data_1VB8 # _entry.id 1VB8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1VB8 pdb_00001vb8 10.2210/pdb1vb8/pdb RCSB RCSB006426 ? ? WWPDB D_1000006426 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-12-21 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1VB8 _pdbx_database_status.recvd_initial_deposition_date 2004-02-25 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Trabi, M.' 1 'Craik, D.J.' 2 # _citation.id primary _citation.title ;Tissue-specific expression of head-to-tail cyclized miniproteins in Violaceae and structure determination of the root cyclotide Viola hederacea root cyclotide1 ; _citation.journal_abbrev 'Plant Cell' _citation.journal_volume 16 _citation.page_first 2204 _citation.page_last 2216 _citation.year 2004 _citation.journal_id_ASTM PLCEEW _citation.country US _citation.journal_id_ISSN 1040-4651 _citation.journal_id_CSD 2109 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15295104 _citation.pdbx_database_id_DOI 10.1105/tpc.104.021790 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Trabi, M.' 1 ? primary 'Craik, D.J.' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'Viola hederacea root peptide 1' _entity.formula_weight 3136.708 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name vhr1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code CAESCVWIPCTVTALLGCSCSNKVCYNGIP _entity_poly.pdbx_seq_one_letter_code_can CAESCVWIPCTVTALLGCSCSNKVCYNGIP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 ALA n 1 3 GLU n 1 4 SER n 1 5 CYS n 1 6 VAL n 1 7 TRP n 1 8 ILE n 1 9 PRO n 1 10 CYS n 1 11 THR n 1 12 VAL n 1 13 THR n 1 14 ALA n 1 15 LEU n 1 16 LEU n 1 17 GLY n 1 18 CYS n 1 19 SER n 1 20 CYS n 1 21 SER n 1 22 ASN n 1 23 LYS n 1 24 VAL n 1 25 CYS n 1 26 TYR n 1 27 ASN n 1 28 GLY n 1 29 ILE n 1 30 PRO n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Viola hederacea' _entity_src_nat.pdbx_ncbi_taxonomy_id 180952 _entity_src_nat.genus Viola _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue roots _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 1 1 CYS CYS A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 PRO 30 30 30 PRO PRO A . n # _exptl.entry_id 1VB8 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1VB8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1VB8 _struct.title 'solution structure of vhr1, the first cyclotide from root tissue' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1VB8 _struct_keywords.pdbx_keywords 'PLANT PROTEIN' _struct_keywords.text 'cyclotide, cystine knot, circular, Viola, CCK, PLANT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code VHR1_VIOHE _struct_ref.pdbx_db_accession P83937 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1VB8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 