data_1VA1
# 
_entry.id   1VA1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.383 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1VA1         pdb_00001va1 10.2210/pdb1va1/pdb 
RCSB  RCSB006394   ?            ?                   
WWPDB D_1000006394 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-02-08 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-03-02 
5 'Structure model' 1 4 2023-12-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
5 5 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2            
2 4 'Structure model' pdbx_struct_assembly  
3 4 'Structure model' pdbx_struct_oper_list 
4 4 'Structure model' struct_ref_seq_dif    
5 4 'Structure model' struct_site           
6 5 'Structure model' chem_comp_atom        
7 5 'Structure model' chem_comp_bond        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_ref_seq_dif.details'         
4 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
5 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
6 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1VA1 
_pdbx_database_status.recvd_initial_deposition_date   2004-02-07 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1VA2 'The same protein, Zinc Finger 2 domain' unspecified 
PDB 1VA3 'The same protein, Zinc Finger 3 domain' unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Oka, S.'       1 
'Shiraishi, Y.' 2 
'Yoshida, T.'   3 
'Ohkubo, T.'    4 
'Sugiura, Y.'   5 
'Kobayashi, Y.' 6 
# 
_citation.id                        primary 
_citation.title                     'NMR structure of transcription factor Sp1 DNA binding domain' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            43 
_citation.page_first                16027 
_citation.page_last                 16035 
_citation.year                      2004 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15609997 
_citation.pdbx_database_id_DOI      10.1021/bi048438p 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Oka, S.'       1 ? 
primary 'Shiraishi, Y.' 2 ? 
primary 'Yoshida, T.'   3 ? 
primary 'Ohkubo, T.'    4 ? 
primary 'Sugiura, Y.'   5 ? 
primary 'Kobayashi, Y.' 6 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Transcription factor Sp1' 4308.053 1 ? ? 'Zinc finger 1' ? 
2 non-polymer syn 'ZINC ION'                 65.409   1 ? ? ?               ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGER 
_entity_poly.pdbx_seq_one_letter_code_can   MDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGER 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'ZINC ION' 
_pdbx_entity_nonpoly.comp_id     ZN 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ASP n 
1 3  PRO n 
1 4  GLY n 
1 5  LYS n 
1 6  LYS n 
1 7  LYS n 
1 8  GLN n 
1 9  HIS n 
1 10 ILE n 
1 11 CYS n 
1 12 HIS n 
1 13 ILE n 
1 14 GLN n 
1 15 GLY n 
1 16 CYS n 
1 17 GLY n 
1 18 LYS n 
1 19 VAL n 
1 20 TYR n 
1 21 GLY n 
1 22 LYS n 
1 23 THR n 
1 24 SER n 
1 25 HIS n 
1 26 LEU n 
1 27 ARG n 
1 28 ALA n 
1 29 HIS n 
1 30 LEU n 
1 31 ARG n 
1 32 TRP n 
1 33 HIS n 
1 34 THR n 
1 35 GLY n 
1 36 GLU n 
1 37 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 SP1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pEVSp1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1   1   MET MET A . n 
A 1 2  ASP 2  530 530 ASP ASP A . n 
A 1 3  PRO 3  531 531 PRO PRO A . n 
A 1 4  GLY 4  532 532 GLY GLY A . n 
A 1 5  LYS 5  533 533 LYS LYS A . n 
A 1 6  LYS 6  534 534 LYS LYS A . n 
A 1 7  LYS 7  535 535 LYS LYS A . n 
A 1 8  GLN 8  536 536 GLN GLN A . n 
A 1 9  HIS 9  537 537 HIS HIS A . n 
A 1 10 ILE 10 538 538 ILE ILE A . n 
A 1 11 CYS 11 539 539 CYS CYS A . n 
A 1 12 HIS 12 540 540 HIS HIS A . n 
A 1 13 ILE 13 541 541 ILE ILE A . n 
A 1 14 GLN 14 542 542 GLN GLN A . n 
A 1 15 GLY 15 543 543 GLY GLY A . n 
A 1 16 CYS 16 544 544 CYS CYS A . n 
A 1 17 GLY 17 545 545 GLY GLY A . n 
A 1 18 LYS 18 546 546 LYS LYS A . n 
A 1 19 VAL 19 547 547 VAL VAL A . n 
A 1 20 TYR 20 548 548 TYR TYR A . n 
A 1 21 GLY 21 549 549 GLY GLY A . n 
A 1 22 LYS 22 550 550 LYS LYS A . n 
A 1 23 THR 23 551 551 THR THR A . n 
A 1 24 SER 24 552 552 SER SER A . n 
A 1 25 HIS 25 553 553 HIS HIS A . n 
A 1 26 LEU 26 554 554 LEU LEU A . n 
A 1 27 ARG 27 555 555 ARG ARG A . n 
A 1 28 ALA 28 556 556 ALA ALA A . n 
A 1 29 HIS 29 557 557 HIS HIS A . n 
A 1 30 LEU 30 558 558 LEU LEU A . n 
A 1 31 ARG 31 559 559 ARG ARG A . n 
A 1 32 TRP 32 560 560 TRP TRP A . n 
A 1 33 HIS 33 561 561 HIS HIS A . n 
A 1 34 THR 34 562 562 THR THR A . n 
