -32.77  
102 8  PRO A 24  ? ? -69.79  -172.52 
103 8  GLU A 25  ? ? -95.04  31.57   
104 8  SER A 42  ? ? -36.26  -30.81  
105 8  LEU A 58  ? ? -43.80  168.39  
106 8  LYS A 60  ? ? -117.19 -71.97  
107 8  LEU A 67  ? ? -38.61  -26.00  
108 8  LYS A 79  ? ? -64.92  72.70   
109 8  SER A 82  ? ? -175.06 143.14  
110 8  PRO A 86  ? ? -69.79  3.49    
111 8  SER A 87  ? ? -119.19 -75.69  
112 8  GLU A 94  ? ? -119.72 71.88   
113 8  LYS A 95  ? ? -101.69 -62.71  
114 8  PRO A 100 ? ? -69.74  -177.15 
115 8  MET A 104 ? ? -82.47  47.93   
116 8  SER A 109 ? ? -131.95 -60.90  
117 9  GLU A 8   ? ? -46.75  150.15  
118 9  ALA A 23  ? ? -39.68  126.91  
119 9  PRO A 24  ? ? -69.78  -166.54 
120 9  GLU A 25  ? ? -92.93  30.70   
121 9  SER A 42  ? ? -36.48  -37.12  
122 9  ASP A 46  ? ? -83.49  40.85   
123 9  LYS A 60  ? ? -97.76  -67.81  
124 9  HIS A 66  ? ? -53.37  102.40  
125 9  LYS A 79  ? ? -68.90  70.15   
126 9  PRO A 86  ? ? -69.77  5.92    
127 9  LYS A 95  ? ? -131.63 -37.91  
128 9  TRP A 101 ? ? -48.63  160.93  
129 9  GLU A 105 ? ? 71.23   44.32   
130 10 PRO A 9   ? ? -69.82  3.17    
131 10 PRO A 24  ? ? -69.76  -177.72 
132 10 GLU A 25  ? ? -91.13  35.27   
133 10 LEU A 58  ? ? -49.24  165.94  
134 10 LYS A 60  ? ? -118.34 -71.74  
135 10 HIS A 66  ? ? -55.94  100.35  
136 10 LEU A 67  ? ? -37.87  -27.81  
137 10 ASN A 78  ? ? -40.99  92.37   
138 10 PRO A 86  ? ? -69.81  2.95    
139 10 LYS A 89  ? ? 38.56   52.91   
140 10 GLU A 94  ? ? -63.83  -174.48 
141 10 THR A 96  ? ? 39.66   37.76   
142 10 GLN A 99  ? ? -45.20  104.17  
143 10 TRP A 101 ? ? -37.41  110.69  
144 10 GLU A 105 ? ? -98.25  -61.47  
145 11 SER A 5   ? ? -39.66  121.88  
146 11 PRO A 24  ? ? -69.76  -169.00 
147 11 SER A 47  ? ? -46.50  174.29  
148 11 LEU A 58  ? ? -58.91  171.68  
149 11 LYS A 60  ? ? -95.13  -68.07  
150 11 HIS A 66  ? ? -51.29  103.85  
151 11 LEU A 67  ? ? -38.27  -26.78  
152 11 PRO A 86  ? ? -69.76  3.82    
153 11 SER A 87  ? ? -105.72 -67.99  
154 11 GLU A 94  ? ? -34.34  107.27  
155 11 THR A 96  ? ? -46.99  156.28  
156 11 GLN A 99  ? ? -40.60  108.36  
157 11 PHE A 107 ? ? -97.31  42.01   
158 11 SER A 112 ? ? 37.17   42.07   
159 12 LYS A 15  ? ? -39.46  -30.35  
160 12 GLU A 25  ? ? -90.38  30.51   
161 12 LYS A 60  ? ? -98.89  -65.55  
162 12 HIS A 66  ? ? -51.33  100.93  
163 12 LEU A 67  ? ? -36.62  -29.87  
164 12 LYS A 79  ? ? -78.09  44.85   
165 12 PRO A 86  ? ? -69.74  3.57    
166 12 LYS A 89  ? ? 39.53   46.78   
167 12 VAL A 106 ? ? -87.55  37.56   
168 12 PRO A 111 ? ? -69.79  91.30   
169 13 GLU A 25  ? ? -84.46  34.71   
