data_1V8M # _entry.id 1V8M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1V8M pdb_00001v8m 10.2210/pdb1v8m/pdb RCSB RCSB006343 ? ? WWPDB D_1000006343 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-10-19 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 17 4 'Structure model' '_pdbx_struct_conn_angle.value' 18 4 'Structure model' '_struct_conn.pdbx_dist_value' 19 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 4 'Structure model' '_struct_conn.ptnr1_symmetry' 26 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 30 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 31 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 32 4 'Structure model' '_struct_conn.ptnr2_symmetry' 33 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 34 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 35 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1V8M _pdbx_database_status.recvd_initial_deposition_date 2004-01-12 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1V8I 'the same protein' unspecified PDB 1V8L 'the same protein with ADP-ribose' unspecified PDB 1V8N 'the same protein with ZN' unspecified PDB 1V8R 'the same protein with ADP-ribose and ZN' unspecified PDB 1V8S 'the same protein with AMP and MG' unspecified PDB 1V8T ;the same protein with ribose-5'-phosphate and Zn ; unspecified PDB 1V8U 'E82Q mutant, with SO4 and Mg' unspecified PDB 1V8V 'E86Q mutant, with ADP-ribose and Mg' unspecified PDB 1V8W 'E82Q mutant, with SO4 and Zn' unspecified PDB 1V8Y 'E86Q mutant, with ADP-ribose and Zn' unspecified TargetDB ttk003001345.4 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yoshiba, S.' 1 'Ooga, T.' 2 'Nakagawa, N.' 3 'Shibata, T.' 4 'Inoue, Y.' 5 'Yokoyama, S.' 6 'Kuramitsu, S.' 7 'Masui, R.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title ;Structural insights into the Thermus thermophilus ADP-ribose pyrophosphatase mechanism via crystal structures with the bound substrate and metal ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 279 _citation.page_first 37163 _citation.page_last 37174 _citation.year 2004 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15210687 _citation.pdbx_database_id_DOI 10.1074/jbc.M403817200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yoshiba, S.' 1 ? primary 'Ooga, T.' 2 ? primary 'Nakagawa, N.' 3 ? primary 'Shibata, T.' 4 ? primary 'Inoue, Y.' 5 ? primary 'Yokoyama, S.' 6 ? primary 'Kuramitsu, S.' 7 ? primary 'Masui, R.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ADP-ribose pyrophosphatase' 19287.912 1 3.6.1.13 ? ? ? 2 non-polymer syn ADENOSINE-5-DIPHOSPHORIBOSE 559.316 1 ? ? ? ? 3 non-polymer syn 'GADOLINIUM ATOM' 157.250 4 ? ? ? ? 4 water nat water 18.015 39 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGRVYYGGVERTYLYRGRILNLALEGRYEIVEHKPAVAVIALREGRMLFVRQMRPAVGLAPLEIPAGLIEPGEDPLEAAR RELAEETGLSGDLTYLFSYFVSPGFTDEKTHVFLAENLKEVEAHPDEDEAIEVVWMRPEEALERHQRGEVEFSATGLVGV LYYHAFLRGR ; _entity_poly.pdbx_seq_one_letter_code_can ;MGRVYYGGVERTYLYRGRILNLALEGRYEIVEHKPAVAVIALREGRMLFVRQMRPAVGLAPLEIPAGLIEPGEDPLEAAR RELAEETGLSGDLTYLFSYFVSPGFTDEKTHVFLAENLKEVEAHPDEDEAIEVVWMRPEEALERHQRGEVEFSATGLVGV LYYHAFLRGR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ttk003001345.4 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ADENOSINE-5-DIPHOSPHORIBOSE APR 3 'GADOLINIUM ATOM' GD 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ARG n 1 4 VAL n 1 5 TYR n 1 6 TYR n 1 7 GLY n 1 8 GLY n 1 9 VAL n 1 10 GLU n 1 11 ARG n 1 12 THR n 1 13 TYR n 1 14 LEU n 1 15 TYR n 1 16 ARG n 1 17 GLY n 1 18 ARG n 1 19 ILE n 1 20 LEU n 1 21 ASN n 1 22 LEU n 1 23 ALA n 1 24 LEU n 1 25 GLU n 1 26 GLY n 1 27 ARG n 1 28 TYR n 1 29 GLU n 1 30 ILE n 1 31 VAL n 1 32 GLU n 1 33 HIS n 1 34 LYS n 1 35 PRO n 1 36 ALA n 1 37 VAL n 1 38 ALA n 1 39 VAL n 1 40 ILE n 1 41 ALA n 1 42 LEU n 1 43 ARG n 1 44 GLU n 1 45 GLY n 1 46 ARG n 1 47 MET n 1 48 LEU n 1 49 PHE n 1 50 VAL n 1 51 ARG n 1 52 GLN n 1 53 MET n 1 54 ARG n 1 55 PRO n 1 56 ALA n 1 57 VAL n 1 58 GLY n 1 59 LEU n 1 60 ALA n 1 61 PRO n 1 62 LEU n 1 63 GLU n 1 64 ILE n 1 65 PRO n 1 66 ALA n 1 67 GLY n 1 68 LEU n 1 69 ILE n 1 70 GLU n 1 71 PRO n 1 72 GLY n 1 73 GLU n 1 74 ASP n 1 75 PRO n 1 76 LEU n 1 77 GLU n 1 78 ALA n 1 79 ALA n 1 80 ARG n 1 81 ARG n 1 82 GLU n 1 83 LEU n 1 84 ALA n 1 85 GLU n 1 86 GLU n 1 87 THR n 1 88 GLY n 1 89 LEU n 1 90 SER n 1 91 GLY n 1 92 ASP n 1 93 LEU n 1 94 THR n 1 95 TYR n 1 96 LEU n 1 97 PHE n 1 98 SER n 1 99 TYR n 1 100 PHE n 1 101 VAL n 1 102 SER n 1 103 PRO n 1 104 GLY n 1 105 PHE n 1 106 THR n 1 107 ASP n 1 108 GLU n 1 109 LYS n 1 110 THR n 1 111 HIS n 1 112 VAL n 1 113 PHE n 1 114 LEU n 1 115 ALA n 1 116 GLU n 1 117 ASN n 1 118 LEU n 1 119 LYS n 1 120 GLU n 1 121 VAL n 1 122 GLU n 1 123 ALA n 1 124 HIS n 1 125 PRO n 1 126 ASP n 1 127 GLU n 1 128 ASP n 1 129 GLU n 1 130 ALA n 1 131 ILE n 1 132 GLU n 1 133 VAL n 1 134 VAL n 1 135 TRP n 1 136 MET n 1 137 ARG n 1 138 PRO n 1 139 GLU n 1 140 GLU n 1 141 ALA n 1 142 LEU n 1 143 GLU n 1 144 ARG n 1 145 HIS n 1 146 GLN n 1 147 ARG n 1 148 GLY n 1 149 GLU n 1 150 VAL n 1 151 GLU n 1 152 PHE n 1 153 SER n 1 154 ALA n 1 155 THR n 1 156 GLY n 1 157 LEU n 1 158 VAL n 1 159 GLY n 1 160 VAL n 1 161 LEU n 1 162 TYR n 1 163 TYR n 1 164 HIS n 1 165 ALA n 1 166 PHE n 1 167 LEU n 1 168 ARG n 1 169 GLY n 1 170 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 274 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 APR non-polymer . ADENOSINE-5-DIPHOSPHORIBOSE ? 