A 1 35 GLY 35 563 563 GLY GLY A . n 
A 1 36 GLU 36 564 564 GLU GLU A . n 
A 1 37 ARG 37 565 565 ARG ARG A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          ZN 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     100 
_pdbx_nonpoly_scheme.auth_seq_num    100 
_pdbx_nonpoly_scheme.pdb_mon_id      ZN 
_pdbx_nonpoly_scheme.auth_mon_id     ZN 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_exptl.entry_id          1VA1 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_database_PDB_matrix.entry_id          1VA1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1VA1 
_struct.title                     'Solution Structure of Transcription Factor Sp1 DNA Binding Domain (Zinc Finger 1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   'minimized average' 
# 
_struct_keywords.entry_id        1VA1 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'C2H2 type Zinc finger, Transcription Factor, DNA-Binding Protein, TRANSCRIPTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SP1_HUMAN 
_struct_ref.pdbx_db_accession          P08047 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   DPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGER 
_struct_ref.pdbx_align_begin           619 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1VA1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 37 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P08047 
_struct_ref_seq.db_align_beg                  619 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  654 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       530 
_struct_ref_seq.pdbx_auth_seq_align_end       565 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1VA1 
_struct_ref_seq_dif.mon_id                       MET 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P08047 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'initiating methionine' 
_struct_ref_seq_dif.pdbx_auth_seq_num            1 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       LYS 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        22 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       GLY 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        35 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        LYS 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         550 
_struct_conf.end_auth_comp_id        GLY 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         563 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 11 SG  ? ? A ZN 100 A CYS 539 1_555 ? ? ? ? ? ? ? 2.300 ? ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 16 SG  ? ? A ZN 100 A CYS 544 1_555 ? ? ? ? ? ? ? 2.308 ? ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 29 NE2 ? ? A ZN 100 A HIS 557 1_555 ? ? ? ? ? ? ? 2.011 ? ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 33 NE2 ? ? A ZN 100 A HIS 561 1_555 ? ? ? ? ? ? ? 2.016 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG  ? A CYS 11 ? A CYS 539 ? 1_555 ZN ? B ZN . ? A ZN 100 ? 1_555 SG  ? A CYS 16 ? A CYS 544 ? 1_555 121.8 ? 
2 SG  ? A CYS 11 ? A CYS 539 ? 1_555 ZN ? B ZN . ? A ZN 100 ? 1_555 NE2 ? A HIS 29 ? A HIS 557 ? 1_555 89.5  ? 
3 SG  ? A CYS 16 ? A CYS 544 ? 1_555 ZN ? B ZN . ? A ZN 100 ? 1_555 NE2 ? A HIS 29 ? A HIS 557 ? 1_555 129.2 ? 
4 SG  ? A CYS 11 ? A CYS 539 ? 1_555 ZN ? B ZN . ? A ZN 100 ? 1_555 NE2 ? A HIS 33 ? A HIS 561 ? 1_555 88.9  ? 
5 SG  ? A CYS 16 ? A CYS 544 ? 1_555 ZN ? B ZN . ? A ZN 100 ? 1_555 NE2 ? A HIS 33 ? A HIS 561 ? 1_555 120.9 ? 
6 NE2 ? A HIS 29 ? A HIS 557 ? 1_555 ZN ? B ZN . ? A ZN 100 ? 1_555 NE2 ? A HIS 33 ? A HIS 561 ? 1_555 95.9  ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS A 9  ? ILE A 10 ? HIS A 537 ILE A 538 
A 2 VAL A 19 ? TYR A 20 ? VAL A 547 TYR A 548 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   HIS 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    9 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    HIS 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     537 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   TYR 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    20 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    TYR 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     548 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    ZN 
_struct_site.pdbx_auth_seq_id     100 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 100' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 11 ? CYS A 539 . ? 1_555 ? 