170 13 LEU A 35  ? ? -38.72  -34.53  
171 13 LYS A 60  ? ? -122.64 -69.29  
172 13 HIS A 66  ? ? -53.35  102.17  
173 13 LEU A 67  ? ? -37.74  -28.24  
174 13 LYS A 79  ? ? -75.48  49.16   
175 13 ASP A 80  ? ? -92.76  40.78   
176 13 PRO A 86  ? ? -69.75  7.84    
177 13 MET A 104 ? ? -175.81 130.91  
178 14 GLU A 25  ? ? -86.77  30.57   
179 14 SER A 42  ? ? -35.79  -36.33  
180 14 LYS A 60  ? ? -120.01 -65.44  
181 14 HIS A 66  ? ? -46.61  102.93  
182 14 LEU A 67  ? ? -36.56  -32.47  
183 14 LYS A 79  ? ? -75.73  49.60   
184 14 PRO A 86  ? ? -69.82  4.69    
185 14 SER A 87  ? ? -106.45 -66.74  
186 14 LYS A 95  ? ? -175.18 131.44  
187 14 GLN A 99  ? ? -38.90  142.37  
188 14 PRO A 100 ? ? -69.80  86.15   
189 15 SER A 3   ? ? 39.16   51.48   
190 15 SER A 6   ? ? -170.18 148.93  
191 15 PRO A 24  ? ? -69.80  -165.25 
192 15 LEU A 58  ? ? -49.89  167.20  
193 15 LYS A 60  ? ? -95.97  -70.26  
194 15 HIS A 66  ? ? -53.97  106.15  
195 15 PRO A 86  ? ? -69.73  3.20    
196 15 THR A 98  ? ? 34.90   41.66   
197 15 GLN A 99  ? ? -33.80  143.45  
198 15 PRO A 100 ? ? -69.69  -179.99 
199 16 SER A 6   ? ? -55.14  96.76   
200 16 PRO A 24  ? ? -69.78  -164.34 
201 16 SER A 42  ? ? -36.19  -33.97  
202 16 LYS A 60  ? ? -90.03  -70.95  
203 16 HIS A 66  ? ? -55.26  103.72  
204 16 ASP A 80  ? ? -88.06  30.07   
205 16 LEU A 83  ? ? -172.48 118.42  
206 16 PRO A 86  ? ? -69.77  7.48    
207 16 SER A 87  ? ? -109.30 -71.01  
208 16 TRP A 101 ? ? -127.29 -73.66  
209 16 MET A 104 ? ? -58.60  104.99  
210 17 SER A 2   ? ? -58.81  176.56  
211 17 GLU A 25  ? ? -86.11  32.20   
212 17 SER A 47  ? ? -50.90  171.57  
213 17 LEU A 58  ? ? -43.39  166.13  
214 17 LYS A 60  ? ? -89.52  -70.25  
215 17 PHE A 65  ? ? -171.64 140.29  
216 17 HIS A 66  ? ? -57.24  103.85  
217 17 LYS A 79  ? ? -81.84  43.12   
218 17 ASP A 80  ? ? -100.63 43.56   
219 17 LEU A 83  ? ? -163.47 119.70  
220 17 PRO A 86  ? ? -69.77  11.07   
221 17 LYS A 95  ? ? -130.68 -42.15  
222 17 THR A 98  ? ? -96.48  -62.28  
223 17 TRP A 101 ? ? -51.32  103.70  
224 18 PRO A 24  ? ? -69.78  -176.71 
225 18 GLU A 25  ? ? -95.08  34.72   
226 18 SER A 42  ? ? -37.66  -28.07  
227 18 LEU A 58  ? ? -58.50  173.96  
228 18 HIS A 66  ? ? -50.91  105.99  
229 18 ASP A 80  ? ? -102.99 40.75   
230 18 SER A 82  ? ? -176.08 145.43  
231 18 PRO A 86  ? ? -69.77  7.70    
232 18 SER A 87  ? ? -109.06 -65.65  
233 18 GLN A 99  ? ? -164.25 118.44  
234 19 SER A 2   ? ? -69.73  94.89   
235 19 PRO A 24  ? ? -69.78  -170.88 
236 19 SER A 42  ? ? -36.57  -29.82  
237 19 SER A 47  ? ? -37.32  143.64  