'C15 H23 N5 O14 P2' 559.316 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GD non-polymer . 'GADOLINIUM ATOM' ? Gd 157.250 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 TYR 5 5 ? ? ? A . n A 1 6 TYR 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 GLY 8 8 ? ? ? A . n A 1 9 VAL 9 9 ? ? ? A . n A 1 10 GLU 10 10 ? ? ? A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 HIS 111 111 111 HIS HIS A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 TRP 135 135 135 TRP TRP A . n A 1 136 MET 136 136 136 MET MET A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 HIS 145 145 145 HIS HIS A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 TYR 162 162 162 TYR TYR A . n A 1 163 TYR 163 163 163 TYR TYR A . n A 1 164 HIS 164 164 164 HIS HIS A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 PHE 166 166 166 PHE PHE A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 ARG 170 170 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 APR 1 619 619 APR APR A . C 3 GD 1 300 300 GD GD A . D 3 GD 1 301 301 GD GD A . E 3 GD 1 302 302 GD GD A . F 3 GD 1 303 303 GD GD A . G 4 HOH 1 620 1 HOH TIP A . G 4 HOH 2 621 2 HOH TIP A . G 4 HOH 3 622 3 HOH TIP A . G 4 HOH 4 623 4 HOH TIP A . G 4 HOH 5 624 5 HOH TIP A . G 4 HOH 6 625 6 HOH TIP A . G 4 HOH 7 626 7 HOH TIP A . G 4 HOH 8 627 8 HOH TIP A . G 4 HOH 9 628 9 HOH TIP A . G 4 HOH 10 629 10 HOH TIP A . G 4 HOH 11 630 11 HOH TIP A . G 4 HOH 12 631 12 HOH TIP A . G 4 HOH 13 632 13 HOH TIP A . G 4 HOH 14 633 14 HOH TIP A . G 4 HOH 15 634 15 HOH TIP A . G 4 HOH 16 635 16 HOH TIP A . G 4 HOH 17 636 17 HOH TIP A . G 4 HOH 18 637 18 HOH TIP A . G 4 HOH 19 638 20 HOH TIP A . G 4 HOH 20 639 21 HOH TIP A . G 4 HOH 21 640 22 HOH TIP A . G 4 HOH 22 641 23 HOH TIP A . G 4 HOH 23 642 24 HOH TIP A . G 4 HOH 24 643 25 HOH TIP A . G 4 HOH 25 644 26 HOH TIP A . G 4 HOH 26 645 27 HOH TIP A . G 4 HOH 27 646 28 HOH TIP A . G 4 HOH 28 647 29 HOH TIP A . G 4 HOH 29 648 30 HOH TIP A . G 4 HOH 30 649 31 HOH TIP A . G 4 HOH 31 650 32 HOH TIP A . G 4 HOH 32 651 33 HOH TIP A . G 4 HOH 33 652 34 HOH TIP A . G 4 HOH 34 653 35 HOH TIP A . G 4 HOH 35 654 36 HOH TIP A . G 4 HOH 36 655 37 HOH TIP A . G 4 HOH 37 656 38 HOH TIP A . G 4 HOH 38 657 39 HOH TIP A . G 4 HOH 39 658 40 HOH TIP A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 HKL-2000 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 # _cell.entry_id 1V8M _cell.length_a 49.610 _cell.length_b 49.610 _cell.length_c 119.870 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1V8M _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? # _exptl.entry_id 1V8M _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.25 _exptl_crystal.density_percent_sol 44.98 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_details 'VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL44B2' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL44B2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0 # _reflns.entry_id 1V8M _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50 _reflns.d_resolution_high 1.8 _reflns.number_obs 16475 _reflns.number_all 16511 _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.062 _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 12.9 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.8 _reflns_shell.d_res_low 1.86 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.283 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1V8M _refine.ls_number_reflns_obs 16145 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F .0 _refine.pdbx_data_cutoff_high_absF 422537.05 _refine.pdbx_data_cutoff_low_absF .000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.11 _refine.ls_d_res_high 1.80 _refine.ls_percent_reflns_obs 98.0 _refine.ls_R_factor_obs 0.22 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.22 _refine.ls_R_factor_R_free 0.244 _refine.ls_R_factor_R_free_error .006 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.0 _refine.ls_number_reflns_R_free 1610 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 22.8 _refine.aniso_B[1][1] 1.22 _refine.aniso_B[2][2] 1.22 _refine.aniso_B[3][3] -2.44 _refine.aniso_B[1][2] -.20 _refine.aniso_B[1][3] .00 _refine.aniso_B[2][3] .00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol .454056 _refine.solvent_model_param_bsol 67.0157 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1V8M _refine_analyze.Luzzati_coordinate_error_obs .22 _refine_analyze.Luzzati_sigma_a_obs .14 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free .24 _refine_analyze.Luzzati_sigma_a_free .16 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1271 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 40 _refine_hist.number_atoms_solvent 39 _refine_hist.number_atoms_total 1350 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 19.11 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d .005 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 23.9 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d .65 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.03 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 1.78 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 1.38 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 