27 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P83937 _struct_ref_seq.db_align_beg 4 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 30 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 27 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 13 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 17 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 13 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 17 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 1 SG ? ? ? 1_555 A CYS 18 SG ? ? A CYS 1 A CYS 18 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 20 SG ? ? A CYS 5 A CYS 20 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf3 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 10 A CYS 25 1_555 ? ? ? ? ? ? ? 2.028 ? ? covale1 covale both ? A CYS 1 N ? ? ? 1_555 A PRO 30 C ? ? A CYS 1 A PRO 30 1_555 ? ? ? ? ? ? ? 1.323 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 HA A VAL 6 ? ? HG3 A LYS 23 ? ? 1.35 2 5 OE1 A GLU 3 ? ? HG1 A THR 13 ? ? 1.60 3 7 OE1 A GLU 3 ? ? HG1 A THR 13 ? ? 1.59 4 9 OE1 A GLU 3 ? ? HG1 A THR 13 ? ? 1.59 5 18 OE1 A GLU 3 ? ? H A THR 13 ? ? 1.58 6 20 OE1 A GLU 3 ? ? HG1 A THR 13 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 7 ? ? -120.56 -60.47 2 1 THR A 11 ? ? -131.16 -30.21 3 1 ASN A 22 ? ? -162.79 79.35 4 2 CYS A 5 ? ? -88.06 34.61 5 2 ASN A 22 ? ? -167.16 75.93 6 3 TRP A 7 ? ? -121.44 -53.16 7 3 ASN A 22 ? ? -165.41 76.06 8 3 ASN A 27 ? ? -158.99 73.74 9 4 CYS A 5 ? ? -89.03 35.12 10 4 TRP A 7 ? ? -131.55 -46.02 11 4 LYS A 23 ? ? 81.75 -52.44 12 4 ASN A 27 ? ? -118.53 76.20 13 5 CYS A 5 ? ? -88.94 -87.23 14 5 VAL A 6 ? ? 71.16 -55.38 15 5 CYS A 20 ? ? -67.87 97.96 16 5 ASN A 22 ? ? -156.04 63.41 17 5 ASN A 27 ? ? -160.58 74.27 18 6 CYS A 5 ? ? -89.18 -73.06 19 6 VAL A 6 ? ? 70.94 -56.27 20 6 ASN A 22 ? ? -144.14 57.21 21 6 LYS A 23 ? ? 79.54 -38.77 22 7 TRP A 7 ? ? -105.31 -63.42 23 7 SER A 21 ? ? -96.64 -102.00 24 8 CYS A 5 ? ? -88.87 -70.33 25 8 VAL A 6 ? ? 70.66 -56.61 26 8 ASN A 22 ? ? -151.03 61.84 27 8 LYS A 23 ? ? 79.90 -45.18 28 9 TRP A 7 ? ? -128.04 -51.27 29 9 ASN A 22 ? ? -156.97 66.56 30 10 CYS A 5 ? ? -88.12 49.99 31 11 CYS A 20 ? ? -66.32 99.15 32 11 SER A 21 ? ? -96.85 -71.46 33 11 LYS A 23 ? ? 74.84 -40.86 34 11 ASN A 27 ? ? -164.57 73.74 35 12 TRP A 7 ? ? -127.79 -58.07 36 12 SER A 21 ? ? -102.77 71.79 37 12 ASN A 22 ? ? 72.17 75.52 38 12 ASN A 27 ? ? -167.10 -104.73 39 13 TRP A 7 ? ? -135.48 -48.25 40 13 SER A 21 ? ? -97.86 -63.28 41 14 VAL A 6 ? ? 70.09 -59.31 42 14 TRP A 7 ? ? -135.15 -33.56 43 14 SER A 21 ? ? -106.00 -94.58 44 14 ASN A 27 ? ? -140.56 16.08 45 15 CYS A 5 ? ? -88.79 36.82 46 15 TRP A 7 ? ? -131.00 -49.80 47 15 LYS A 23 ? ? 