238 19 HIS A 66  ? ? -52.79  105.98  
239 19 ASP A 80  ? ? -98.35  38.54   
240 19 PRO A 86  ? ? -69.77  2.03    
241 19 SER A 87  ? ? -118.97 -71.14  
242 19 LYS A 89  ? ? 34.44   39.72   
243 19 GLU A 94  ? ? -175.55 147.53  
244 19 LYS A 95  ? ? 33.61   30.45   
245 19 THR A 96  ? ? -69.39  85.87   
246 19 TRP A 101 ? ? -97.18  40.66   
247 19 LYS A 103 ? ? -34.44  126.04  
248 20 GLU A 25  ? ? -86.16  36.36   
249 20 ALA A 38  ? ? -47.14  174.09  
250 20 LYS A 60  ? ? -124.76 -50.48  
251 20 HIS A 66  ? ? -52.56  104.98  
252 20 LYS A 79  ? ? -69.62  69.13   
253 20 PRO A 86  ? ? -69.77  3.68    
254 20 SER A 87  ? ? -105.60 -74.72  
255 20 LYS A 95  ? ? 34.35   47.81   
256 20 TRP A 101 ? ? -36.32  116.80  
257 20 VAL A 106 ? ? -33.87  146.14  
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'RIKEN Structural Genomics/Proteomics Initiative' 
_pdbx_SG_project.initial_of_center     RSGI 
# 
_pdbx_nmr_ensemble.entry_id                                      1V87 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations, structures with the lowest energy, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1V87 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.05mM Ring-H2 Domain U-13C, 15N; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.1mM ZnCl; 90% H2O, 10%D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_refine.entry_id           1V87 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XwinNMR 2.6      collection           Bruker          1 
NMRPipe 20020425 processing           'Delaglio, F.'  2 
NMRView 5.0.4    'data analysis'      'Johnson, B.A.' 3 
KUJIRA  0.880    'data analysis'      'Kobayashi, N.' 4 
CYANA   2.0.17   'structure solution' 'Guentert, P.'  5 
CYANA   2.0.17   refinement           'Guentert, P.'  6 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CYS N    N  N N 74  
CYS CA   C  N R 75  
CYS C    C  N N 76  
CYS O    O  N N 77  
CYS CB   C  N N 78  
CYS SG   S  N N 79  
CYS OXT  O  N N 80  
CYS H    H  N N 81  
CYS H2   H  N N 82  
CYS HA   H  N N 83  
CYS HB2  H  N N 84  
CYS HB3  H  N N 85  
CYS HG   H  N N 86  
CYS HXT  H  N N 87  
GLN N    N  N N 88  
GLN CA   C  N S 89  
GLN C    C  N N 90  
GLN O    O  N N 91  
GLN CB   C  N N 92  
GLN CG   C  N N 93  
GLN CD   C  N N 94  
GLN OE1  O  N N 95  
GLN NE2  N  N N 96  
GLN OXT  O  N N 97  
GLN H    H  N N 98  
GLN H2   H  N N 99  
GLN HA   H  N N 100 
GLN HB2  H  N N 101 
GLN HB3  H  N N 102 
GLN HG2  H  N N 103 
GLN HG3  H  N N 104 
GLN HE21 H  N N 105 
GLN HE22 H  N N 106 
GLN HXT  H  N N 107 
GLU N    N  N N 108 
GLU CA   C  N S 109 
GLU C    C  N N 110 