2 AC1 4 CYS A 16 ? CYS A 544 . ? 1_555 ? 
3 AC1 4 HIS A 29 ? HIS A 557 . ? 1_555 ? 
4 AC1 4 HIS A 33 ? HIS A 561 . ? 1_555 ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  CYS A 539 ? ? -66.11  96.25   
2  2  LYS A 535 ? ? 60.64   158.22  
3  2  HIS A 540 ? ? -97.61  30.55   
4  2  GLN A 542 ? ? -62.58  83.07   
5  2  LYS A 546 ? ? -100.10 -164.98 
6  2  THR A 562 ? ? -97.31  36.33   
7  3  GLN A 536 ? ? 60.07   -178.65 
8  3  CYS A 539 ? ? -65.31  91.43   
9  3  GLU A 564 ? ? -146.58 -48.35  
10 4  PRO A 531 ? ? -50.90  98.74   
11 4  HIS A 540 ? ? -115.96 51.03   
12 4  CYS A 544 ? ? -68.75  -174.97 
13 5  CYS A 544 ? ? -107.79 -168.94 
14 5  THR A 562 ? ? -97.78  30.62   
15 5  GLU A 564 ? ? 63.02   -79.32  
16 6  LYS A 535 ? ? 62.53   157.37  
17 6  GLN A 536 ? ? 63.26   126.04  
18 6  HIS A 540 ? ? -96.80  33.87   
19 6  GLU A 564 ? ? -146.24 -47.35  
20 7  LYS A 535 ? ? 60.07   -178.53 
21 7  CYS A 539 ? ? -59.91  86.29   
22 8  CYS A 539 ? ? -68.90  97.02   
23 9  LYS A 546 ? ? -67.92  -172.42 
24 10 LYS A 535 ? ? 43.48   92.25   
25 11 LYS A 535 ? ? 60.64   158.22  
26 11 HIS A 540 ? ? -97.61  30.55   
27 11 GLN A 542 ? ? -62.58  83.07   
28 11 LYS A 546 ? ? -100.10 -164.98 
29 11 THR A 562 ? ? -97.31  36.33   
30 12 GLN A 542 ? ? -58.89  89.35   
31 12 VAL A 547 ? ? 57.12   87.00   
32 12 GLU A 564 ? ? -161.58 32.32   
33 13 GLN A 536 ? ? -172.91 131.02  
34 13 CYS A 539 ? ? -62.14  98.49   
35 13 CYS A 544 ? ? -115.79 -165.72 
36 13 VAL A 547 ? ? 53.71   86.53   
37 14 HIS A 540 ? ? -96.65  35.96   
38 15 CYS A 539 ? ? -64.04  93.15   
39 15 CYS A 544 ? ? -110.70 -168.16 
40 15 LYS A 546 ? ? -60.76  -171.45 
41 15 THR A 562 ? ? 56.06   -178.28 
42 16 ASP A 530 ? ? 60.60   98.91   
43 16 CYS A 544 ? ? -119.08 -165.16 
44 17 CYS A 544 ? ? -64.91  -167.03 
45 17 VAL A 547 ? ? 54.17   82.96   
46 17 GLU A 564 ? ? 60.11   165.14  
47 18 PRO A 531 ? ? -51.87  108.32  
48 18 GLU A 564 ? ? -155.83 -45.95  
49 19 CYS A 544 ? ? -64.98  -166.01 
50 19 VAL A 547 ? ? 57.04   99.31   
51 20 HIS A 540 ? ? -95.88  40.87   
52 20 GLN A 542 ? ? 62.23   -80.93  
53 20 CYS A 544 ? ? -62.67  -166.88 
54 20 GLU A 564 ? ? -137.36 -49.86  
55 21 LYS A 535 ? ? 58.27   169.66  
56 21 HIS A 540 ? ? -95.04  30.41   
57 21 GLN A 542 ? ? -62.02  84.63   
58 21 THR A 562 ? ? 56.67   -83.38  
59 21 GLU A 564 ? ? 60.07   98.52   
60 22 GLN A 542 ? ? -92.14  36.52   
61 22 CYS A 544 ? ? -111.06 -169.82 
62 22 THR A 562 ? ? 55.00   -85.25  
63 22 GLU A 564 ? ? 60.51   173.67  
64 23 VAL A 547 ? ? 48.35   88.91   
65 24 HIS A 540 ? ? -97.57  32.92   
66 24 GLN A 542 ? ? 59.47   -83.68  
67 24 CYS A 544 ? ? -64.01  -169.05 
68 24 VAL A 547 ? ? 49.76   96.23   
69 25 LYS A 535 ? ? 60.36   171.74  
70 26 ASP A 530 ? ? 60.60   93.42   
71 26 PRO A 531 ? ? -50.27  171.62  
72 26 GLU A 564 ? ? -130.50 -57.77  
73 28 GLN A 542 ? ? -68.00  73.62   
74 28 THR A 562 ? ? 52.68   -172.17 
75 28 GLU A 564 ? ? 63.83   131.93  
76 29 LYS A 535 ? ? 60.24   103.15  
77 29 CYS A 539 ? ? -69.69  99.53   
78 29 GLN A 542 ? ? -59.73  92.41   
79 29 THR A 562 ? ? 50.99   172.74  
80 30 GLN A 536 ? ? 59.93   164.39  
81 30 CYS A 539 ? ? -64.19  94.54   
82 30 CYS A 544 ? ? -112.94 -167.13 
83 31 PRO A 531 ? ? -51.06  -177.81 
84 31 LYS A 535 ? ? -57.36  -108.58 
85 31 GLN A 536 ? ? 85.40   113.25  
86 31 CYS A 539 ? ? -52.94  101.45  
87 31 CYS A 544 ? ? -67.07  -167.70 
88 31 THR A 562 ? ? -59.05  100.36  
# 
_pdbx_nmr_ensemble.entry_id                                      1VA1 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             31 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1VA1 
_pdbx_nmr_representative.conformer_id         31 
_pdbx_nmr_representative.selection_criteria   'minimized average structure' 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1mM Sp1 DNA-Binding Domain U-15N/13C; 10mM Tris-d; 50mM NaCl; 1mM DTT' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  7.4 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '10mM Tris-d, 50mM NaCl' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_details.entry_id   1VA1 
_pdbx_nmr_details.text       'The structure was determined using triple-resonance NMR spectroscopy.' 