80.10 -53.61 48 16 TRP A 7 ? ? -135.27 -47.51 49 16 CYS A 18 ? ? -64.53 98.39 50 16 CYS A 20 ? ? -63.80 97.18 51 16 ASN A 22 ? ? 69.83 90.92 52 16 LYS A 23 ? ? 69.54 -10.13 53 16 ASN A 27 ? ? -161.77 67.88 54 17 ALA A 2 ? ? -80.77 49.21 55 17 CYS A 5 ? ? -89.85 -77.48 56 17 VAL A 6 ? ? 72.02 -56.77 57 17 LYS A 23 ? ? 78.51 -49.41 58 17 ASN A 27 ? ? -166.39 74.60 59 18 CYS A 5 ? ? -89.38 39.62 60 18 TRP A 7 ? ? -135.79 -44.85 61 18 LYS A 23 ? ? 82.70 -50.96 62 18 ASN A 27 ? ? -173.64 71.10 63 19 TRP A 7 ? ? -123.40 -56.46 64 19 CYS A 10 ? ? -57.84 107.99 65 19 ASN A 22 ? ? -165.84 83.82 66 20 VAL A 6 ? ? 70.81 -56.55 67 20 LYS A 23 ? ? 74.89 -34.96 68 20 ASN A 27 ? ? -160.16 73.83 # _pdbx_nmr_ensemble.entry_id 1VB8 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM vhr1' '70% H2O, 10% D2O, 20% acetonitrile-d3' 2 '1mM vhr1' '80% D2O, 20% acetonitrile-d3' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 ambient 6 ? ? K 2 310 ambient 6 ? ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 '2D TOCSY' 3 1 1 DQF-COSY 4 1 2 TQF-COSY 5 1 2 '2D TOCSY' 6 1 2 DQF-COSY 7 2 1 '2D NOESY' 8 2 1 '2D TOCSY' 9 2 1 TQF-COSY 10 2 1 DQF-COSY # _pdbx_nmr_refine.entry_id 1VB8 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'final energy minimization in water shell' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR ? collection Bruker 1 GLXCC ? 'data analysis' 'Cieslar et al.' 2 X-PLOR 3.851 'structure solution' Brunger 3 CNS 1.0 refinement ? 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 CYS N N N N 31 CYS CA C N R 32 CYS C C N N 33 CYS O O N N 34 CYS CB C N N 35 CYS SG S N N 36 CYS OXT O N N 37 CYS H H N N 38 CYS H2 H N N 39 CYS HA H N N 40 CYS HB2 H N N 41 CYS HB3 H N N 42 CYS HG H N N 43 CYS HXT H N N 44 GLU N N N N 45 GLU CA C N S 46 GLU C C N N 47 GLU O O N N 48 GLU CB C N N 49 GLU CG C N N 50 GLU CD C N N 51 GLU OE1 O N N 52 GLU OE2 O N N 53 GLU OXT O N N 54 GLU H H N N 55 GLU H2 H N N 56 GLU HA H N N 57 GLU HB2 H N N 58 GLU HB3 H N N 59 GLU HG2 H N N 60 GLU HG3 H N N 61 GLU HE2 H N N 62 GLU HXT H N N 63 GLY N N N N 64 GLY CA C N N 65 GLY C C N N 66 GLY O O N N 67 GLY OXT O N N 68 GLY H H N N 69 GLY H2 H N N 70 GLY HA2 H N N 71 GLY HA3 H N N 72 GLY HXT H N N 73 ILE N N N N 74 ILE CA C N S 75 ILE C C N N 76 ILE O O N N 77 ILE CB C N S 78 ILE CG1 C N N 79 ILE CG2 C N N 80 ILE CD1 C N N 81 ILE OXT O N N 82 ILE H H N N 83 ILE H2 H N N 84 ILE HA H N N 85 ILE HB H N N 86 ILE HG12 H N N 87 ILE HG13 H N N 88 ILE HG21 H N N 89 ILE HG22 H N N 90 ILE HG23 H N N 91 ILE HD11 H N N 92 ILE HD12 H N N 93 ILE HD13 H N N 94 ILE HXT H N N 95 LEU N N N N 96 LEU CA C N S 97 LEU C C N N 98 LEU O O N N 99 LEU CB C N N 100 LEU CG C N N 101 LEU