2.20 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 1.80 _refine_ls_shell.d_res_low 1.91 _refine_ls_shell.number_reflns_R_work 2245 _refine_ls_shell.R_factor_R_work 0.246 _refine_ls_shell.percent_reflns_obs 91.5 _refine_ls_shell.R_factor_R_free 0.304 _refine_ls_shell.R_factor_R_free_error .020 _refine_ls_shell.percent_reflns_R_free 9.5 _refine_ls_shell.number_reflns_R_free 236 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' 3 APR_XPLOR_PAR.TXT APR_XPLOR_TOP.TXT 'X-RAY DIFFRACTION' 4 GD_XPLOR_PAR2.TXT GD_XPLOR_TOP2.TXT 'X-RAY DIFFRACTION' # _database_PDB_matrix.entry_id 1V8M _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] .000000 _database_PDB_matrix.origx[1][3] .000000 _database_PDB_matrix.origx[2][1] .000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] .000000 _database_PDB_matrix.origx[3][1] .000000 _database_PDB_matrix.origx[3][2] .000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] .00000 _database_PDB_matrix.origx_vector[2] .00000 _database_PDB_matrix.origx_vector[3] .00000 # _struct.entry_id 1V8M _struct.title 'Crystal structure analysis of ADP-ribose pyrophosphatase complexed with ADP-ribose and Gd' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1V8M _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'Nudix motif, loop-helix-loop, MutT family, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q84CU3_THETH _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGRVYYGGVERTYLYRGRILNLALEGRYEIVEHKPAVAVIALREGRMLFVRQMRPAVGLAPLEIPAGLIEPGEDPLEAAR RELAEETGLSGDLTYLFSYFVSPGFTDEKTHVFLAENLKEVEAHPDEDEAIEVVWMRPEEALERHQRGEVEFSATGLVGV LYYHAFLRGR ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession Q84CU3 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1V8M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 170 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q84CU3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 170 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 170 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7600 ? 1 MORE -91 ? 1 'SSA (A^2)' 13510 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 -x,-x+y,-z+2/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 79.9133333333 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 74 ? GLY A 88 ? ASP A 74 GLY A 88 1 ? 15 HELX_P HELX_P2 2 ARG A 137 ? ARG A 147 ? ARG A 137 ARG A 147 1 ? 11 HELX_P HELX_P3 3 SER A 153 ? LEU A 167 ? SER A 153 LEU A 167 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ALA 66 O ? ? ? 1_555 C GD . GD ? ? A ALA 66 A GD 300 1_555 ? ? ? ? ? ? ? 2.252 ? ? metalc2 metalc ? ? A GLU 82 OE1 ? ? ? 1_555 D GD . GD ? ? A GLU 82 A GD 301 1_555 ? ? ? ? ? ? ? 2.747 ? ? metalc3 metalc ? ? A GLU 82 OE2 ? ? ? 1_555 D GD . GD ? ? A GLU 82 A GD 301 1_555 ? ? ? ? ? ? ? 2.760 ? ? metalc4 metalc ? ? A GLU 86 OE2 ? ? ? 1_555 C GD . GD ? ? A GLU 86 A GD 300 1_555 ? ? ? ? ? ? ? 2.179 ? ? metalc5 metalc ? ? A GLU 122 OE2 ? ? ? 5_565 E GD . GD ? ? A GLU 122 A GD 302 1_555 ? ? ? ? ? ? ? 3.056 ? ? metalc6 metalc ? ? A GLU 122 OE1 ? ? ? 1_555 F GD . GD ? ? A GLU 122 A GD 303 1_555 ? ? ? ? ? ? ? 2.109 ? ? metalc7 metalc ? ? A GLU 122 OE2 ? ? ? 1_555 F GD . GD ? ? A GLU 122 A GD 303 1_555 ? ? ? ? ? ? ? 2.131 ? ? metalc8 metalc ? ? A GLU 140 OE1 ? ? ? 1_555 E GD . GD ? ? A GLU 140 A GD 302 1_555 ? ? ? ? ? ? ? 2.593 ? ? metalc9 metalc ? ? A GLU 140 OE2 ? ? ? 1_555 E GD . GD ? ? A GLU 140 A GD 302 1_555 ? ? ? ? ? ? ? 2.061 ? ? metalc10 metalc ? ? A GLU 140 OE1 ? ? ? 5_665 F GD . GD ? ? A GLU 140 A GD 303 1_555 ? ? ? ? ? ? ? 2.358 ? ? metalc11 metalc ? ? A GLU 140 OE2 ? ? ? 5_665 F GD . GD ? ? A GLU 140 A GD 303 1_555 ? ? ? ? ? ? ? 2.836 ? ? metalc12 metalc ? ? A GLU 143 OE2 ? ? ? 1_555 E GD . GD ? ? A GLU 143 A GD 302 1_555 ? ? ? ? ? ? ? 2.240 ? ? metalc13 metalc ? ? A GLU 143 OE1 ? ? ? 1_555 E GD . GD ? ? A GLU 143 A GD 302 1_555 ? ? ? ? ? ? ? 2.542 ? ? metalc14 metalc ? ? A GLU 143 OE2 ? ? ? 5_665 F GD . GD ? ? A GLU 143 A GD 303 1_555 ? ? ? ? ? ? ? 1.926 ? ? metalc15 metalc ? ? C GD . GD ? ? ? 1_555 B APR . O3A ? ? A GD 300 A APR 619 1_555 ? ? ? ? ? ? ? 2.745 ? ? metalc16 metalc ? ? C GD . GD ? ? ? 1_555 G HOH . O ? ? A GD 300 A HOH 632 1_555 ? ? ? ? ? ? ? 2.398 ? ? metalc17 metalc ? ? C GD . GD ? ? ? 1_555 G HOH . O ? ? A GD 300 A HOH 657 1_555 ? ? ? ? ? ? ? 1.791 ? ? metalc18 metalc ? ? D GD . GD ? ? ? 1_555 B APR . O1A ? ? A GD 301 A APR 619 1_555 ? ? ? ? ? ? ? 2.704 ? ? metalc19 metalc ? ? D GD . GD ? ? ? 1_555 G HOH . O ? ? A GD 301 A HOH 656 1_555 ? ? ? ? ? ? ? 2.174 ? ? metalc20 metalc ? ? D GD . GD ? ? ? 1_555 G HOH . O ? ? A GD 301 A HOH 657 1_555 ? ? ? ? ? ? ? 1.979 ? ? metalc21 metalc ? ? E GD . GD ? ? ? 1_555 G HOH . O ? ? A GD 302 A HOH 647 5_565 ? ? ? ? ? ? ? 2.084 ? ? metalc22 metalc ? ? F GD . GD ? ? ? 1_555 G HOH . O ? ? A GD 303 A HOH 647 1_555 ? ? ? ? ? ? ? 2.996 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A ALA 66 ? A ALA 66 ? 1_555 GD ? C GD . ? A GD 300 ? 1_555 OE2 ? A GLU 86 ? A GLU 86 ? 1_555 99.9 ? 2 O ? A ALA 66 ? A ALA 66 ? 1_555 GD ? C GD . ? A GD 300 ? 1_555 O3A ? B APR . ? A APR 619 ? 1_555 97.3 ? 3 OE2 ? A GLU 86 ? A GLU 86 ? 1_555 GD ? C GD . ? A GD 300 ? 1_555 O3A ? B APR . ? A APR 619 ? 1_555 162.9 ? 4 O ? A ALA 66 ? A ALA 66 ? 1_555 GD ? C GD . ? A GD 300 ? 1_555 O ? G HOH . ? A HOH 632 ? 1_555 83.2 ? 5 OE2 ? A GLU 86 ? A GLU 86 ? 