data_1VK9 # _entry.id 1VK9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1VK9 pdb_00001vk9 10.2210/pdb1vk9/pdb RCSB RCSB001943 ? ? WWPDB D_1000001943 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-05-18 2 'Structure model' 1 1 2008-04-26 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-04 5 'Structure model' 1 4 2023-01-25 6 'Structure model' 1 5 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Version format compliance' 5 4 'Structure model' 'Refinement description' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Derived calculations' 8 6 'Structure model' 'Data collection' 9 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' database_2 3 5 'Structure model' pdbx_struct_conn_angle 4 5 'Structure model' struct_conn 5 5 'Structure model' struct_ref_seq_dif 6 5 'Structure model' struct_site 7 6 'Structure model' chem_comp_atom 8 6 'Structure model' chem_comp_bond 9 6 'Structure model' pdbx_entry_details 10 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 18 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 19 5 'Structure model' '_pdbx_struct_conn_angle.value' 20 5 'Structure model' '_struct_conn.pdbx_dist_value' 21 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 22 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 23 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 24 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 25 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 26 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 27 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 28 5 'Structure model' '_struct_conn.ptnr1_symmetry' 29 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 30 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 31 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 32 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 33 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 34 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 35 5 'Structure model' '_struct_conn.ptnr2_symmetry' 36 5 'Structure model' '_struct_ref_seq_dif.details' 37 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 38 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 39 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.entry_id 1VK9 _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2004-05-06 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id 283363 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _audit_author.name 'Joint Center for Structural Genomics (JCSG)' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title ;Crystal structure of an ADP-ribosylated protein with a cytidine deaminase-like fold, but unknown function (TM1506), from Thermotoga maritima at 2.70 A resolution. ; _citation.journal_abbrev Proteins _citation.journal_volume 71 _citation.page_first 1546 _citation.page_last 1552 _citation.year 2008 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18275082 _citation.pdbx_database_id_DOI 10.1002/prot.21992 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, Q.' 1 ? primary 'Kozbial, P.' 2 ? primary 'McMullan, D.' 3 ? primary 'Krishna, S.S.' 4 ? primary 'Brittain, S.M.' 5 ? primary 'Ficarro, S.B.' 6 ? primary 'DiDonato, M.' 7 ? primary 'Miller, M.D.' 8 ? primary 'Abdubek, P.' 9 ? primary 'Axelrod, H.L.' 