# 
_pdbx_nmr_refine.entry_id           1VA1 
_pdbx_nmr_refine.method             'torsion angle dynamics, simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
CNS     1.1   'structure solution' ?                     1 
NMRPipe 2.1   processing           'F. Delaglio, et al.' 2 
NMRView 5.0.4 'data analysis'      'Bruce A. Johnson'    3 
CNS     1.1   refinement           ?                     4 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASP N    N  N N 41  
ASP CA   C  N S 42  
ASP C    C  N N 43  
ASP O    O  N N 44  
ASP CB   C  N N 45  
ASP CG   C  N N 46  
ASP OD1  O  N N 47  
ASP OD2  O  N N 48  
ASP OXT  O  N N 49  
ASP H    H  N N 50  
ASP H2   H  N N 51  
ASP HA   H  N N 52  
ASP HB2  H  N N 53  
ASP HB3  H  N N 54  
ASP HD2  H  N N 55  
ASP HXT  H  N N 56  
CYS N    N  N N 57  
CYS CA   C  N R 58  
CYS C    C  N N 59  
CYS O    O  N N 60  
CYS CB   C  N N 61  
CYS SG   S  N N 62  
CYS OXT  O  N N 63  
CYS H    H  N N 64  
CYS H2   H  N N 65  
CYS HA   H  N N 66  
CYS HB2  H  N N 67  
CYS HB3  H  N N 68  
CYS HG   H  N N 69  
CYS HXT  H  N N 70  
GLN N    N  N N 71  
GLN CA   C  N S 72  
GLN C    C  N N 73  
GLN O    O  N N 74  
GLN CB   C  N N 75  
GLN CG   C  N N 76  
GLN CD   C  N N 77  
GLN OE1  O  N N 78  
GLN NE2  N  N N 79  
GLN OXT  O  N N 80  
GLN H    H  N N 81  
GLN H2   H  N N 82  
GLN HA   H  N N 83  
GLN HB2  H  N N 84  
GLN HB3  H  N N 85  
GLN HG2  H  N N 86  
GLN HG3  H  N N 87  
GLN HE21 H  N N 88  
GLN HE22 H  N N 89  
GLN HXT  H  N N 90  
GLU N    N  N N 91  
GLU CA   C  N S 92  
GLU C    C  N N 93  
GLU O    O  N N 94  
GLU CB   C  N N 95  
GLU CG   C  N N 96  
GLU CD   C  N N 97  
GLU OE1  O  N N 98  
GLU OE2  O  N N 99  
GLU OXT  O  N N 100 
GLU H    H  N N 101 
GLU H2   H  N N 102 
GLU HA   H  N N 103 
GLU HB2  H  N N 104 
GLU HB3  H  N N 105 
GLU HG2  H  N N 106 
GLU HG3  H  N N 107 
GLU HE2  H  N N 108 
GLU HXT  H  N N 109 
GLY N    N  N N 110 
GLY CA   C  N N 111 
GLY C    C  N N 112 
GLY O    O  N N 113 
GLY OXT  O  N N 114 
GLY H    H  N N 115 
GLY H2   H  N N 116 
GLY HA2  H  N N 117 
GLY HA3  H  N N 118 
GLY HXT  H  N N 119 
HIS N    N  N N 120 
HIS CA   C  N S 121 
HIS C    C  N N 122 
HIS O    O  N N 123 
HIS CB   C  N N 124 
HIS CG   C  Y N 125 
HIS ND1  N  Y N 126 
HIS CD2  C  Y N 127 
HIS CE1  C  Y N 128 
HIS NE2  N  Y N 129 
HIS OXT  O  N N 130 
HIS H    H  N N 131 
HIS H2   H  N N 132 
HIS HA   H  N N 133 
HIS HB2  H  N N 134 
HIS HB3  H  N N 135 
HIS HD1  H  N N 136 
HIS HD2  H  N N 137 
HIS HE1  H  N N 138 
HIS HE2  H  N N 139 
HIS HXT  H  N N 140 
ILE N    N  N N 141 
ILE CA   C  N S 142 
ILE C    C  N N 143 
ILE O    O  N N 144 
ILE CB   C  N S 145 
ILE CG1  C  N N 146 
ILE CG2  C  N N 147 
ILE CD1  C  N N 148 
ILE OXT  O  N N 149 
ILE H    H  N N 150 
ILE H2   H  N N 151 
ILE HA   H  N N 152 
ILE HB   H  N N 153 
ILE HG12 H  N N 154 
ILE HG13 H  N N 155 
ILE HG21 H  N N 156 
ILE HG22 H  N N 157 
ILE HG23 H  N N 158 
ILE HD11 H  N N 159 
ILE HD12 H  N N 160 
ILE HD13 H  N N 161 
ILE HXT  H  N N 162 
LEU N    N  N N 163 