1_555 GD ? C GD . ? A GD 300 ? 1_555 O ? G HOH . ? A HOH 632 ? 1_555 70.0 ? 6 O3A ? B APR . ? A APR 619 ? 1_555 GD ? C GD . ? A GD 300 ? 1_555 O ? G HOH . ? A HOH 632 ? 1_555 113.1 ? 7 O ? A ALA 66 ? A ALA 66 ? 1_555 GD ? C GD . ? A GD 300 ? 1_555 O ? G HOH . ? A HOH 657 ? 1_555 110.4 ? 8 OE2 ? A GLU 86 ? A GLU 86 ? 1_555 GD ? C GD . ? A GD 300 ? 1_555 O ? G HOH . ? A HOH 657 ? 1_555 110.1 ? 9 O3A ? B APR . ? A APR 619 ? 1_555 GD ? C GD . ? A GD 300 ? 1_555 O ? G HOH . ? A HOH 657 ? 1_555 62.5 ? 10 O ? G HOH . ? A HOH 632 ? 1_555 GD ? C GD . ? A GD 300 ? 1_555 O ? G HOH . ? A HOH 657 ? 1_555 165.8 ? 11 OE1 ? A GLU 82 ? A GLU 82 ? 1_555 GD ? D GD . ? A GD 301 ? 1_555 OE2 ? A GLU 82 ? A GLU 82 ? 1_555 46.9 ? 12 OE1 ? A GLU 82 ? A GLU 82 ? 1_555 GD ? D GD . ? A GD 301 ? 1_555 O1A ? B APR . ? A APR 619 ? 1_555 56.2 ? 13 OE2 ? A GLU 82 ? A GLU 82 ? 1_555 GD ? D GD . ? A GD 301 ? 1_555 O1A ? B APR . ? A APR 619 ? 1_555 90.5 ? 14 OE1 ? A GLU 82 ? A GLU 82 ? 1_555 GD ? D GD . ? A GD 301 ? 1_555 O ? G HOH . ? A HOH 656 ? 1_555 97.7 ? 15 OE2 ? A GLU 82 ? A GLU 82 ? 1_555 GD ? D GD . ? A GD 301 ? 1_555 O ? G HOH . ? A HOH 656 ? 1_555 69.0 ? 16 O1A ? B APR . ? A APR 619 ? 1_555 GD ? D GD . ? A GD 301 ? 1_555 O ? G HOH . ? A HOH 656 ? 1_555 153.9 ? 17 OE1 ? A GLU 82 ? A GLU 82 ? 1_555 GD ? D GD . ? A GD 301 ? 1_555 O ? G HOH . ? A HOH 657 ? 1_555 85.5 ? 18 OE2 ? A GLU 82 ? A GLU 82 ? 1_555 GD ? D GD . ? A GD 301 ? 1_555 O ? G HOH . ? A HOH 657 ? 1_555 66.2 ? 19 O1A ? B APR . ? A APR 619 ? 1_555 GD ? D GD . ? A GD 301 ? 1_555 O ? G HOH . ? A HOH 657 ? 1_555 69.7 ? 20 O ? G HOH . ? A HOH 656 ? 1_555 GD ? D GD . ? A GD 301 ? 1_555 O ? G HOH . ? A HOH 657 ? 1_555 113.2 ? 21 OE2 ? A GLU 122 ? A GLU 122 ? 5_565 GD ? E GD . ? A GD 302 ? 1_555 OE1 ? A GLU 140 ? A GLU 140 ? 1_555 61.1 ? 22 OE2 ? A GLU 122 ? A GLU 122 ? 5_565 GD ? E GD . ? A GD 302 ? 1_555 OE2 ? A GLU 140 ? A GLU 140 ? 1_555 109.9 ? 23 OE1 ? A GLU 140 ? A GLU 140 ? 1_555 GD ? E GD . ? A GD 302 ? 1_555 OE2 ? A GLU 140 ? A GLU 140 ? 1_555 54.8 ? 24 OE2 ? A GLU 122 ? A GLU 122 ? 5_565 GD ? E GD . ? A GD 302 ? 1_555 OE2 ? A GLU 143 ? A GLU 143 ? 1_555 89.8 ? 25 OE1 ? A GLU 140 ? A GLU 140 ? 1_555 GD ? E GD . ? A GD 302 ? 1_555 OE2 ? A GLU 143 ? A GLU 143 ? 1_555 90.8 ? 26 OE2 ? A GLU 140 ? A GLU 140 ? 1_555 GD ? E GD . ? A GD 302 ? 1_555 OE2 ? A GLU 143 ? A GLU 143 ? 1_555 115.3 ? 27 OE2 ? A GLU 122 ? A GLU 122 ? 5_565 GD ? E GD . ? A GD 302 ? 1_555 OE1 ? A GLU 143 ? A GLU 143 ? 1_555 139.9 ? 28 OE1 ? A GLU 140 ? A GLU 140 ? 1_555 GD ? E GD . ? A GD 302 ? 1_555 OE1 ? A GLU 143 ? A GLU 143 ? 1_555 99.0 ? 29 OE2 ? A GLU 140 ? A GLU 140 ? 1_555 GD ? E GD . ? A GD 302 ? 1_555 OE1 ? A GLU 143 ? A GLU 143 ? 1_555 77.3 ? 30 OE2 ? A GLU 143 ? A GLU 143 ? 1_555 GD ? E GD . ? A GD 302 ? 1_555 OE1 ? A GLU 143 ? A GLU 143 ? 1_555 53.8 ? 31 OE2 ? A GLU 122 ? A GLU 122 ? 5_565 GD ? E GD . ? A GD 302 ? 1_555 O ? G HOH . ? A HOH 647 ? 5_565 140.4 ? 32 OE1 ? A GLU 140 ? A GLU 140 ? 1_555 GD ? E GD . ? A GD 302 ? 1_555 O ? G HOH . ? A HOH 647 ? 5_565 158.4 ? 33 OE2 ? A GLU 140 ? A GLU 140 ? 1_555 GD ? E GD . ? A GD 302 ? 1_555 O ? G HOH . ? A HOH 647 ? 5_565 106.0 ? 34 OE2 ? A GLU 143 ? A GLU 143 ? 1_555 GD ? E GD . ? A GD 302 ? 1_555 O ? G HOH . ? A HOH 647 ? 5_565 89.6 ? 35 OE1 ? A GLU 143 ? A GLU 143 ? 1_555 GD ? E GD . ? A GD 302 ? 1_555 O ? G HOH . ? A HOH 647 ? 5_565 64.3 ? 36 OE1 ? A GLU 122 ? A GLU 122 ? 1_555 GD ? F GD . ? A GD 303 ? 1_555 OE2 ? A GLU 122 ? A GLU 122 ? 1_555 62.4 ? 37 OE1 ? A GLU 122 ? A GLU 122 ? 1_555 GD ? F GD . ? A GD 303 ? 1_555 OE1 ? A GLU 140 ? A GLU 140 ? 5_665 90.8 ? 38 OE2 ? A GLU 122 ? A GLU 122 ? 1_555 GD ? F GD . ? A GD 303 ? 1_555 OE1 ? A GLU 140 ? A GLU 140 ? 5_665 80.3 ? 39 OE1 ? A GLU 122 ? A GLU 122 ? 1_555 GD ? F GD . ? A GD 303 ? 1_555 OE2 ? A GLU 140 ? A GLU 140 ? 5_665 136.1 ? 40 OE2 ? A GLU 122 ? A GLU 122 ? 1_555 GD ? F GD . ? A GD 303 ? 1_555 OE2 ? A GLU 140 ? A GLU 140 ? 5_665 116.0 ? 41 OE1 ? A GLU 140 ? A GLU 140 ? 5_665 GD ? F GD . ? A GD 303 ? 1_555 OE2 ? A GLU 140 ? A GLU 140 ? 5_665 48.9 ? 42 OE1 ? A GLU 122 ? A GLU 122 ? 1_555 GD ? F GD . ? A GD 303 ? 1_555 OE2 ? A GLU 143 ? A GLU 143 ? 5_665 75.6 ? 43 OE2 ? A GLU 122 ? A GLU 122 ? 1_555 GD ? F GD . ? A GD 303 ? 1_555 OE2 ? A GLU 143 ? A GLU 143 ? 5_665 137.7 ? 44 OE1 ? A GLU 140 ? A GLU 140 ? 5_665 GD ? F GD . ? A GD 303 ? 1_555 OE2 ? A GLU 143 ? A GLU 143 ? 5_665 106.9 ? 45 OE2 ? A GLU 140 ? A GLU 140 ? 5_665 GD ? F GD . ? A GD 303 ? 1_555 OE2 ? A GLU 143 ? A GLU 143 ? 5_665 97.7 ? 46 OE1 ? A GLU 122 ? A GLU 122 ? 1_555 GD ? F GD . ? A GD 303 ? 1_555 O ? G HOH . ? A HOH 647 ? 1_555 142.3 ? 47 OE2 ? A GLU 122 ? A GLU 122 ? 1_555 GD ? F GD . ? A GD 303 ? 1_555 O ? G HOH . ? A HOH 647 ? 1_555 141.4 ? 48 OE1 ? A GLU 140 ? A GLU 140 ? 5_665 GD ? F GD . ? A GD 303 ? 1_555 O ? G HOH . ? A HOH 647 ? 1_555 117.8 ? 49 OE2 ? A GLU 140 ? A GLU 140 ? 5_665 GD ? F GD . ? A GD 303 ? 1_555 O ? G HOH . ? A HOH 647 ? 1_555 69.1 ? 50 OE2 ? A GLU 143 ? A GLU 143 ? 5_665 GD ? F GD . ? A GD 303 ? 1_555 O ? G HOH . ? A HOH 647 ? 