GLU O    O  N N 111 
GLU CB   C  N N 112 
GLU CG   C  N N 113 
GLU CD   C  N N 114 
GLU OE1  O  N N 115 
GLU OE2  O  N N 116 
GLU OXT  O  N N 117 
GLU H    H  N N 118 
GLU H2   H  N N 119 
GLU HA   H  N N 120 
GLU HB2  H  N N 121 
GLU HB3  H  N N 122 
GLU HG2  H  N N 123 
GLU HG3  H  N N 124 
GLU HE2  H  N N 125 
GLU HXT  H  N N 126 
GLY N    N  N N 127 
GLY CA   C  N N 128 
GLY C    C  N N 129 
GLY O    O  N N 130 
GLY OXT  O  N N 131 
GLY H    H  N N 132 
GLY H2   H  N N 133 
GLY HA2  H  N N 134 
GLY HA3  H  N N 135 
GLY HXT  H  N N 136 
HIS N    N  N N 137 
HIS CA   C  N S 138 
HIS C    C  N N 139 
HIS O    O  N N 140 
HIS CB   C  N N 141 
HIS CG   C  Y N 142 
HIS ND1  N  Y N 143 
HIS CD2  C  Y N 144 
HIS CE1  C  Y N 145 
HIS NE2  N  Y N 146 
HIS OXT  O  N N 147 
HIS H    H  N N 148 
HIS H2   H  N N 149 
HIS HA   H  N N 150 
HIS HB2  H  N N 151 
HIS HB3  H  N N 152 
HIS HD1  H  N N 153 
HIS HD2  H  N N 154 
HIS HE1  H  N N 155 
HIS HE2  H  N N 156 
HIS HXT  H  N N 157 
ILE N    N  N N 158 
ILE CA   C  N S 159 
ILE C    C  N N 160 
ILE O    O  N N 161 
ILE CB   C  N S 162 
ILE CG1  C  N N 163 
ILE CG2  C  N N 164 
ILE CD1  C  N N 165 
ILE OXT  O  N N 166 
ILE H    H  N N 167 
ILE H2   H  N N 168 
ILE HA   H  N N 169 
ILE HB   H  N N 170 
ILE HG12 H  N N 171 
ILE HG13 H  N N 172 
ILE HG21 H  N N 173 
ILE HG22 H  N N 174 
ILE HG23 H  N N 175 
ILE HD11 H  N N 176 
ILE HD12 H  N N 177 
ILE HD13 H  N N 178 
ILE HXT  H  N N 179 
LEU N    N  N N 180 
LEU CA   C  N S 181 
LEU C    C  N N 182 
LEU O    O  N N 183 
LEU CB   C  N N 184 
LEU CG   C  N N 185 
LEU CD1  C  N N 186 
LEU CD2  C  N N 187 
LEU OXT  O  N N 188 
LEU H    H  N N 189 
LEU H2   H  N N 190 
LEU HA   H  N N 191 
LEU HB2  H  N N 192 
LEU HB3  H  N N 193 
LEU HG   H  N N 194 
LEU HD11 H  N N 195 
LEU HD12 H  N N 196 
LEU HD13 H  N N 197 
LEU HD21 H  N N 198 
LEU HD22 H  N N 199 
LEU HD23 H  N N 200 
LEU HXT  H  N N 201 
LYS N    N  N N 202 
LYS CA   C  N S 203 
LYS C    C  N N 204 
LYS O    O  N N 205 
LYS CB   C  N N 206 
LYS CG   C  N N 207 
LYS CD   C  N N 208 
LYS CE   C  N N 209 
LYS NZ   N  N N 210 
LYS OXT  O  N N 211 
LYS H    H  N N 212 
LYS H2   H  N N 213 
LYS HA   H  N N 214 
LYS HB2  H  N N 215 
LYS HB3  H  N N 216 
LYS HG2  H  N N 217 
LYS HG3  H  N N 218 
LYS HD2  H  N N 219 
LYS HD3  H  N N 220 
LYS HE2  H  N N 221 
LYS HE3  H  N N 222 
LYS HZ1  H  N N 223 
LYS HZ2  H  N N 224 
LYS HZ3  H  N N 225 
LYS HXT  H  N N 226 
MET N    N  N N 227 
MET CA   C  N S 228 
MET C    C  N N 229 
MET O    O  N N 230 
MET CB   C  N N 231 
MET CG   C  N N 232 
MET SD   S  N N 233 
MET CE   C  N N 234 