LEU CA   C  N S 164 
LEU C    C  N N 165 
LEU O    O  N N 166 
LEU CB   C  N N 167 
LEU CG   C  N N 168 
LEU CD1  C  N N 169 
LEU CD2  C  N N 170 
LEU OXT  O  N N 171 
LEU H    H  N N 172 
LEU H2   H  N N 173 
LEU HA   H  N N 174 
LEU HB2  H  N N 175 
LEU HB3  H  N N 176 
LEU HG   H  N N 177 
LEU HD11 H  N N 178 
LEU HD12 H  N N 179 
LEU HD13 H  N N 180 
LEU HD21 H  N N 181 
LEU HD22 H  N N 182 
LEU HD23 H  N N 183 
LEU HXT  H  N N 184 
LYS N    N  N N 185 
LYS CA   C  N S 186 
LYS C    C  N N 187 
LYS O    O  N N 188 
LYS CB   C  N N 189 
LYS CG   C  N N 190 
LYS CD   C  N N 191 
LYS CE   C  N N 192 
LYS NZ   N  N N 193 
LYS OXT  O  N N 194 
LYS H    H  N N 195 
LYS H2   H  N N 196 
LYS HA   H  N N 197 
LYS HB2  H  N N 198 
LYS HB3  H  N N 199 
LYS HG2  H  N N 200 
LYS HG3  H  N N 201 
LYS HD2  H  N N 202 
LYS HD3  H  N N 203 
LYS HE2  H  N N 204 
LYS HE3  H  N N 205 
LYS HZ1  H  N N 206 
LYS HZ2  H  N N 207 
LYS HZ3  H  N N 208 
LYS HXT  H  N N 209 
MET N    N  N N 210 
MET CA   C  N S 211 
MET C    C  N N 212 
MET O    O  N N 213 
MET CB   C  N N 214 
MET CG   C  N N 215 
MET SD   S  N N 216 
MET CE   C  N N 217 
MET OXT  O  N N 218 
MET H    H  N N 219 
MET H2   H  N N 220 
MET HA   H  N N 221 
MET HB2  H  N N 222 
MET HB3  H  N N 223 
MET HG2  H  N N 224 
MET HG3  H  N N 225 
MET HE1  H  N N 226 
MET HE2  H  N N 227 
MET HE3  H  N N 228 
MET HXT  H  N N 229 
PRO N    N  N N 230 
PRO CA   C  N S 231 
PRO C    C  N N 232 
PRO O    O  N N 233 
PRO CB   C  N N 234 
PRO CG   C  N N 235 
PRO CD   C  N N 236 
PRO OXT  O  N N 237 
PRO H    H  N N 238 
PRO HA   H  N N 239 
PRO HB2  H  N N 240 
PRO HB3  H  N N 241 
PRO HG2  H  N N 242 
PRO HG3  H  N N 243 
PRO HD2  H  N N 244 
PRO HD3  H  N N 245 
PRO HXT  H  N N 246 
SER N    N  N N 247 
SER CA   C  N S 248 
SER C    C  N N 249 
SER O    O  N N 250 
SER CB   C  N N 251 
SER OG   O  N N 252 
SER OXT  O  N N 253 
SER H    H  N N 254 
SER H2   H  N N 255 
SER HA   H  N N 256 
SER HB2  H  N N 257 
SER HB3  H  N N 258 
SER HG   H  N N 259 
SER HXT  H  N N 260 
THR N    N  N N 261 
THR CA   C  N S 262 
THR C    C  N N 263 
THR O    O  N N 264 
THR CB   C  N R 265 
THR OG1  O  N N 266 
THR CG2  C  N N 267 
THR OXT  O  N N 268 
THR H    H  N N 269 
THR H2   H  N N 270 
THR HA   H  N N 271 
THR HB   H  N N 272 
THR HG1  H  N N 273 
THR HG21 H  N N 274 
THR HG22 H  N N 275 
THR HG23 H  N N 276 
THR HXT  H  N N 277 
TRP N    N  N N 278 
TRP CA   C  N S 279 
TRP C    C  N N 280 
TRP O    O  N N 281 
TRP CB   C  N N 282 
TRP CG   C  Y N 283 
TRP CD1  C  Y N 284 
TRP CD2  C  Y N 285 
TRP NE1  N  Y N 286 
TRP CE2  C  Y N 287 
TRP CE3  C  Y N 288 
TRP CZ2  C  Y N 289 
TRP CZ3  C  Y N 290 
TRP CH2  C  Y N 291 
TRP OXT  O  N N 292 
TRP H    H  N N 293 
TRP H2   H  N N 294 
TRP HA   H  N N 295 
TRP HB2  H  N N 296 
TRP HB3  H  N N 297 
TRP HD1  H  N N 298 
TRP HE1  H  N N 299 
TRP HE3  H  N N 300 
TRP HZ2  H  N N 301 
TRP HZ3  H  N N 302 
TRP HH2  H  N N 303 
TRP HXT  H  N N 304 
TYR N    N  N N 305 
TYR CA   C  N S 306 
TYR C    C  N N 307 