1_555 72.9 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 4 ? C ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? parallel B 3 4 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 12 ? ARG A 16 ? THR A 12 ARG A 16 A 2 LEU A 20 ? GLU A 25 ? LEU A 20 GLU A 25 A 3 TYR A 28 ? HIS A 33 ? TYR A 28 HIS A 33 B 1 ALA A 66 ? LEU A 68 ? ALA A 66 LEU A 68 B 2 ALA A 36 ? ARG A 43 ? ALA A 36 ARG A 43 B 3 LYS A 109 ? GLU A 120 ? LYS A 109 GLU A 120 B 4 LEU A 89 ? PHE A 100 ? LEU A 89 PHE A 100 C 1 ALA A 66 ? LEU A 68 ? ALA A 66 LEU A 68 C 2 ALA A 36 ? ARG A 43 ? ALA A 36 ARG A 43 C 3 ARG A 46 ? ARG A 51 ? ARG A 46 ARG A 51 C 4 GLU A 132 ? MET A 136 ? GLU A 132 MET A 136 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 15 ? N TYR A 15 O LEU A 22 ? O LEU A 22 A 2 3 N ALA A 23 ? N ALA A 23 O ILE A 30 ? O ILE A 30 B 1 2 O GLY A 67 ? O GLY A 67 N VAL A 37 ? N VAL A 37 B 2 3 N ILE A 40 ? N ILE A 40 O PHE A 113 ? O PHE A 113 B 3 4 O VAL A 112 ? O VAL A 112 N PHE A 97 ? N PHE A 97 C 1 2 O GLY A 67 ? O GLY A 67 N VAL A 37 ? N VAL A 37 C 2 3 N ARG A 43 ? N ARG A 43 O ARG A 46 ? O ARG A 46 C 3 4 N PHE A 49 ? N PHE A 49 O VAL A 134 ? O VAL A 134 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A APR 619 ? 21 'BINDING SITE FOR RESIDUE APR A 619' AC2 Software A GD 300 ? 6 'BINDING SITE FOR RESIDUE GD A 300' AC3 Software A GD 301 ? 4 'BINDING SITE FOR RESIDUE GD A 301' AC4 Software A GD 302 ? 6 'BINDING SITE FOR RESIDUE GD A 302' AC5 Software A GD 303 ? 5 'BINDING SITE FOR RESIDUE GD A 303' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 21 ARG A 18 ? ARG A 18 . ? 1_555 ? 2 AC1 21 ILE A 19 ? ILE A 19 . ? 1_555 ? 3 AC1 21 ARG A 27 ? ARG A 27 . ? 6_555 ? 4 AC1 21 GLU A 29 ? GLU A 29 . ? 6_555 ? 5 AC1 21 ALA A 36 ? ALA A 36 . ? 1_555 ? 6 AC1 21 GLN A 52 ? GLN A 52 . ? 1_555 ? 7 AC1 21 ARG A 54 ? ARG A 54 . ? 1_555 ? 8 AC1 21 GLU A 63 ? GLU A 63 . ? 1_555 ? 9 AC1 21 GLY A 67 ? GLY A 67 . ? 1_555 ? 10 AC1 21 LEU A 68 ? LEU A 68 . ? 1_555 ? 11 AC1 21 GLU A 82 ? GLU A 82 . ? 1_555 ? 12 AC1 21 SER A 102 ? SER A 102 . ? 6_555 ? 13 AC1 21 PRO A 103 ? PRO A 103 . ? 6_555 ? 14 AC1 21 GLY A 104 ? GLY A 104 . ? 6_555 ? 15 AC1 21 GLU A 108 ? GLU A 108 . ? 1_555 ? 16 AC1 21 GD C . ? GD A 300 . ? 1_555 ? 17 AC1 21 GD D . ? GD A 301 . ? 1_555 ? 18 AC1 21 HOH G . ? HOH A 629 . ? 1_555 ? 19 AC1 21 HOH G . ? HOH A 635 . ? 1_555 ? 20 AC1 21 HOH G . ? HOH A 657 . ? 1_555 ? 21 AC1 21 HOH G . ? HOH A 658 . ? 1_555 ? 22 AC2 6 ALA A 66 ? ALA A 66 . ? 1_555 ? 23 AC2 6 GLU A 82 ? GLU A 82 . ? 1_555 ? 24 AC2 6 GLU A 86 ? GLU A 86 . ? 1_555 ? 25 AC2 6 APR B . ? APR A 619 . ? 1_555 ? 26 AC2 6 HOH G . ? HOH A 632 . ? 1_555 ? 27 AC2 6 HOH G . ? HOH A 657 . ? 1_555 ? 28 AC3 4 GLU A 82 ? GLU A 82 . ? 1_555 ? 29 AC3 4 APR B . ? APR A 619 . ? 1_555 ? 30 AC3 4 HOH G . ? HOH A 656 . ? 1_555 ? 31 AC3 4 HOH G . ? HOH A 657 . ? 1_555 ? 32 AC4 6 GLU A 122 ? GLU A 122 . ? 5_565 ? 33 AC4 6 ASP A 126 ? ASP A 126 . ? 5_565 ? 34 AC4 6 GLU A 140 ? GLU A 140 . ? 1_555 ? 35 AC4 6 GLU A 143 ? GLU A 143 . ? 1_555 ? 36 AC4 6 GD F . ? GD A 303 . ? 5_565 ? 37 AC4 6 HOH G . ? HOH A 647 . ? 5_565 ? 38 AC5 5 GLU A 122 ? GLU A 122 . ? 1_555 ? 39 AC5 5 GLU A 140 ? GLU A 140 . ? 5_665 ? 40 AC5 5 GLU A 143 ? GLU A 143 . ? 5_665 ? 41 AC5 5 GD E . ? GD A 302 . ? 5_665 ? 42 AC5 5 HOH G . ? HOH A 647 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 102 ? ? -163.85 77.76 2 1 PHE A 105 ? ? -148.95 -17.84 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A TYR 5 ? A TYR 5 6 1 Y 1 A TYR 6 ? A TYR 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A GLY 8 ? A GLY 8 9 1 Y 1 A VAL 9 ? A VAL 9 10 1 Y 1 A GLU 10 ? A GLU 10 11 1 Y 1 A ARG 170 ? A ARG 170 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 APR N1 N Y N 14 APR C2 C Y N 15 APR N3 N Y N 16 APR C4 C Y N 17 APR C5 C Y N 18 APR C6 C Y N 19 APR N6 N N N 20 APR N7 N Y N 21 APR C8 C Y N 22 APR N9 N Y N 23 APR "C1'" C N R 24 APR "C2'" C N R 25 APR "O2'" O N N 26 APR "C3'" C N S 27 APR "O3'" O N N 28 APR "O4'" O N N 29 APR "C4'" C N R 30 APR "C5'" C N N 31 APR "O5'" O N N 32 APR PA P N S 33 APR O1A O N N 34 APR O2A O N N 35 APR O3A O N N 36 APR PB P N R 37 APR O1B O N N 38 APR O2B O N N 39 APR O5D O N N 40 APR C5D C N N 41 APR O4D O N N 42 APR O1D O N N 43 APR C1D C N R 44 APR O2D O N N 45 APR C2D C N R 46 APR O3D O N N 47 APR C3D C N S 48 APR C4D C N R 49 APR H2 H N N 50 APR H61 H N N 51 APR H62 H N N 52 APR H8 H N N 53 APR "H'1" H N N 54 APR "H'2" H N N 55 APR "HO'2" H N N 56 APR "H'3" H N N 57 APR "HO'3" H N N 58 APR "H'4" H N N 59 APR "H5'1" H N N 60 APR "H5'2" H N N 61 APR HOA2 H N N 62 APR HOB2 H N N 63 APR H5R1 H N N 64 APR H5R2 H N N 65 APR HOR1 H N N 66 APR "HR'1" H N N 67 APR HOR2 H N N 68 APR "HR'2" H N N 69 APR HOR3 H N N 70 APR "HR'3" H N N 71 APR "HR'4" H N N 72 ARG N N N N 73 ARG CA C N S 74 ARG C C N N 75 ARG O O N N 76 ARG CB C N N 77 ARG CG C N N 78 ARG CD C N N 79 ARG NE N N N 80 ARG CZ C N N 81 ARG NH1 N N N 82 ARG NH2 N N N 83 ARG OXT O N N 84 ARG H H N N 85 ARG H2 H N N 86 ARG HA H N N 87 ARG HB2 H N N 88 ARG HB3 H N N 89 ARG HG2 H N N 90 ARG HG3 H N N 91 ARG HD2 H N N 92 ARG HD3 H N N 93 ARG HE H N N 94 ARG HH11 H N N 95 ARG HH12 H N N 96 ARG HH21 H N N 97 ARG HH22 H N N 98 ARG HXT H N N 99 ASN N N N N 100 ASN CA C N S 101 ASN C C N N 102 ASN O O N N 103 ASN CB C N N 104 ASN CG C N N 105 ASN OD1 O N N 106 ASN ND2 N N N 107 ASN OXT O N N 108 ASN H H N N 109 ASN H2 H N N 110 ASN HA H N N 111 ASN HB2 H N N 112 ASN HB3 H N N 113 ASN HD21 H N N 114 ASN HD22 H N N 115 ASN HXT H N N 116 ASP N N N N 117 ASP CA C N S 118 ASP C C N N 119 ASP O O N N 