10 ? primary 'Chiu, H.J.' 11 ? primary 'Clayton, T.' 12 ? primary 'Duan, L.' 13 ? primary 'Elsliger, M.A.' 14 ? primary 'Feuerhelm, J.' 15 ? primary 'Grzechnik, S.K.' 16 ? primary 'Hale, J.' 17 ? primary 'Han, G.W.' 18 ? primary 'Jaroszewski, L.' 19 ? primary 'Klock, H.E.' 20 ? primary 'Morse, A.T.' 21 ? primary 'Nigoghossian, E.' 22 ? primary 'Paulsen, J.' 23 ? primary 'Reyes, R.' 24 ? primary 'Rife, C.L.' 25 ? primary 'van den Bedem, H.' 26 ? primary 'White, A.' 27 ? primary 'Hodgson, K.O.' 28 ? primary 'Wooley, J.' 29 ? primary 'Deacon, A.M.' 30 ? primary 'Godzik, A.' 31 ? primary 'Lesley, S.A.' 32 ? primary 'Wilson, I.A.' 33 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'conserved hypothetical protein TM1506' 17433.691 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 6 ? ? ? ? 3 non-polymer syn 'UNKNOWN LIGAND' ? 1 ? ? ? ? 4 water nat water 18.015 9 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MGSDKIHHHHHHVEKNLLRSALKIFEKKDLSLLAYSGRSIFESKDSGLKPVVELFKRFDNLEGSLVIDK(MSE)VGKAAA SFLLK(MSE)KPDHIHAKVISKPALKL(MSE)NEYGQSFSYDEKIPFVLGKDGKS(MSE)CPFEKLVLE(MSE)DDPEEI IRIVLSKFTSL ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSDKIHHHHHHVEKNLLRSALKIFEKKDLSLLAYSGRSIFESKDSGLKPVVELFKRFDNLEGSLVIDKMVGKAAASFLL KMKPDHIHAKVISKPALKLMNEYGQSFSYDEKIPFVLGKDGKSMCPFEKLVLEMDDPEEIIRIVLSKFTSL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier 283363 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'UNKNOWN LIGAND' UNL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 ASP n 1 5 LYS n 1 6 ILE n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 HIS n 1 12 HIS n 1 13 VAL n 1 14 GLU n 1 15 LYS n 1 16 ASN n 1 17 LEU n 1 18 LEU n 1 19 ARG n 1 20 SER n 1 21 ALA n 1 22 LEU n 1 23 LYS n 1 24 ILE n 1 25 PHE n 1 26 GLU n 1 27 LYS n 1 28 LYS n 1 29 ASP n 1 30 LEU n 1 31 SER n 1 32 LEU n 1 33 LEU n 1 34 ALA n 1 35 TYR n 1 36 SER n 1 37 GLY n 1 38 ARG n 1 39 SER n 1 40 ILE n 1 41 PHE n 1 42 GLU n 1 43 SER n 1 44 LYS n 1 45 ASP n 1 46 SER n 1 47 GLY n 1 48 LEU n 1 49 LYS n 1 50 PRO n 1 51 VAL n 1 52 VAL n 1 53 GLU n 1 54 LEU n 1 55 PHE n 1 56 LYS n 1 57 ARG n 1 58 PHE n 1 59 ASP n 1 60 ASN n 1 61 LEU n 1 62 GLU n 1 63 GLY n 1 64 SER n 1 65 LEU n 1 66 VAL n 1 67 ILE n 1 68 ASP n 1 69 LYS n 1 70 MSE n 1 71 VAL n 1 72 GLY n 1 73 LYS n 1 74 ALA n 1 75 ALA n 1 76 ALA n 1 77 SER n 1 78 PHE n 1 79 LEU n 1 80 LEU n 1 81 LYS n 1 82 MSE n 1 83 LYS n 1 84 PRO n 1 85 ASP n 1 86 HIS n 1 87 ILE n 1 88 HIS n 1 89 ALA n 1 90 LYS n 1 91 VAL n 1 92 ILE n 1 93 SER n 1 94 LYS n 1 95 PRO n 1 96 ALA n 1 97 LEU n 1 98 LYS n 1 99 LEU n 1 100 MSE n 1 101 ASN n 1 102 GLU n 1 103 TYR n 1 104 GLY n 1 105 GLN n 1 106 SER n 1 107 PHE n 1 108 SER n 1 109 TYR n 1 110 ASP n 1 111 GLU n 1 112 LYS n 1 113 ILE n 1 114 PRO n 1 115 PHE n 1 116 VAL n 1 117 LEU n 1 118 GLY n 1 119 LYS n 1 120 ASP n 1 121 GLY n 1 122 LYS n 1 123 SER n 1 124 MSE n 1 125 CYS n 1 126 PRO n 1 127 PHE n 1 128 GLU n 1 129 LYS n 1 130 LEU n 1 131 VAL n 1 132 LEU n 1 133 GLU n 1 134 MSE n 1 135 ASP n 1 136 ASP n 1 137 PRO n 1 138 GLU n 1 139 GLU n 1 140 ILE n 1 141 ILE n 1 142 ARG n 1 143 ILE n 1 144 VAL n 1 145 LEU n 1 146 SER n 1 147 LYS n 1 148 PHE n 1 149 THR n 1 150 SER n 1 151 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermotoga _entity_src_gen.pdbx_gene_src_gene TM1506 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermotoga maritima' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2336 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UNL non-polymer . 