TYR O    O  N N 308 
TYR CB   C  N N 309 
TYR CG   C  Y N 310 
TYR CD1  C  Y N 311 
TYR CD2  C  Y N 312 
TYR CE1  C  Y N 313 
TYR CE2  C  Y N 314 
TYR CZ   C  Y N 315 
TYR OH   O  N N 316 
TYR OXT  O  N N 317 
TYR H    H  N N 318 
TYR H2   H  N N 319 
TYR HA   H  N N 320 
TYR HB2  H  N N 321 
TYR HB3  H  N N 322 
TYR HD1  H  N N 323 
TYR HD2  H  N N 324 
TYR HE1  H  N N 325 
TYR HE2  H  N N 326 
TYR HH   H  N N 327 
TYR HXT  H  N N 328 
VAL N    N  N N 329 
VAL CA   C  N S 330 
VAL C    C  N N 331 
VAL O    O  N N 332 
VAL CB   C  N N 333 
VAL CG1  C  N N 334 
VAL CG2  C  N N 335 
VAL OXT  O  N N 336 
VAL H    H  N N 337 
VAL H2   H  N N 338 
VAL HA   H  N N 339 
VAL HB   H  N N 340 
VAL HG11 H  N N 341 
VAL HG12 H  N N 342 
VAL HG13 H  N N 343 
VAL HG21 H  N N 344 
VAL HG22 H  N N 345 
VAL HG23 H  N N 346 
VAL HXT  H  N N 347 
ZN  ZN   ZN N N 348 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASP N   CA   sing N N 39  
ASP N   H    sing N N 40  
ASP N   H2   sing N N 41  
ASP CA  C    sing N N 42  
ASP CA  CB   sing N N 43  
ASP CA  HA   sing N N 44  
ASP C   O    doub N N 45  
ASP C   OXT  sing N N 46  
ASP CB  CG   sing N N 47  
ASP CB  HB2  sing N N 48  
ASP CB  HB3  sing N N 49  
ASP CG  OD1  doub N N 50  
ASP CG  OD2  sing N N 51  
ASP OD2 HD2  sing N N 52  
ASP OXT HXT  sing N N 53  
CYS N   CA   sing N N 54  
CYS N   H    sing N N 55  
CYS N   H2   sing N N 56  
CYS CA  C    sing N N 57  
CYS CA  CB   sing N N 58  
CYS CA  HA   sing N N 59  
CYS C   O    doub N N 60  
CYS C   OXT  sing N N 61  
CYS CB  SG   sing N N 62  
CYS CB  HB2  sing N N 63  
CYS CB  HB3  sing N N 64  
CYS SG  HG   sing N N 65  
CYS OXT HXT  sing N N 66  
GLN N   CA   sing N N 67  
GLN N   H    sing N N 68  
GLN N   H2   sing N N 69  
GLN CA  C    sing N N 70  
GLN CA  CB   sing N N 71  
GLN CA  HA   sing N N 72  
GLN C   O    doub N N 73  
GLN C   OXT  sing N N 74  
GLN CB  CG   sing N N 75  
GLN CB  HB2  sing N N 76  
GLN CB  HB3  sing N N 77  
GLN CG  CD   sing N N 78  
GLN CG  HG2  sing N N 79  
GLN CG  HG3  sing N N 80  
GLN CD  OE1  doub N N 81  
GLN CD  NE2  sing N N 82  
GLN NE2 HE21 sing N N 83  
GLN NE2 HE22 sing N N 84  
GLN OXT HXT  sing N N 85  
GLU N   CA   sing N N 86  
GLU N   H    sing N N 87  
GLU N   H2   sing N N 88  
GLU CA  C    sing N N 89  
GLU CA  CB   sing N N 90  
GLU CA  HA   sing N N 91  
GLU C   O    doub N N 92  
GLU C   OXT  sing N N 93  
GLU CB  CG   sing N N 94  
GLU CB  HB2  sing N N 95  
GLU CB  HB3  sing N N 96  
GLU CG  CD   sing N N 97  
GLU CG  HG2  sing N N 98  
GLU CG  HG3  sing N N 99  
GLU CD  OE1  doub N N 100 
GLU CD  OE2  sing N N 101 
GLU OE2 HE2  sing N N 102 
GLU OXT HXT  sing N N 103 
GLY N   CA   sing N N 104 
GLY N   H    sing N N 105 
GLY N   H2   sing N N 106 
GLY CA  C    sing N N 107 
GLY CA  HA2  sing N N 108 
GLY CA  HA3  sing N N 109 
GLY C   O    doub N N 110 
GLY C   OXT  sing N N 111 
GLY OXT HXT  sing N N 112 
HIS N   CA   sing N N 113 
HIS N   H    sing N N 114 
HIS N   H2   sing N N 115 
HIS CA  C    sing N N 116 