120 ASP CB C N N 121 ASP CG C N N 122 ASP OD1 O N N 123 ASP OD2 O N N 124 ASP OXT O N N 125 ASP H H N N 126 ASP H2 H N N 127 ASP HA H N N 128 ASP HB2 H N N 129 ASP HB3 H N N 130 ASP HD2 H N N 131 ASP HXT H N N 132 GD GD GD N N 133 GLN N N N N 134 GLN CA C N S 135 GLN C C N N 136 GLN O O N N 137 GLN CB C N N 138 GLN CG C N N 139 GLN CD C N N 140 GLN OE1 O N N 141 GLN NE2 N N N 142 GLN OXT O N N 143 GLN H H N N 144 GLN H2 H N N 145 GLN HA H N N 146 GLN HB2 H N N 147 GLN HB3 H N N 148 GLN HG2 H N N 149 GLN HG3 H N N 150 GLN HE21 H N N 151 GLN HE22 H N N 152 GLN HXT H N N 153 GLU N N N N 154 GLU CA C N S 155 GLU C C N N 156 GLU O O N N 157 GLU CB C N N 158 GLU CG C N N 159 GLU CD C N N 160 GLU OE1 O N N 161 GLU OE2 O N N 162 GLU OXT O N N 163 GLU H H N N 164 GLU H2 H N N 165 GLU HA H N N 166 GLU HB2 H N N 167 GLU HB3 H N N 168 GLU HG2 H N N 169 GLU HG3 H N N 170 GLU HE2 H N N 171 GLU HXT H N N 172 GLY N N N N 173 GLY CA C N N 174 GLY C C N N 175 GLY O O N N 176 GLY OXT O N N 177 GLY H H N N 178 GLY H2 H N N 179 GLY HA2 H N N 180 GLY HA3 H N N 181 GLY HXT H N N 182 HIS N N N N 183 HIS CA C N S 184 HIS C C N N 185 HIS O O N N 186 HIS CB C N N 187 HIS CG C Y N 188 HIS ND1 N Y N 189 HIS CD2 C Y N 190 HIS CE1 C Y N 191 HIS NE2 N Y N 192 HIS OXT O N N 193 HIS H H N N 194 HIS H2 H N N 195 HIS HA H N N 196 HIS HB2 H N N 197 HIS HB3 H N N 198 HIS HD1 H N N 199 HIS HD2 H N N 200 HIS HE1 H N N 201 HIS HE2 H N N 202 HIS HXT H N N 203 HOH O O N N 204 HOH H1 H N N 205 HOH H2 H N N 206 ILE N N N N 207 ILE CA C N S 208 ILE C C N N 209 ILE O O N N 210 ILE CB C N S 211 ILE CG1 C N N 212 ILE CG2 C N N 213 ILE CD1 C N N 214 ILE OXT O N N 215 ILE H H N N 216 ILE H2 H N N 217 ILE HA H N N 218 ILE HB H N N 219 ILE HG12 H N N 220 ILE HG13 H N N 221 ILE HG21 H N N 222 ILE HG22 H N N 223 ILE HG23 H N N 224 ILE HD11 H N N 225 ILE HD12 H N N 226 ILE HD13 H N N 227 ILE HXT H N N 228 LEU N N N N 229 LEU CA C N S 230 LEU C C N N 231 LEU O O N N 232 LEU CB C N N 233 LEU CG C N N 234 LEU CD1 C N N 235 LEU CD2 C N N 236 LEU OXT O N N 237 LEU H H N N 238 LEU H2 H N N 239 LEU HA H N N 240 LEU HB2 H N N 241 LEU HB3 H N N 242 LEU HG H N N 243 LEU HD11 H N N 244 LEU HD12 H N N 245 LEU HD13 H N N 246 LEU HD21 H N N 247 LEU HD22 H N N 248 LEU HD23 H N N 249 LEU HXT H N N 250 LYS N N N N 251 LYS CA C N S 252 LYS C C N N 253 LYS O O N N 254 LYS CB C N N 255 LYS CG C N N 256 LYS CD C N N 257 LYS CE C N N 258 LYS NZ N N N 259 LYS OXT O N N 260 LYS H H N N 261 LYS H2 H N N 262 LYS HA H N N 263 LYS HB2 H N N 264 LYS HB3 H N N 265 LYS HG2 H N N 266 LYS HG3 H N N 267 LYS HD2 H N N 268 LYS HD3 H N N 269 LYS HE2 H N N 270 LYS HE3 H N N 271 LYS HZ1 H N N 272 LYS HZ2 H N N 273 LYS HZ3 H N N 274 LYS HXT H N N 275 MET N N N N 276 MET CA C N S 277 MET C C N N 278 MET O O N N 279 MET CB C N N 280 MET CG C N N 281 MET SD S N N 282 MET CE C N N 283 MET OXT O N N 284 MET H H N N 285 MET H2 H N N 286 MET HA H N N 287 MET HB2 H N N 288 MET HB3 H N N 289 MET HG2 H N N 290 MET HG3 H N N 291 MET HE1 H N N 292 MET HE2 H N N 293 MET HE3 H N N 294 MET HXT H N N 295 PHE N N N N 296 PHE CA C N S 297 PHE C C N N 298 PHE O O N N 299 PHE CB C N N 300 PHE CG C Y N 301 PHE CD1 C Y N 302 PHE CD2 C Y N 303 PHE CE1 C Y N 304 PHE CE2 C Y N 305 PHE CZ C Y N 306 PHE OXT O N N 307 PHE H H N N 308 PHE H2 H N N 309 PHE HA H N N 310 PHE HB2 H N N 311 PHE HB3 H N N 312 PHE HD1 H N N 313 PHE HD2 H N N 314 PHE HE1 H N N 315 PHE HE2 H N N 316 PHE HZ H N N 317 PHE HXT H N N 318 PRO N N N N 319 PRO CA C N S 320 PRO C C N N 321 PRO O O N N 322 PRO CB C N N 323 PRO CG C N N 324 PRO CD C N N 325 PRO OXT O N N 326 PRO H H N N 327 PRO HA H N N 328 PRO HB2 H N N 329 PRO HB3 H N N 330 PRO HG2 H N N 331 PRO HG3 H N N 332 PRO HD2 H N N 333 PRO HD3 H N N 334 PRO HXT H N N 335 SER N N N N 336 SER CA C N S 337 SER C C N N 338 SER O O N N 339 SER CB C N N 340 SER OG O N N 341 SER OXT O N N 342 SER H H N N 343 SER H2 H N N 344 SER HA H N N 345 SER HB2 H N N 346 SER HB3 H N N 347 SER HG H N N 348 SER HXT H N N 349 THR N N N N 350 THR CA C N S 351 THR C C N N 352 THR O O N N 353 THR CB C N R 354 THR OG1 O N N 355 THR CG2 C N N 356 THR OXT O N N 357 THR H H N N 358 THR H2 H N N 359 THR HA H N N 360 THR HB H N N 361 THR HG1 H N N 362 THR HG21 H N N 363 THR HG22 H N N 364 THR HG23 H N N 365 THR HXT H N N 366 TRP N N N N 367 TRP CA C N S 368 TRP C C N N 369 TRP O O N N 370 TRP CB C N N 371 TRP CG C Y N 372 TRP CD1 C Y N 373 TRP CD2 C Y N 374 TRP NE1 N Y N 375 TRP CE2 C Y N 376 TRP CE3 C Y N 377 TRP CZ2 C Y N 378 TRP CZ3 C Y N 379 TRP CH2 C Y N 380 TRP OXT O N N 381 TRP H H N N 382 TRP H2 H N N 383 TRP HA H N N 384 TRP HB2 H N N 385 TRP HB3 H N N 386 TRP HD1 H N N 387 TRP HE1 H N N 388 TRP HE3 H N N 389 TRP HZ2 H N N 390 TRP HZ3 H N N 391 TRP HH2 H N N 392 TRP HXT H N N 393 TYR N N N N 394 TYR CA C N S 395 TYR C C N N 396 TYR O O N N 397 TYR CB C N N 398 TYR CG C Y N 399 TYR CD1 C Y N 400 TYR CD2 C Y N 401 TYR CE1 C Y N 402 TYR CE2 C Y N 403 TYR CZ C Y N 404 TYR OH O N N 405 TYR OXT O N N 406 TYR H H N N 407 TYR H2 H N N 408 TYR HA H N N 409 TYR HB2 H N N 410 TYR HB3 H N N 411 TYR HD1 H N N 412 TYR HD2 H N N 413 TYR HE1 H N N 414 TYR HE2 H N N 415 TYR HH H N N 416 TYR HXT H N N 417 VAL N N N N 418 VAL CA C N S 419 VAL C C N N 420 VAL O O N N 421 VAL CB C N N 422 VAL CG1 C N N 423 VAL CG2 C N N 424 VAL OXT O N N 425 