MET OXT  O  N N 235 
MET H    H  N N 236 
MET H2   H  N N 237 
MET HA   H  N N 238 
MET HB2  H  N N 239 
MET HB3  H  N N 240 
MET HG2  H  N N 241 
MET HG3  H  N N 242 
MET HE1  H  N N 243 
MET HE2  H  N N 244 
MET HE3  H  N N 245 
MET HXT  H  N N 246 
PHE N    N  N N 247 
PHE CA   C  N S 248 
PHE C    C  N N 249 
PHE O    O  N N 250 
PHE CB   C  N N 251 
PHE CG   C  Y N 252 
PHE CD1  C  Y N 253 
PHE CD2  C  Y N 254 
PHE CE1  C  Y N 255 
PHE CE2  C  Y N 256 
PHE CZ   C  Y N 257 
PHE OXT  O  N N 258 
PHE H    H  N N 259 
PHE H2   H  N N 260 
PHE HA   H  N N 261 
PHE HB2  H  N N 262 
PHE HB3  H  N N 263 
PHE HD1  H  N N 264 
PHE HD2  H  N N 265 
PHE HE1  H  N N 266 
PHE HE2  H  N N 267 
PHE HZ   H  N N 268 
PHE HXT  H  N N 269 
PRO N    N  N N 270 
PRO CA   C  N S 271 
PRO C    C  N N 272 
PRO O    O  N N 273 
PRO CB   C  N N 274 
PRO CG   C  N N 275 
PRO CD   C  N N 276 
PRO OXT  O  N N 277 
PRO H    H  N N 278 
PRO HA   H  N N 279 
PRO HB2  H  N N 280 
PRO HB3  H  N N 281 
PRO HG2  H  N N 282 
PRO HG3  H  N N 283 
PRO HD2  H  N N 284 
PRO HD3  H  N N 285 
PRO HXT  H  N N 286 
SER N    N  N N 287 
SER CA   C  N S 288 
SER C    C  N N 289 
SER O    O  N N 290 
SER CB   C  N N 291 
SER OG   O  N N 292 
SER OXT  O  N N 293 
SER H    H  N N 294 
SER H2   H  N N 295 
SER HA   H  N N 296 
SER HB2  H  N N 297 
SER HB3  H  N N 298 
SER HG   H  N N 299 
SER HXT  H  N N 300 
THR N    N  N N 301 
THR CA   C  N S 302 
THR C    C  N N 303 
THR O    O  N N 304 
THR CB   C  N R 305 
THR OG1  O  N N 306 
THR CG2  C  N N 307 
THR OXT  O  N N 308 
THR H    H  N N 309 
THR H2   H  N N 310 
THR HA   H  N N 311 
THR HB   H  N N 312 
THR HG1  H  N N 313 
THR HG21 H  N N 314 
THR HG22 H  N N 315 
THR HG23 H  N N 316 
THR HXT  H  N N 317 
TRP N    N  N N 318 
TRP CA   C  N S 319 
TRP C    C  N N 320 
TRP O    O  N N 321 
TRP CB   C  N N 322 
TRP CG   C  Y N 323 
TRP CD1  C  Y N 324 
TRP CD2  C  Y N 325 
TRP NE1  N  Y N 326 
TRP CE2  C  Y N 327 
TRP CE3  C  Y N 328 
TRP CZ2  C  Y N 329 
TRP CZ3  C  Y N 330 
TRP CH2  C  Y N 331 
TRP OXT  O  N N 332 
TRP H    H  N N 333 
TRP H2   H  N N 334 
TRP HA   H  N N 335 
TRP HB2  H  N N 336 
TRP HB3  H  N N 337 
TRP HD1  H  N N 338 
TRP HE1  H  N N 339 
TRP HE3  H  N N 340 
TRP HZ2  H  N N 341 
TRP HZ3  H  N N 342 
TRP HH2  H  N N 343 
TRP HXT  H  N N 344 
TYR N    N  N N 345 
TYR CA   C  N S 346 
TYR C    C  N N 347 
TYR O    O  N N 348 
TYR CB   C  N N 349 
TYR CG   C  Y N 350 
TYR CD1  C  Y N 351 
TYR CD2  C  Y N 352 
TYR CE1  C  Y N 353 
TYR CE2  C  Y N 354 
TYR CZ   C  Y N 355 
TYR OH   O  N N 356 
TYR OXT  O  N N 357 