HIS CA  CB   sing N N 117 
HIS CA  HA   sing N N 118 
HIS C   O    doub N N 119 
HIS C   OXT  sing N N 120 
HIS CB  CG   sing N N 121 
HIS CB  HB2  sing N N 122 
HIS CB  HB3  sing N N 123 
HIS CG  ND1  sing Y N 124 
HIS CG  CD2  doub Y N 125 
HIS ND1 CE1  doub Y N 126 
HIS ND1 HD1  sing N N 127 
HIS CD2 NE2  sing Y N 128 
HIS CD2 HD2  sing N N 129 
HIS CE1 NE2  sing Y N 130 
HIS CE1 HE1  sing N N 131 
HIS NE2 HE2  sing N N 132 
HIS OXT HXT  sing N N 133 
ILE N   CA   sing N N 134 
ILE N   H    sing N N 135 
ILE N   H2   sing N N 136 
ILE CA  C    sing N N 137 
ILE CA  CB   sing N N 138 
ILE CA  HA   sing N N 139 
ILE C   O    doub N N 140 
ILE C   OXT  sing N N 141 
ILE CB  CG1  sing N N 142 
ILE CB  CG2  sing N N 143 
ILE CB  HB   sing N N 144 
ILE CG1 CD1  sing N N 145 
ILE CG1 HG12 sing N N 146 
ILE CG1 HG13 sing N N 147 
ILE CG2 HG21 sing N N 148 
ILE CG2 HG22 sing N N 149 
ILE CG2 HG23 sing N N 150 
ILE CD1 HD11 sing N N 151 
ILE CD1 HD12 sing N N 152 
ILE CD1 HD13 sing N N 153 
ILE OXT HXT  sing N N 154 
LEU N   CA   sing N N 155 
LEU N   H    sing N N 156 
LEU N   H2   sing N N 157 
LEU CA  C    sing N N 158 
LEU CA  CB   sing N N 159 
LEU CA  HA   sing N N 160 
LEU C   O    doub N N 161 
LEU C   OXT  sing N N 162 
LEU CB  CG   sing N N 163 
LEU CB  HB2  sing N N 164 
LEU CB  HB3  sing N N 165 
LEU CG  CD1  sing N N 166 
LEU CG  CD2  sing N N 167 
LEU CG  HG   sing N N 168 
LEU CD1 HD11 sing N N 169 
LEU CD1 HD12 sing N N 170 
LEU CD1 HD13 sing N N 171 
LEU CD2 HD21 sing N N 172 
LEU CD2 HD22 sing N N 173 
LEU CD2 HD23 sing N N 174 
LEU OXT HXT  sing N N 175 
LYS N   CA   sing N N 176 
LYS N   H    sing N N 177 
LYS N   H2   sing N N 178 
LYS CA  C    sing N N 179 
LYS CA  CB   sing N N 180 
LYS CA  HA   sing N N 181 
LYS C   O    doub N N 182 
LYS C   OXT  sing N N 183 
LYS CB  CG   sing N N 184 
LYS CB  HB2  sing N N 185 
LYS CB  HB3  sing N N 186 
LYS CG  CD   sing N N 187 
LYS CG  HG2  sing N N 188 
LYS CG  HG3  sing N N 189 
LYS CD  CE   sing N N 190 
LYS CD  HD2  sing N N 191 
LYS CD  HD3  sing N N 192 
LYS CE  NZ   sing N N 193 
LYS CE  HE2  sing N N 194 
LYS CE  HE3  sing N N 195 
LYS NZ  HZ1  sing N N 196 
LYS NZ  HZ2  sing N N 197 
LYS NZ  HZ3  sing N N 198 
LYS OXT HXT  sing N N 199 
MET N   CA   sing N N 200 
MET N   H    sing N N 201 
MET N   H2   sing N N 202 
MET CA  C    sing N N 203 
MET CA  CB   sing N N 204 
MET CA  HA   sing N N 205 
MET C   O    doub N N 206 
MET C   OXT  sing N N 207 
MET CB  CG   sing N N 208 
MET CB  HB2  sing N N 209 
MET CB  HB3  sing N N 210 
MET CG  SD   sing N N 211 
MET CG  HG2  sing N N 212 
MET CG  HG3  sing N N 213 
MET SD  CE   sing N N 214 
MET CE  HE1  sing N N 215 
MET CE  HE2  sing N N 216 
MET CE  HE3  sing N N 217 
MET OXT HXT  sing N N 218 
PRO N   CA   sing N N 219 
PRO N   CD   sing N N 220 
PRO N   H    sing N N 221 
PRO CA  C    sing N N 222 
PRO CA  CB   sing N N 223 
PRO CA  HA   sing N N 224 
PRO C   O    doub N N 225 
PRO C   OXT  sing N N 226 
PRO CB  CG   sing N N 227 
PRO CB  HB2  sing N N 228 