VAL H H N N 426 VAL H2 H N N 427 VAL HA H N N 428 VAL HB H N N 429 VAL HG11 H N N 430 VAL HG12 H N N 431 VAL HG13 H N N 432 VAL HG21 H N N 433 VAL HG22 H N N 434 VAL HG23 H N N 435 VAL HXT H N N 436 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 APR N1 C2 sing Y N 13 APR N1 C6 doub Y N 14 APR C2 N3 doub Y N 15 APR C2 H2 sing N N 16 APR N3 C4 sing Y N 17 APR C4 C5 doub Y N 18 APR C4 N9 sing Y N 19 APR C5 C6 sing Y N 20 APR C5 N7 sing Y N 21 APR C6 N6 sing N N 22 APR N6 H61 sing N N 23 APR N6 H62 sing N N 24 APR N7 C8 doub Y N 25 APR C8 N9 sing Y N 26 APR C8 H8 sing N N 27 APR N9 "C1'" sing N N 28 APR "C1'" "C2'" sing N N 29 APR "C1'" "O4'" sing N N 30 APR "C1'" "H'1" sing N N 31 APR "C2'" "O2'" sing N N 32 APR "C2'" "C3'" sing N N 33 APR "C2'" "H'2" sing N N 34 APR "O2'" "HO'2" sing N N 35 APR "C3'" "O3'" sing N N 36 APR "C3'" "C4'" sing N N 37 APR "C3'" "H'3" sing N N 38 APR "O3'" "HO'3" sing N N 39 APR "O4'" "C4'" sing N N 40 APR "C4'" "C5'" sing N N 41 APR "C4'" "H'4" sing N N 42 APR "C5'" "O5'" sing N N 43 APR "C5'" "H5'1" sing N N 44 APR "C5'" "H5'2" sing N N 45 APR "O5'" PA sing N N 46 APR PA O1A doub N N 47 APR PA O2A sing N N 48 APR PA O3A sing N N 49 APR O2A HOA2 sing N N 50 APR O3A PB sing N N 51 APR PB O1B doub N N 52 APR PB O2B sing N N 53 APR PB O5D sing N N 54 APR O2B HOB2 sing N N 55 APR O5D C5D sing N N 56 APR C5D C4D sing N N 57 APR C5D H5R1 sing N N 58 APR C5D H5R2 sing N N 59 APR O4D C1D sing N N 60 APR O4D C4D sing N N 61 APR O1D C1D sing N N 62 APR O1D HOR1 sing N N 63 APR C1D C2D sing N N 64 APR C1D "HR'1" sing N N 65 APR O2D C2D sing N N 66 APR O2D HOR2 sing N N 67 APR C2D C3D sing N N 68 APR C2D "HR'2" sing N N 69 APR O3D C3D sing N N 70 APR O3D HOR3 sing N N 71 APR C3D C4D sing N N 72 APR C3D "HR'3" sing N N 73 APR C4D "HR'4" sing N N 74 ARG N CA sing N N 75 ARG N H sing N N 76 ARG N H2 sing N N 77 ARG CA C sing N N 78 ARG CA CB sing N N 79 ARG CA HA sing N N 80 ARG C O doub N N 81 ARG C OXT sing N N 82 ARG CB CG sing N N 83 ARG CB HB2 sing N N 84 ARG CB HB3 sing N N 85 ARG CG CD sing N N 86 ARG CG HG2 sing N N 87 ARG CG HG3 sing N N 88 ARG CD NE sing N N 89 ARG CD HD2 sing N N 90 ARG CD HD3 sing N N 91 ARG NE CZ sing N N 92 ARG NE HE sing N N 93 ARG CZ NH1 sing N N 94 ARG CZ NH2 doub N N 95 ARG NH1 HH11 sing N N 96 ARG NH1 HH12 sing N N 97 ARG NH2 HH21 sing N N 98 ARG NH2 HH22 sing N N 99 ARG OXT HXT sing N N 100 ASN N CA sing N N 101 ASN N H sing N N 102 ASN N H2 sing N N 103 ASN CA C sing N N 104 ASN CA CB sing N N 105 ASN CA HA sing N N 106 ASN C O doub N N 107 ASN C OXT sing N N 108 ASN CB CG sing N N 109 ASN CB HB2 sing N N 110 ASN CB HB3 sing N N 111 ASN CG OD1 doub N N 112 ASN CG ND2 sing N N 113 ASN ND2 HD21 sing N N 114 ASN ND2 HD22 sing N N 115 ASN OXT HXT sing N N 116 ASP N CA sing N N 117 ASP N H sing N N 118 ASP N H2 sing N N 119 ASP CA C sing N N 120 ASP CA CB sing N N 121 ASP CA HA sing N N 122 ASP C O doub N N 123 ASP C OXT sing N N 124 ASP CB CG sing N N 125 ASP CB HB2 sing N N 126 ASP CB HB3 sing N N 127 ASP CG OD1 doub N N 128 ASP CG OD2 sing N N 129 ASP OD2 HD2 sing N N 130 ASP OXT HXT sing N N 131 GLN N CA sing N N 132 GLN N H sing N N 133 GLN N H2 sing N N 134 GLN CA C sing N N 135 GLN CA CB sing N N 136 GLN CA HA sing N N 137 GLN C O doub N N 138 GLN C OXT sing N N 139 GLN CB CG sing N N 140 GLN CB HB2 sing N N 141 GLN CB HB3 sing N N 142 GLN CG CD sing N N 143 GLN CG HG2 sing N N 144 GLN CG HG3 sing N N 145 GLN CD OE1 doub N N 146 GLN CD NE2 sing N N 147 GLN NE2 HE21 sing N N 148 GLN NE2 HE22 sing N N 149 GLN OXT HXT sing N N 150 GLU N CA sing N N 151 GLU N H sing N N 152 GLU N H2 sing N N 153 GLU CA C sing N N 154 GLU CA CB sing N N 155 GLU CA HA sing N N 156 GLU C O doub N N 157 GLU C OXT sing N N 158 GLU CB CG sing N N 159 GLU CB HB2 sing N N 160 GLU CB HB3 sing N N 161 GLU CG CD sing N N 162 GLU CG HG2 sing N N 163 GLU CG HG3 sing N N 164 GLU CD OE1 doub N N 165 GLU CD OE2 sing N N 166 GLU OE2 HE2 sing N N 167 GLU OXT HXT sing N N 168 GLY N CA sing N N 169 GLY N H sing N N 170 GLY N H2 sing N N 171 GLY CA C sing N N 172 GLY CA HA2 sing N N 173 GLY CA HA3 sing N N 174 GLY C O doub N N 175 GLY C OXT sing N N 176 GLY OXT HXT sing N N 177 HIS N CA sing N N 178 HIS N H sing N N 179 HIS N H2 sing N N 180 HIS CA C sing N N 181 HIS CA CB sing N N 182 HIS CA HA sing N N 183 HIS C O doub N N 184 HIS C OXT sing N N 185 HIS CB CG sing N N 186 HIS CB HB2 sing N N 187 HIS CB HB3 sing N N 188 HIS CG ND1 sing Y N 189 HIS CG CD2 doub Y N 190 HIS ND1 CE1 doub Y N 191 HIS ND1 HD1 sing N N 192 HIS CD2 NE2 sing Y N 193 HIS CD2 HD2 sing N N 194 HIS CE1 NE2 sing Y N 195 HIS CE1 HE1 sing N N 196 HIS NE2 HE2 sing N N 197 HIS OXT HXT sing N N 198 HOH O H1 sing N N 199 HOH O H2 sing N N 200 ILE N CA sing N N 201 ILE N H sing N N 202 ILE N H2 sing N N 203 ILE CA C sing N N 204 ILE CA CB sing N N 205 ILE CA HA sing N N 206 ILE C O doub N N 207 ILE C OXT sing N N 208 ILE CB CG1 sing N N 209 ILE CB CG2 sing N N 210 ILE CB HB sing N N 211 ILE CG1 CD1 sing N N 212 ILE CG1 HG12 sing N N 213 ILE CG1 HG13 sing N N 214 ILE CG2 HG21 sing N N 215 ILE CG2 HG22 sing N N 216 ILE CG2 HG23 sing N N 217 ILE CD1 HD11 sing N N 218 ILE CD1 HD12 sing N N 219 ILE CD1 HD13 sing N N 220 ILE OXT HXT sing N N 221 LEU N CA sing N N 222 LEU N H sing N N 223 LEU N H2 sing N N 224 LEU CA C sing N N 