'UNKNOWN LIGAND' ? ? ? VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -11 ? ? ? A . n A 1 2 GLY 2 -10 -10 GLY GLY A . n A 1 3 SER 3 -9 -9 SER SER A . n A 1 4 ASP 4 -8 -8 ASP ASP A . n A 1 5 LYS 5 -7 -7 LYS LYS A . n A 1 6 ILE 6 -6 -6 ILE ILE A . n A 1 7 HIS 7 -5 -5 HIS HIS A . n A 1 8 HIS 8 -4 -4 HIS HIS A . n A 1 9 HIS 9 -3 -3 HIS HIS A . n A 1 10 HIS 10 -2 -2 HIS HIS A . n A 1 11 HIS 11 -1 -1 HIS HIS A . n A 1 12 HIS 12 0 0 HIS HIS A . n A 1 13 VAL 13 1 1 VAL VAL A . n A 1 14 GLU 14 2 2 GLU GLU A . n A 1 15 LYS 15 3 3 LYS LYS A . n A 1 16 ASN 16 4 4 ASN ASN A . n A 1 17 LEU 17 5 5 LEU LEU A . n A 1 18 LEU 18 6 6 LEU LEU A . n A 1 19 ARG 19 7 7 ARG ARG A . n A 1 20 SER 20 8 8 SER SER A . n A 1 21 ALA 21 9 9 ALA ALA A . n A 1 22 LEU 22 10 10 LEU LEU A . n A 1 23 LYS 23 11 11 LYS LYS A . n A 1 24 ILE 24 12 12 ILE ILE A . n A 1 25 PHE 25 13 13 PHE PHE A . n A 1 26 GLU 26 14 14 GLU GLU A . n A 1 27 LYS 27 15 15 LYS LYS A . n A 1 28 LYS 28 16 16 LYS LYS A . n A 1 29 ASP 29 17 17 ASP ASP A . n A 1 30 LEU 30 18 18 LEU LEU A . n A 1 31 SER 31 19 19 SER SER A . n A 1 32 LEU 32 20 20 LEU LEU A . n A 1 33 LEU 33 21 21 LEU LEU A . n A 1 34 ALA 34 22 22 ALA ALA A . n A 1 35 TYR 35 23 23 TYR TYR A . n A 1 36 SER 36 24 24 SER SER A . n A 1 37 GLY 37 25 25 GLY GLY A . n A 1 38 ARG 38 26 26 ARG ARG A . n A 1 39 SER 39 27 27 SER SER A . n A 1 40 ILE 40 28 28 ILE ILE A . n A 1 41 PHE 41 29 29 PHE PHE A . n A 1 42 GLU 42 30 30 GLU GLU A . n A 1 43 SER 43 31 31 SER SER A . n A 1 44 LYS 44 32 32 LYS LYS A . n A 1 45 ASP 45 33 33 ASP ASP A . n A 1 46 SER 46 34 34 SER SER A . n A 1 47 GLY 47 35 35 GLY GLY A . n A 1 48 LEU 48 36 36 LEU LEU A . n A 1 49 LYS 49 37 37 LYS LYS A . n A 1 50 PRO 50 38 38 PRO PRO A . n A 1 51 VAL 51 39 39 VAL VAL A . n A 1 52 VAL 52 40 40 VAL VAL A . n A 1 53 GLU 53 41 41 GLU GLU A . n A 1 54 LEU 54 42 42 LEU LEU A . n A 1 55 PHE 55 43 43 PHE PHE A . n A 1 56 LYS 56 44 44 LYS LYS A . n A 1 57 ARG 57 45 45 ARG ARG A . n A 1 58 PHE 58 46 46 PHE PHE A . n A 1 59 ASP 59 47 47 ASP ASP A . n A 1 60 ASN 60 48 48 ASN ASN A . n A 1 61 LEU 61 49 49 LEU LEU A . n A 1 62 GLU 62 50 50 GLU GLU A . n A 1 63 GLY 63 51 51 GLY GLY A . n A 1 64 SER 64 52 52 SER SER A . n A 1 65 LEU 65 53 53 LEU LEU A . n A 1 66 VAL 66 54 54 VAL VAL A . n A 1 67 ILE 67 55 55 ILE ILE A . n A 1 68 ASP 68 56 56 ASP ASP A . n A 1 69 LYS 69 57 57 LYS LYS A . n A 1 70 MSE 70 58 58 MSE MSE A . n A 1 71 VAL 71 59 59 VAL VAL A . n A 1 72 GLY 72 60 60 GLY GLY A . n A 1 73 LYS 73 61 61 LYS LYS A . n A 1 74 ALA 74 62 62 ALA ALA A . n A 1 75 ALA 75 63 63 ALA ALA A . n A 1 76 ALA 76 64 64 ALA ALA A . n A 1 77 SER 77 65 65 SER SER A . n A 1 78 PHE 78 66 66 PHE PHE A . n A 1 79 LEU 79 67 67 LEU LEU A . n A 1 80 LEU 80 68 68 LEU LEU A . n A 1 81 LYS 81 69 69 LYS LYS A . n A 1 82 MSE 82 70 70 MSE MSE A . n A 1 83 LYS 83 71 71 LYS LYS A . n A 1 84 PRO 84 72 72 PRO PRO A . n A 1 85 ASP 85 73 73 ASP ASP A . n A 1 86 HIS 86 74 74 HIS HIS A . n A 1 87 ILE 87 75 75 ILE ILE A . n A 1 88 HIS 88 76 76 HIS HIS A . n A 1 89 ALA 89 77 77 ALA ALA A . n A 1 90 LYS 90 78 