PRO CB  HB3  sing N N 229 
PRO CG  CD   sing N N 230 
PRO CG  HG2  sing N N 231 
PRO CG  HG3  sing N N 232 
PRO CD  HD2  sing N N 233 
PRO CD  HD3  sing N N 234 
PRO OXT HXT  sing N N 235 
SER N   CA   sing N N 236 
SER N   H    sing N N 237 
SER N   H2   sing N N 238 
SER CA  C    sing N N 239 
SER CA  CB   sing N N 240 
SER CA  HA   sing N N 241 
SER C   O    doub N N 242 
SER C   OXT  sing N N 243 
SER CB  OG   sing N N 244 
SER CB  HB2  sing N N 245 
SER CB  HB3  sing N N 246 
SER OG  HG   sing N N 247 
SER OXT HXT  sing N N 248 
THR N   CA   sing N N 249 
THR N   H    sing N N 250 
THR N   H2   sing N N 251 
THR CA  C    sing N N 252 
THR CA  CB   sing N N 253 
THR CA  HA   sing N N 254 
THR C   O    doub N N 255 
THR C   OXT  sing N N 256 
THR CB  OG1  sing N N 257 
THR CB  CG2  sing N N 258 
THR CB  HB   sing N N 259 
THR OG1 HG1  sing N N 260 
THR CG2 HG21 sing N N 261 
THR CG2 HG22 sing N N 262 
THR CG2 HG23 sing N N 263 
THR OXT HXT  sing N N 264 
TRP N   CA   sing N N 265 
TRP N   H    sing N N 266 
TRP N   H2   sing N N 267 
TRP CA  C    sing N N 268 
TRP CA  CB   sing N N 269 
TRP CA  HA   sing N N 270 
TRP C   O    doub N N 271 
TRP C   OXT  sing N N 272 
TRP CB  CG   sing N N 273 
TRP CB  HB2  sing N N 274 
TRP CB  HB3  sing N N 275 
TRP CG  CD1  doub Y N 276 
TRP CG  CD2  sing Y N 277 
TRP CD1 NE1  sing Y N 278 
TRP CD1 HD1  sing N N 279 
TRP CD2 CE2  doub Y N 280 
TRP CD2 CE3  sing Y N 281 
TRP NE1 CE2  sing Y N 282 
TRP NE1 HE1  sing N N 283 
TRP CE2 CZ2  sing Y N 284 
TRP CE3 CZ3  doub Y N 285 
TRP CE3 HE3  sing N N 286 
TRP CZ2 CH2  doub Y N 287 
TRP CZ2 HZ2  sing N N 288 
TRP CZ3 CH2  sing Y N 289 
TRP CZ3 HZ3  sing N N 290 
TRP CH2 HH2  sing N N 291 
TRP OXT HXT  sing N N 292 
TYR N   CA   sing N N 293 
TYR N   H    sing N N 294 
TYR N   H2   sing N N 295 
TYR CA  C    sing N N 296 
TYR CA  CB   sing N N 297 
TYR CA  HA   sing N N 298 
TYR C   O    doub N N 299 
TYR C   OXT  sing N N 300 
TYR CB  CG   sing N N 301 
TYR CB  HB2  sing N N 302 
TYR CB  HB3  sing N N 303 
TYR CG  CD1  doub Y N 304 
TYR CG  CD2  sing Y N 305 
TYR CD1 CE1  sing Y N 306 
TYR CD1 HD1  sing N N 307 
TYR CD2 CE2  doub Y N 308 
TYR CD2 HD2  sing N N 309 
TYR CE1 CZ   doub Y N 310 
TYR CE1 HE1  sing N N 311 
TYR CE2 CZ   sing Y N 312 
TYR CE2 HE2  sing N N 313 
TYR CZ  OH   sing N N 314 
TYR OH  HH   sing N N 315 
TYR OXT HXT  sing N N 316 
VAL N   CA   sing N N 317 
VAL N   H    sing N N 318 
VAL N   H2   sing N N 319 
VAL CA  C    sing N N 320 
VAL CA  CB   sing N N 321 
VAL CA  HA   sing N N 322 
VAL C   O    doub N N 323 
VAL C   OXT  sing N N 324 
VAL CB  CG1  sing N N 325 
VAL CB  CG2  sing N N 326 
VAL CB  HB   sing N N 327 
VAL CG1 HG11 sing N N 328 
VAL CG1 HG12 sing N N 329 
VAL CG1 HG13 sing N N 330 
VAL CG2 HG21 sing N N 331 
VAL CG2 HG22 sing N N 332 
VAL CG2 HG23 sing N N 333 
VAL OXT HXT  sing N N 334 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.field_strength    600 
# 
_atom_sites.entry_id                    1VA1 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_