225 LEU CA CB sing N N 226 LEU CA HA sing N N 227 LEU C O doub N N 228 LEU C OXT sing N N 229 LEU CB CG sing N N 230 LEU CB HB2 sing N N 231 LEU CB HB3 sing N N 232 LEU CG CD1 sing N N 233 LEU CG CD2 sing N N 234 LEU CG HG sing N N 235 LEU CD1 HD11 sing N N 236 LEU CD1 HD12 sing N N 237 LEU CD1 HD13 sing N N 238 LEU CD2 HD21 sing N N 239 LEU CD2 HD22 sing N N 240 LEU CD2 HD23 sing N N 241 LEU OXT HXT sing N N 242 LYS N CA sing N N 243 LYS N H sing N N 244 LYS N H2 sing N N 245 LYS CA C sing N N 246 LYS CA CB sing N N 247 LYS CA HA sing N N 248 LYS C O doub N N 249 LYS C OXT sing N N 250 LYS CB CG sing N N 251 LYS CB HB2 sing N N 252 LYS CB HB3 sing N N 253 LYS CG CD sing N N 254 LYS CG HG2 sing N N 255 LYS CG HG3 sing N N 256 LYS CD CE sing N N 257 LYS CD HD2 sing N N 258 LYS CD HD3 sing N N 259 LYS CE NZ sing N N 260 LYS CE HE2 sing N N 261 LYS CE HE3 sing N N 262 LYS NZ HZ1 sing N N 263 LYS NZ HZ2 sing N N 264 LYS NZ HZ3 sing N N 265 LYS OXT HXT sing N N 266 MET N CA sing N N 267 MET N H sing N N 268 MET N H2 sing N N 269 MET CA C sing N N 270 MET CA CB sing N N 271 MET CA HA sing N N 272 MET C O doub N N 273 MET C OXT sing N N 274 MET CB CG sing N N 275 MET CB HB2 sing N N 276 MET CB HB3 sing N N 277 MET CG SD sing N N 278 MET CG HG2 sing N N 279 MET CG HG3 sing N N 280 MET SD CE sing N N 281 MET CE HE1 sing N N 282 MET CE HE2 sing N N 283 MET CE HE3 sing N N 284 MET OXT HXT sing N N 285 PHE N CA sing N N 286 PHE N H sing N N 287 PHE N H2 sing N N 288 PHE CA C sing N N 289 PHE CA CB sing N N 290 PHE CA HA sing N N 291 PHE C O doub N N 292 PHE C OXT sing N N 293 PHE CB CG sing N N 294 PHE CB HB2 sing N N 295 PHE CB HB3 sing N N 296 PHE CG CD1 doub Y N 297 PHE CG CD2 sing Y N 298 PHE CD1 CE1 sing Y N 299 PHE CD1 HD1 sing N N 300 PHE CD2 CE2 doub Y N 301 PHE CD2 HD2 sing N N 302 PHE CE1 CZ doub Y N 303 PHE CE1 HE1 sing N N 304 PHE CE2 CZ sing Y N 305 PHE CE2 HE2 sing N N 306 PHE CZ HZ sing N N 307 PHE OXT HXT sing N N 308 PRO N CA sing N N 309 PRO N CD sing N N 310 PRO N H sing N N 311 PRO CA C sing N N 312 PRO CA CB sing N N 313 PRO CA HA sing N N 314 PRO C O doub N N 315 PRO C OXT sing N N 316 PRO CB CG sing N N 317 PRO CB HB2 sing N N 318 PRO CB HB3 sing N N 319 PRO CG CD sing N N 320 PRO CG HG2 sing N N 321 PRO CG HG3 sing N N 322 PRO CD HD2 sing N N 323 PRO CD HD3 sing N N 324 PRO OXT HXT sing N N 325 SER N CA sing N N 326 SER N H sing N N 327 SER N H2 sing N N 328 SER CA C sing N N 329 SER CA CB sing N N 330 SER CA HA sing N N 331 SER C O doub N N 332 SER C OXT sing N N 333 SER CB OG sing N N 334 SER CB HB2 sing N N 335 SER CB HB3 sing N N 336 SER OG HG sing N N 337 SER OXT HXT sing N N 338 THR N CA sing N N 339 THR N H sing N N 340 THR N H2 sing N N 341 THR CA C sing N N 342 THR CA CB sing N N 343 THR CA HA sing N N 344 THR C O doub N N 345 THR C OXT sing N N 346 THR CB OG1 sing N N 347 THR CB CG2 sing N N 348 THR CB HB sing N N 349 THR OG1 HG1 sing N N 350 THR CG2 HG21 sing N N 351 THR CG2 HG22 sing N N 352 THR CG2 HG23 sing N N 353 THR OXT HXT sing N N 354 TRP N CA sing N N 355 TRP N H sing N N 356 TRP N H2 sing N N 357 TRP CA C sing N N 358 TRP CA CB sing N N 359 TRP CA HA sing N N 360 TRP C O doub N N 361 TRP C OXT sing N N 362 TRP CB CG sing N N 363 TRP CB HB2 sing N N 364 TRP CB HB3 sing N N 365 TRP CG CD1 doub Y N 366 TRP CG CD2 sing Y N 367 TRP CD1 NE1 sing Y N 368 TRP CD1 HD1 sing N N 369 TRP CD2 CE2 doub Y N 370 TRP CD2 CE3 sing Y N 371 TRP NE1 CE2 sing Y N 372 TRP NE1 HE1 sing N N 373 TRP CE2 CZ2 sing Y N 374 TRP CE3 CZ3 doub Y N 375 TRP CE3 HE3 sing N N 376 TRP CZ2 CH2 doub Y N 377 TRP CZ2 HZ2 sing N N 378 TRP CZ3 CH2 sing Y N 379 TRP CZ3 HZ3 sing N N 380 TRP CH2 HH2 sing N N 381 TRP OXT HXT sing N N 382 TYR N CA sing N N 383 TYR N H sing N N 384 TYR N H2 sing N N 385 TYR CA C sing N N 386 TYR CA CB sing N N 387 TYR CA HA sing N N 388 TYR C O doub N N 389 TYR C OXT sing N N 390 TYR CB CG sing N N 391 TYR CB HB2 sing N N 392 TYR CB HB3 sing N N 393 TYR CG CD1 doub Y N 394 TYR CG CD2 sing Y N 395 TYR CD1 CE1 sing Y N 396 TYR CD1 HD1 sing N N 397 TYR CD2 CE2 doub Y N 398 TYR CD2 HD2 sing N N 399 TYR CE1 CZ doub Y N 400 TYR CE1 HE1 sing N N 401 TYR CE2 CZ sing Y N 402 TYR CE2 HE2 sing N N 403 TYR CZ OH sing N N 404 TYR OH HH sing N N 405 TYR OXT HXT sing N N 406 VAL N CA sing N N 407 VAL N H sing N N 408 VAL N H2 sing N N 409 VAL CA C sing N N 410 VAL CA CB sing N N 411 VAL CA HA sing N N 412 VAL C O doub N N 413 VAL C OXT sing N N 414 VAL CB CG1 sing N N 415 VAL CB CG2 sing N N 416 VAL CB HB sing N N 417 VAL CG1 HG11 sing N N 418 VAL CG1 HG12 sing N N 419 VAL CG1 HG13 sing N N 420 VAL CG2 HG21 sing N N 421 VAL CG2 HG22 sing N N 422 VAL CG2 HG23 sing N N 423 VAL OXT HXT sing N N 424 # _atom_sites.entry_id 1V8M _atom_sites.fract_transf_matrix[1][1] .020157 _atom_sites.fract_transf_matrix[1][2] .011638 _atom_sites.fract_transf_matrix[1][3] .000000 _atom_sites.fract_transf_matrix[2][1] .000000 _atom_sites.fract_transf_matrix[2][2] .023276 _atom_sites.fract_transf_matrix[2][3] .000000 _atom_sites.fract_transf_matrix[3][1] .000000 _atom_sites.fract_transf_matrix[3][2] .000000 _atom_sites.fract_transf_matrix[3][3] .008342 _atom_sites.fract_transf_vector[1] .00000 _atom_sites.fract_transf_vector[2] .00000 _atom_sites.fract_transf_vector[3] .00000 # loop_ _atom_type.symbol C GD N O P S # loop_