78 LYS LYS A . n A 1 91 VAL 91 79 79 VAL VAL A . n A 1 92 ILE 92 80 80 ILE ILE A . n A 1 93 SER 93 81 81 SER SER A . n A 1 94 LYS 94 82 82 LYS LYS A . n A 1 95 PRO 95 83 83 PRO PRO A . n A 1 96 ALA 96 84 84 ALA ALA A . n A 1 97 LEU 97 85 85 LEU LEU A . n A 1 98 LYS 98 86 86 LYS LYS A . n A 1 99 LEU 99 87 87 LEU LEU A . n A 1 100 MSE 100 88 88 MSE MSE A . n A 1 101 ASN 101 89 89 ASN ASN A . n A 1 102 GLU 102 90 90 GLU GLU A . n A 1 103 TYR 103 91 91 TYR TYR A . n A 1 104 GLY 104 92 92 GLY GLY A . n A 1 105 GLN 105 93 93 GLN GLN A . n A 1 106 SER 106 94 94 SER SER A . n A 1 107 PHE 107 95 95 PHE PHE A . n A 1 108 SER 108 96 96 SER SER A . n A 1 109 TYR 109 97 97 TYR TYR A . n A 1 110 ASP 110 98 98 ASP ASP A . n A 1 111 GLU 111 99 99 GLU GLU A . n A 1 112 LYS 112 100 100 LYS LYS A . n A 1 113 ILE 113 101 101 ILE ILE A . n A 1 114 PRO 114 102 102 PRO PRO A . n A 1 115 PHE 115 103 103 PHE PHE A . n A 1 116 VAL 116 104 104 VAL VAL A . n A 1 117 LEU 117 105 105 LEU LEU A . n A 1 118 GLY 118 106 106 GLY GLY A . n A 1 119 LYS 119 107 107 LYS LYS A . n A 1 120 ASP 120 108 108 ASP ASP A . n A 1 121 GLY 121 109 109 GLY GLY A . n A 1 122 LYS 122 110 110 LYS LYS A . n A 1 123 SER 123 111 111 SER SER A . n A 1 124 MSE 124 112 112 MSE MSE A . n A 1 125 CYS 125 113 113 CYS CYS A . n A 1 126 PRO 126 114 114 PRO PRO A . n A 1 127 PHE 127 115 115 PHE PHE A . n A 1 128 GLU 128 116 116 GLU GLU A . n A 1 129 LYS 129 117 117 LYS LYS A . n A 1 130 LEU 130 118 118 LEU LEU A . n A 1 131 VAL 131 119 119 VAL VAL A . n A 1 132 LEU 132 120 120 LEU LEU A . n A 1 133 GLU 133 121 121 GLU GLU A . n A 1 134 MSE 134 122 122 MSE MSE A . n A 1 135 ASP 135 123 123 ASP ASP A . n A 1 136 ASP 136 124 124 ASP ASP A . n A 1 137 PRO 137 125 125 PRO PRO A . n A 1 138 GLU 138 126 126 GLU GLU A . n A 1 139 GLU 139 127 127 GLU GLU A . n A 1 140 ILE 140 128 128 ILE ILE A . n A 1 141 ILE 141 129 129 ILE ILE A . n A 1 142 ARG 142 130 130 ARG ARG A . n A 1 143 ILE 143 131 131 ILE ILE A . n A 1 144 VAL 144 132 132 VAL VAL A . n A 1 145 LEU 145 133 133 LEU LEU A . n A 1 146 SER 146 134 134 SER SER A . n A 1 147 LYS 147 135 135 LYS LYS A . n A 1 148 PHE 148 136 136 PHE PHE A . n A 1 149 THR 149 137 ? ? ? A . n A 1 150 SER 150 138 ? ? ? A . n A 1 151 LEU 151 139 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 140 1 ZN ZN A . C 2 ZN 1 141 2 ZN ZN A . D 2 ZN 1 142 3 ZN ZN A . E 2 ZN 1 143 4 ZN ZN A . F 2 ZN 1 144 5 ZN ZN A . G 2 ZN 1 145 6 ZN ZN A . H 3 UNL 1 201 201 UNL UNL A . I 4 HOH 1 202 7 HOH HOH A . I 4 HOH 2 203 8 HOH HOH A . I 4 HOH 3 204 9 HOH HOH A . I 4 HOH 4 205 10 HOH HOH A . I 4 HOH 5 206 11 HOH HOH A . I 4 HOH 6 207 12 HOH HOH A . I 4 HOH 7 208 13 HOH HOH A . I 4 HOH 8 209 14 HOH HOH A . I 4 HOH 9 210 15 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 2 ? CD ? A GLU 14 CD 2 1 Y 1 A GLU 2 ? OE1 ? A GLU 14 OE1 3 1 Y 1 A GLU 2 ? OE2 ? A GLU 14 OE2 4 1 Y 1 A LYS 3 ? CD ? A LYS 15 CD 5 1 Y 1 A LYS 3 ? CE ? A LYS 15 CE 6 1 Y 1 A LYS 3 ? NZ ? A LYS 15 NZ 7 1 Y 1 A ARG 7 ? CZ ? A ARG 19 CZ 8 1 Y 1 A ARG 7 ? NH1 ? A ARG 19 NH1 9 1 Y 1 A ARG 7 ? NH2 ? A ARG 19 NH2 10 1 Y 1 A LYS 37 ? CD ? A LYS 49 CD 11 1 Y 1 A LYS 37 ? CE ? A LYS 49 CE 12 1 Y 1 A LYS 37 ? NZ ? A LYS 49 NZ 13 1 Y 1 A LYS 107 ? CG ? A LYS 119 CG 14 1 Y 1 A LYS 107 ? CD ? A LYS 119 CD 15 1 