TYR H    H  N N 358 
TYR H2   H  N N 359 
TYR HA   H  N N 360 
TYR HB2  H  N N 361 
TYR HB3  H  N N 362 
TYR HD1  H  N N 363 
TYR HD2  H  N N 364 
TYR HE1  H  N N 365 
TYR HE2  H  N N 366 
TYR HH   H  N N 367 
TYR HXT  H  N N 368 
VAL N    N  N N 369 
VAL CA   C  N S 370 
VAL C    C  N N 371 
VAL O    O  N N 372 
VAL CB   C  N N 373 
VAL CG1  C  N N 374 
VAL CG2  C  N N 375 
VAL OXT  O  N N 376 
VAL H    H  N N 377 
VAL H2   H  N N 378 
VAL HA   H  N N 379 
VAL HB   H  N N 380 
VAL HG11 H  N N 381 
VAL HG12 H  N N 382 
VAL HG13 H  N N 383 
VAL HG21 H  N N 384 
VAL HG22 H  N N 385 
VAL HG23 H  N N 386 
VAL HXT  H  N N 387 
ZN  ZN   ZN N N 388 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MET N   CA   sing N N 216 
MET N   H    sing N N 217 
MET N   H2   sing N N 218 
MET CA  C    sing N N 219 
MET CA  CB   sing N N 220 
MET CA  HA   sing N N 221 
MET C   O    doub N N 222 
MET C   OXT  sing N N 223 
MET CB  CG   sing N N 224 
MET CB  HB2  sing N N 225 
MET CB  HB3  sing N N 226 
MET CG  SD   sing N N 227 
MET CG  HG2  sing N N 228 
MET CG  HG3  sing N N 229 
MET SD  CE   sing N N 230 
MET CE  HE1  sing N N 231 
MET CE  HE2  sing N N 232 
MET CE  HE3  sing N N 233 
MET OXT HXT  sing N N 234 
PHE N   CA   sing N N 235 
PHE N   H    sing N N 236 
PHE N   H2   sing N N 237 
PHE CA  C    sing N N 238 
PHE CA  CB   sing N N 239 
PHE CA  HA   sing N N 240 
PHE C   O    doub N N 241 
PHE C   OXT  sing N N 242 
PHE CB  CG   sing N N 243 
PHE CB  HB2  sing N N 244 
PHE CB  HB3  sing N N 245 
PHE CG  CD1  doub Y N 246 
PHE CG  CD2  sing Y N 247 
PHE CD1 CE1  sing Y N 248 
PHE CD1 HD1  sing N N 249 
PHE CD2 CE2  doub Y N 250 
PHE CD2 HD2  sing N N 251 
PHE CE1 CZ   doub Y N 252 
PHE CE1 HE1  sing N N 253 
PHE CE2 CZ   sing Y N 254 
PHE CE2 HE2  sing N N 255 
PHE CZ  HZ   sing N N 256 
PHE OXT HXT  sing N N 257 
PRO N   CA   sing N N 258 
PRO N   CD   sing N N 259 
PRO N   H    sing N N 260 
PRO CA  C    sing N N 261 
PRO CA  CB   sing N N 262 
PRO CA  HA   sing N N 263 
PRO C   O    doub N N 264 
PRO C   OXT  sing N N 265 
PRO CB  CG   sing N N 266 
PRO CB  HB2  sing N N 267 
PRO CB  HB3  sing N N 268 
PRO CG  CD   sing N N 269 
PRO CG  HG2  sing N N 270 
PRO CG  HG3  sing N N 271 
PRO CD  HD2  sing N N 272 
PRO CD  HD3  sing N N 273 
PRO OXT HXT  sing N N 274 
SER N   CA   sing N N 275 
SER N   H    sing N N 276 
SER N   H2   sing N N 277 
SER CA  C    sing N N 278 
SER CA  CB   sing N N 279 
SER CA  HA   sing N N 280 
SER C   O    doub N N 281 
SER C   OXT  sing N N 282 
SER CB  OG   sing N N 283 
SER CB  HB2  sing N N 284 
SER CB  HB3  sing N N 285 