CD1 C N N 102 LEU CD2 C N N 103 LEU OXT O N N 104 LEU H H N N 105 LEU H2 H N N 106 LEU HA H N N 107 LEU HB2 H N N 108 LEU HB3 H N N 109 LEU HG H N N 110 LEU HD11 H N N 111 LEU HD12 H N N 112 LEU HD13 H N N 113 LEU HD21 H N N 114 LEU HD22 H N N 115 LEU HD23 H N N 116 LEU HXT H N N 117 LYS N N N N 118 LYS CA C N S 119 LYS C C N N 120 LYS O O N N 121 LYS CB C N N 122 LYS CG C N N 123 LYS CD C N N 124 LYS CE C N N 125 LYS NZ N N N 126 LYS OXT O N N 127 LYS H H N N 128 LYS H2 H N N 129 LYS HA H N N 130 LYS HB2 H N N 131 LYS HB3 H N N 132 LYS HG2 H N N 133 LYS HG3 H N N 134 LYS HD2 H N N 135 LYS HD3 H N N 136 LYS HE2 H N N 137 LYS HE3 H N N 138 LYS HZ1 H N N 139 LYS HZ2 H N N 140 LYS HZ3 H N N 141 LYS HXT H N N 142 PRO N N N N 143 PRO CA C N S 144 PRO C C N N 145 PRO O O N N 146 PRO CB C N N 147 PRO CG C N N 148 PRO CD C N N 149 PRO OXT O N N 150 PRO H H N N 151 PRO HA H N N 152 PRO HB2 H N N 153 PRO HB3 H N N 154 PRO HG2 H N N 155 PRO HG3 H N N 156 PRO HD2 H N N 157 PRO HD3 H N N 158 PRO HXT H N N 159 SER N N N N 160 SER CA C N S 161 SER C C N N 162 SER O O N N 163 SER CB C N N 164 SER OG O N N 165 SER OXT O N N 166 SER H H N N 167 SER H2 H N N 168 SER HA H N N 169 SER HB2 H N N 170 SER HB3 H N N 171 SER HG H N N 172 SER HXT H N N 173 THR N N N N 174 THR CA C N S 175 THR C C N N 176 THR O O N N 177 THR CB C N R 178 THR OG1 O N N 179 THR CG2 C N N 180 THR OXT O N N 181 THR H H N N 182 THR H2 H N N 183 THR HA H N N 184 THR HB H N N 185 THR HG1 H N N 186 THR HG21 H N N 187 THR HG22 H N N 188 THR HG23 H N N 189 THR HXT H N N 190 TRP N N N N 191 TRP CA C N S 192 TRP C C N N 193 TRP O O N N 194 TRP CB C N N 195 TRP CG C Y N 196 TRP CD1 C Y N 197 TRP CD2 C Y N 198 TRP NE1 N Y N 199 TRP CE2 C Y N 200 TRP CE3 C Y N 201 TRP CZ2 C Y N 202 TRP CZ3 C Y N 203 TRP CH2 C Y N 204 TRP OXT O N N 205 TRP H H N N 206 TRP H2 H N N 207 TRP HA H N N 208 TRP HB2 H N N 209 TRP HB3 H N N 210 TRP HD1 H N N 211 TRP HE1 H N N 212 TRP HE3 H N N 213 TRP HZ2 H N N 214 TRP HZ3 H N N 215 TRP HH2 H N N 216 TRP HXT H N N 217 TYR N N N N 218 TYR CA C N S 219 TYR C C N N 220 TYR O O N N 221 TYR CB C N N 222 TYR CG C Y N 223 TYR CD1 C Y N 224 TYR CD2 C Y N 225 TYR CE1 C Y N 226 TYR CE2 C Y N 227 TYR CZ C Y N 228 TYR OH O N N 229 TYR OXT O N N 230 TYR H H N N 231 TYR H2 H N N 232 TYR HA H N N 233 TYR HB2 H N N 234 TYR HB3 H N N 235 TYR HD1 H N N 236 TYR HD2 H N N 237 TYR HE1 H N N 238 TYR HE2 H N N 239 TYR HH H N N 240 TYR HXT H N N 241 VAL N N N N 242 VAL CA C N S 243 VAL C C N N 244 VAL O O N N 245 VAL CB C N N 246 VAL CG1 C N N 247 VAL CG2 C N N 248 VAL OXT O N N 249 VAL H H N N 250 VAL H2 H N N 251 VAL HA H N N 252 VAL HB H N N 253 VAL HG11 H N N 254 VAL HG12 H N N 255 VAL HG13 H N N 256 VAL HG21 H