Y 1 A LYS 107 ? CE ? A LYS 119 CE 16 1 Y 1 A LYS 107 ? NZ ? A LYS 119 NZ 17 1 Y 1 A LYS 110 ? CG ? A LYS 122 CG 18 1 Y 1 A LYS 110 ? CD ? A LYS 122 CD 19 1 Y 1 A LYS 110 ? CE ? A LYS 122 CE 20 1 Y 1 A LYS 110 ? NZ ? A LYS 122 NZ 21 1 Y 1 A GLU 126 ? CD ? A GLU 138 CD 22 1 Y 1 A GLU 126 ? OE1 ? A GLU 138 OE1 23 1 Y 1 A GLU 126 ? OE2 ? A GLU 138 OE2 24 1 Y 1 A GLU 127 ? CD ? A GLU 139 CD 25 1 Y 1 A GLU 127 ? OE1 ? A GLU 139 OE1 26 1 Y 1 A GLU 127 ? OE2 ? A GLU 139 OE2 # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MOSFLM 'data reduction' . ? 1 SCALA 'data scaling' '4.2)' ? 2 SHELXD phasing . ? 3 autoSHARP phasing . ? 4 SOLOMON phasing . ? 5 REFMAC refinement 5.1.24 ? 6 CCP4 'data scaling' '(SCALA)' ? 7 # _cell.entry_id 1VK9 _cell.length_a 132.891 _cell.length_b 132.891 _cell.length_c 66.379 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1VK9 _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 # _exptl.crystals_number 1 _exptl.method 'X-RAY DIFFRACTION' _exptl.entry_id 1VK9 # _exptl_crystal.id 1 _exptl_crystal.density_percent_sol 75.49 _exptl_crystal.density_Matthews 5.06 _exptl_crystal.density_meas ? _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION,SITTING DROP,NANODROP' _exptl_crystal_grow.pH 5.8 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.pdbx_details '40% PEG-600, 0.1M Imidazole pH 8.0, 0.2M Zn(OAc)2, pH 5.8, VAPOR DIFFUSION,SITTING DROP,NANODROP, temperature 277K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type ADSC _diffrn_detector.details ? _diffrn_detector.pdbx_collection_date 2003-12-12 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Double Crystal Si(111)' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9796 1.0 2 1.0332 1.0 3 0.9795 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 8.2.1 _diffrn_source.type 'ALS BEAMLINE 8.2.1' _diffrn_source.pdbx_wavelength_list '0.9796, 1.0332, 0.9795' _diffrn_source.pdbx_wavelength ? # _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.d_resolution_high 2.700 _reflns.d_resolution_low 66.38 _reflns.number_obs 9700 _reflns.percent_possible_obs 97.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_netI_over_sigmaI 15.7 _reflns.B_iso_Wilson_estimate 75.49 _reflns.pdbx_redundancy 6.4 _reflns.pdbx_Rsym_value 0.086 _reflns.entry_id 1VK9 _reflns.number_all ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.70 _reflns_shell.d_res_low 2.77 _reflns_shell.percent_possible_all 78.0 _reflns_shell.pdbx_Rsym_value 0.548 _reflns_shell.pdbx_redundancy 4.9 _reflns_shell.number_unique_all 569 _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.percent_possible_obs ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.ls_d_res_high 2.70 _refine.ls_d_res_low 57.50 _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_obs 9155 _refine.ls_number_reflns_R_free 465 _refine.ls_percent_reflns_R_free 4.8 _refine.ls_percent_reflns_obs 96.83 _refine.ls_R_factor_obs 0.20789 _refine.ls_R_factor_R_work 0.20579 _refine.ls_R_factor_R_free 0.25083 _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.B_iso_mean 34.913 _refine.aniso_B[1][1] 0.42 _refine.aniso_B[2][2] 0.42 _refine.aniso_B[3][3] -0.64 _refine.aniso_B[1][2] 0.21 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.details ;THERE ARE UNEXPLAINED ELECTRON DENSITY NEAR HIS -5, HIS 0, SER 31, GLU 126, GLU 127. AN UNKNOWN ENTITY WAS PRESENT IN THE ACTIVE SITE, IT MAY CONTAIN FRAGMENTS SUCH AS A SUGAR, A METAL AND A PHOSPHORYL GROUP, ACCORDING TO DENSITY MAP. THE METALS WERE MODELLED AS ZINC SINCE THE CRYSTAL WAS GROWN IN 0.2M ZINC BUFFER. LYS -7 FROM AN ADJACENT MOLECULE IN THE CRYSTAL IS OBSERVED TO PARTICIPATE IN THE COORDINATION OF ZN 5 IN THE DENSITY MAP. IT IS SUSPICIOUS AND COULD BE AN ARTIFACT OF THE LIMITED RESOLUTION. ; _refine.pdbx_overall_ESU_R 0.300 _refine.pdbx_overall_ESU_R_Free 0.252 _refine.overall_SU_ML 0.168 _refine.overall_SU_B 8.772 _refine.correlation_coeff_Fo_to_Fc 0.936 _refine.correlation_coeff_Fo_to_Fc_free 0.914 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.entry_id 1VK9 _refine.ls_R_factor_all ? _refine.ls_number_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1151 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 35 _refine_hist.number_atoms_solvent 9 _refine_hist.number_atoms_total 1195 _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 57.50 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 1176 0.014 0.021 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1577 1.504 1.976 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 146 5.523 5.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 176 0.105 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 846 0.005 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 544 0.312 0.200 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 29 0.218 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 39 0.247 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 9 0.143 0.200 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 732 1.758 3.000 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1177 3.422 5.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 444 7.109 8.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 400 10.817 11.000 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 12 _refine_ls_shell.d_res_high 2.700 _refine_ls_shell.d_res_low 2.820 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.number_reflns_R_work 887 _refine_ls_shell.R_factor_R_work 0.334 _refine_ls_shell.percent_reflns_R_free 5.54 _refine_ls_shell.number_reflns_R_free 52 _refine_ls_shell.R_factor_R_free 0.456 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 1VK9 _struct.title 'CRYSTAL STRUCTURE OF A DUF1893 family protein (TM1506) FROM THERMOTOGA MARITIMA AT 2.70 A RESOLUTION' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.text 'STRUCTURAL GENOMICS, JOINT CENTER FOR STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.entry_id 1VK9 # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 3 ? I N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9X1J4_THEMA _struct_ref.pdbx_db_accession Q9X1J4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEKNLLRSALKIFEKKDLSLLAYSGRSIFESKDSGLKPVVELFKRFDNLEGSLVIDKMVGKAAASFLLKMKPDHIHAKVI SKPALKLMNEYGQSFSYDEKIPFVLGKDGKSMCPFEKLVLEMDDPEEIIRIVLSKFTSL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1VK9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 13 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 151 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9X1J4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 139 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 139 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1VK9 MET A 1 ? UNP Q9X1J4 ? ? 