SER OG  HG   sing N N 286 
SER OXT HXT  sing N N 287 
THR N   CA   sing N N 288 
THR N   H    sing N N 289 
THR N   H2   sing N N 290 
THR CA  C    sing N N 291 
THR CA  CB   sing N N 292 
THR CA  HA   sing N N 293 
THR C   O    doub N N 294 
THR C   OXT  sing N N 295 
THR CB  OG1  sing N N 296 
THR CB  CG2  sing N N 297 
THR CB  HB   sing N N 298 
THR OG1 HG1  sing N N 299 
THR CG2 HG21 sing N N 300 
THR CG2 HG22 sing N N 301 
THR CG2 HG23 sing N N 302 
THR OXT HXT  sing N N 303 
TRP N   CA   sing N N 304 
TRP N   H    sing N N 305 
TRP N   H2   sing N N 306 
TRP CA  C    sing N N 307 
TRP CA  CB   sing N N 308 
TRP CA  HA   sing N N 309 
TRP C   O    doub N N 310 
TRP C   OXT  sing N N 311 
TRP CB  CG   sing N N 312 
TRP CB  HB2  sing N N 313 
TRP CB  HB3  sing N N 314 
TRP CG  CD1  doub Y N 315 
TRP CG  CD2  sing Y N 316 
TRP CD1 NE1  sing Y N 317 
TRP CD1 HD1  sing N N 318 
TRP CD2 CE2  doub Y N 319 
TRP CD2 CE3  sing Y N 320 
TRP NE1 CE2  sing Y N 321 
TRP NE1 HE1  sing N N 322 
TRP CE2 CZ2  sing Y N 323 
TRP CE3 CZ3  doub Y N 324 
TRP CE3 HE3  sing N N 325 
TRP CZ2 CH2  doub Y N 326 
TRP CZ2 HZ2  sing N N 327 
TRP CZ3 CH2  sing Y N 328 
TRP CZ3 HZ3  sing N N 329 
TRP CH2 HH2  sing N N 330 
TRP OXT HXT  sing N N 331 
TYR N   CA   sing N N 332 
TYR N   H    sing N N 333 
TYR N   H2   sing N N 334 
TYR CA  C    sing N N 335 
TYR CA  CB   sing N N 336 
TYR CA  HA   sing N N 337 
TYR C   O    doub N N 338 
TYR C   OXT  sing N N 339 
TYR CB  CG   sing N N 340 
TYR CB  HB2  sing N N 341 
TYR CB  HB3  sing N N 342 
TYR CG  CD1  doub Y N 343 
TYR CG  CD2  sing Y N 344 
TYR CD1 CE1  sing Y N 345 
TYR CD1 HD1  sing N N 346 
TYR CD2 CE2  doub Y N 347 
TYR CD2 HD2  sing N N 348 
TYR CE1 CZ   doub Y N 349 
TYR CE1 HE1  sing N N 350 
TYR CE2 CZ   sing Y N 351 
TYR CE2 HE2  sing N N 352 
TYR CZ  OH   sing N N 353 
TYR OH  HH   sing N N 354 
TYR OXT HXT  sing N N 355 
VAL N   CA   sing N N 356 
VAL N   H    sing N N 357 
VAL N   H2   sing N N 358 
VAL CA  C    sing N N 359 
VAL CA  CB   sing N N 360 
VAL CA  HA   sing N N 361 
VAL C   O    doub N N 362 
VAL C   OXT  sing N N 363 
VAL CB  CG1  sing N N 364 
VAL CB  CG2  sing N N 365 
VAL CB  HB   sing N N 366 
VAL CG1 HG11 sing N N 367 
VAL CG1 HG12 sing N N 368 
VAL CG1 HG13 sing N N 369 
VAL CG2 HG21 sing N N 370 
VAL CG2 HG22 sing N N 371 
VAL CG2 HG23 sing N N 372 
VAL OXT HXT  sing N N 373 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             AVANCE 
_pdbx_nmr_spectrometer.field_strength    800 
# 
_atom_sites.entry_id                    1V87 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_