N N 257 VAL HG22 H N N 258 VAL HG23 H N N 259 VAL HXT H N N 260 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 CYS N CA sing N N 29 CYS N H sing N N 30 CYS N H2 sing N N 31 CYS CA C sing N N 32 CYS CA CB sing N N 33 CYS CA HA sing N N 34 CYS C O doub N N 35 CYS C OXT sing N N 36 CYS CB SG sing N N 37 CYS CB HB2 sing N N 38 CYS CB HB3 sing N N 39 CYS SG HG sing N N 40 CYS OXT HXT sing N N 41 GLU N CA sing N N 42 GLU N H sing N N 43 GLU N H2 sing N N 44 GLU CA C sing N N 45 GLU CA CB sing N N 46 GLU CA HA sing N N 47 GLU C O doub N N 48 GLU C OXT sing N N 49 GLU CB CG sing N N 50 GLU CB HB2 sing N N 51 GLU CB HB3 sing N N 52 GLU CG CD sing N N 53 GLU CG HG2 sing N N 54 GLU CG HG3 sing N N 55 GLU CD OE1 doub N N 56 GLU CD OE2 sing N N 57 GLU OE2 HE2 sing N N 58 GLU OXT HXT sing N N 59 GLY N CA sing N N 60 GLY N H sing N N 61 GLY N H2 sing N N 62 GLY CA C sing N N 63 GLY CA HA2 sing N N 64 GLY CA HA3 sing N N 65 GLY C O doub N N 66 GLY C OXT sing N N 67 GLY OXT HXT sing N N 68 ILE N CA sing N N 69 ILE N H sing N N 70 ILE N H2 sing N N 71 ILE CA C sing N N 72 ILE CA CB sing N N 73 ILE CA HA sing N N 74 ILE C O doub N N 75 ILE C OXT sing N N 76 ILE CB CG1 sing N N 77 ILE CB CG2 sing N N 78 ILE CB HB sing N N 79 ILE CG1 CD1 sing N N 80 ILE CG1 HG12 sing N N 81 ILE CG1 HG13 sing N N 82 ILE CG2 HG21 sing N N 83 ILE CG2 HG22 sing N N 84 ILE CG2 HG23 sing N N 85 ILE CD1 HD11 sing N N 86 ILE CD1 HD12 sing N N 87 ILE CD1 HD13 sing N N 88 ILE OXT HXT sing N N 89 LEU N CA sing N N 90 LEU N H sing N N 91 LEU N H2 sing N N 92 LEU CA C sing N N 93 LEU CA CB sing N N 94 LEU CA HA sing N N 95 LEU C O doub N N 96 LEU C OXT sing N N 97 LEU CB CG sing N N 98 LEU CB HB2 sing N N 99 LEU CB HB3 sing N N 100 LEU CG CD1 sing N N 101 LEU CG CD2 sing N N 102 LEU CG HG sing N N 103 LEU CD1 HD11 sing N N 104 LEU CD1 HD12 sing N N 105 LEU CD1 HD13 sing N N 106 LEU CD2 HD21 sing N N 107 LEU CD2 HD22 sing N N 108 LEU CD2 HD23 sing N N 109 LEU OXT HXT sing N N 110 LYS N CA sing N N 111 LYS N H sing N N 112 LYS N H2 sing N N 113 LYS CA C sing N N 114 LYS CA CB sing N N 115 LYS CA HA sing N N 116 LYS C O doub N N 117 LYS C OXT sing N N 118 LYS CB CG sing N N 119 LYS CB HB2 sing N N 120 LYS CB HB3 sing N N 121 LYS CG CD sing N N 122 LYS CG HG2 sing N N 123 LYS CG HG3 sing N N 124 LYS CD CE sing N N 125 LYS CD HD2 sing N N 126 LYS CD HD3 sing N N 127 LYS CE NZ sing N N 128 LYS CE HE2 sing N N 129 LYS CE HE3 sing N N 130 LYS NZ HZ1 sing N N 131 LYS NZ HZ2 sing N N 132 LYS NZ HZ3 sing N N 133 LYS OXT HXT sing N N 134 PRO N CA sing N N 135 PRO N CD sing N N 136 PRO N H sing N N 137 PRO CA C sing N N 138 PRO CA CB sing N N 139 PRO CA HA sing N N 140 PRO C O doub N N 141 PRO C OXT sing N N 142 PRO CB CG sing N N 143 PRO CB HB2 sing N N 144 PRO CB HB3 sing N N 145 PRO CG CD sing N N 146 PRO CG HG2 sing N N 147 PRO CG HG3 sing N N 148 PRO CD HD2 sing N N 149 PRO CD HD3 sing N N 150 PRO OXT HXT sing N N 151 SER N CA sing N N 152 SER N H sing N N 153 SER N H2 sing N N 154 SER CA C sing N N 155 SER CA CB sing N N 156 SER CA HA sing N N 157 SER C O doub N N 158 SER C OXT sing N N 159 SER CB OG sing N N 160 SER CB HB2 sing N N 161 SER CB HB3 sing N N 162 SER OG HG sing N N 163 SER OXT HXT sing N N 164 THR N CA sing N N 165 THR N H sing N N 166 THR N H2 sing N N 167 THR CA C sing N N 168 THR CA CB sing N N 169 THR CA HA sing N N 170 THR C O doub N N 171 THR C OXT sing N N 172 THR CB OG1 sing N N 173 THR CB CG2 sing N N 174 THR CB HB sing N N 175 THR OG1 HG1 sing N N 176 THR CG2 HG21 sing N N 177 THR CG2 HG22 sing N N 178 THR CG2 HG23 sing N N 179 THR OXT HXT sing N N 180 TRP N CA sing N N 181 TRP N H sing N N 182 TRP N H2 sing N N 183 TRP CA C sing N N 184 TRP CA CB sing N N 185 TRP CA HA sing N N 186 TRP C O doub N N 187 TRP C OXT sing N N 188 TRP CB CG sing N N 189 TRP CB HB2 sing N N 190 TRP CB HB3 sing N N 191 TRP CG CD1 doub Y N 192 TRP CG CD2 sing Y N 193 TRP CD1 NE1 sing Y N 194 TRP CD1 HD1 sing N N 195 TRP CD2 CE2 doub Y N 196 TRP CD2 CE3 sing Y N 197 TRP NE1 CE2 sing Y N 198 TRP NE1 HE1 sing N N 199 TRP CE2 CZ2 sing Y N 200 TRP CE3 CZ3 doub Y N 201 TRP CE3 HE3 sing N N 202 TRP CZ2 CH2 doub Y N 203 TRP CZ2 HZ2 sing N N 204 TRP CZ3 CH2 sing Y N 205 TRP CZ3 HZ3 sing N N 206 TRP CH2 HH2 sing N N 207 TRP OXT HXT sing N N 208 TYR N CA sing N N 209 TYR N H sing N N 210 TYR N H2 sing N N 211 TYR CA C sing N N 212 TYR CA CB sing N N 213 TYR CA HA sing N N 214 TYR C O doub N N 215 TYR C OXT sing N N 216 TYR CB CG sing N N 217 TYR CB HB2 sing N N 218 TYR CB HB3 sing N N 219 TYR CG CD1 doub Y N 220 TYR CG CD2 sing Y N 221 TYR CD1 CE1 sing Y N 222 TYR CD1 HD1 sing N N 223 TYR CD2 CE2 doub Y N 224 TYR CD2 HD2 sing N N 225 TYR CE1 CZ doub Y N 226 TYR CE1 HE1 sing N N 227 TYR CE2 CZ sing Y N 228 TYR CE2 HE2 sing N N 229 TYR CZ OH sing N N 230 TYR OH HH sing N N 231 TYR OXT HXT sing N N 232 VAL N CA sing N N 233 VAL N H sing N N 234 VAL N H2 sing N N 235 VAL CA C sing N N 236 VAL CA CB sing N N 237 VAL CA HA sing N N 238 VAL C O doub N N 239 VAL C OXT sing N N 240 VAL CB CG1 sing N N 241 VAL CB CG2 sing N N 242 VAL CB HB sing N N 243 VAL CG1 HG11 sing N N 244 VAL CG1 HG12 sing N N 245 VAL CG1 HG13 sing N N 246 VAL CG2 HG21 sing N N 247 VAL CG2 HG22 sing N N 248 VAL CG2 HG23 sing N N 249 VAL OXT HXT sing N N 250 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.field_strength 750 # _atom_sites.entry_id 1VB8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_