'expression tag' -11 1 1 1VK9 GLY A 2 ? UNP Q9X1J4 ? ? 'expression tag' -10 2 1 1VK9 SER A 3 ? UNP Q9X1J4 ? ? 'expression tag' -9 3 1 1VK9 ASP A 4 ? UNP Q9X1J4 ? ? 'expression tag' -8 4 1 1VK9 LYS A 5 ? UNP Q9X1J4 ? ? 'expression tag' -7 5 1 1VK9 ILE A 6 ? UNP Q9X1J4 ? ? 'expression tag' -6 6 1 1VK9 HIS A 7 ? UNP Q9X1J4 ? ? 'expression tag' -5 7 1 1VK9 HIS A 8 ? UNP Q9X1J4 ? ? 'expression tag' -4 8 1 1VK9 HIS A 9 ? UNP Q9X1J4 ? ? 'expression tag' -3 9 1 1VK9 HIS A 10 ? UNP Q9X1J4 ? ? 'expression tag' -2 10 1 1VK9 HIS A 11 ? UNP Q9X1J4 ? ? 'expression tag' -1 11 1 1VK9 HIS A 12 ? UNP Q9X1J4 ? ? 'expression tag' 0 12 1 1VK9 VAL A 13 ? UNP Q9X1J4 MET 1 'SEE REMARK 999' 1 13 1 1VK9 MSE A 70 ? UNP Q9X1J4 MET 58 'modified residue' 58 14 1 1VK9 MSE A 82 ? UNP Q9X1J4 MET 70 'modified residue' 70 15 1 1VK9 MSE A 100 ? UNP Q9X1J4 MET 88 'modified residue' 88 16 1 1VK9 MSE A 124 ? UNP Q9X1J4 MET 112 'modified residue' 112 17 1 1VK9 MSE A 134 ? UNP Q9X1J4 MET 122 'modified residue' 122 18 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA,PQS tetrameric 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 14720 ? 2 MORE -950 ? 2 'SSA (A^2)' 25880 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F,G,H,I 2 1,2,3,4 A,B,C,D,E,F,G,H,I # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 66.4455000000 0.0000000000 -1.0000000000 0.0000000000 115.0869819343 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 7_555 y,x,-z+2/3 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 44.2526666667 4 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+2/3 0.5000000000 -0.8660254038 0.0000000000 66.4455000000 -0.8660254038 -0.5000000000 0.0000000000 115.0869819343 0.0000000000 0.0000000000 -1.0000000000 44.2526666667 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 14 ? LYS A 28 ? GLU A 2 LYS A 16 1 ? 15 HELX_P HELX_P2 2 LEU A 48 ? PHE A 58 ? LEU A 36 PHE A 46 1 ? 11 HELX_P HELX_P3 3 GLY A 72 ? LYS A 83 ? GLY A 60 LYS A 71 1 ? 12 HELX_P HELX_P4 4 LYS A 94 ? TYR A 103 ? LYS A 82 TYR A 91 1 ? 10 HELX_P HELX_P5 5 CYS A 125 ? GLU A 133 ? CYS A 113 GLU A 121 1 ? 9 HELX_P HELX_P6 6 ASP A 136 ? SER A 146 ? ASP A 124 SER A 134 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LYS 69 C ? ? ? 1_555 A MSE 70 N ? ? A LYS 57 A MSE 58 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale2 covale both ? A MSE 70 C ? ? ? 1_555 A VAL 71 N ? ? A MSE 58 A VAL 59 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale3 covale both ? A LYS 81 C ? ? ? 1_555 A MSE 82 N ? ? A LYS 69 A MSE 70 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale4 covale both ? A MSE 82 C ? ? ? 1_555 A LYS 83 N ? ? A MSE 70 A LYS 71 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale5 covale both ? A LEU 99 C ? ? ? 1_555 A MSE 100 N ? ? A LEU 87 A MSE 88 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale6 covale both ? A MSE 100 C ? ? ? 1_555 A ASN 101 N ? ? A MSE 88 A ASN 89 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale7 covale both ? A SER 123 C ? ? ? 1_555 A MSE 124 N ? ? A SER 111 A MSE 112 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale8 covale both ? A MSE 124 C ? ? ? 1_555 A CYS 125 N ? ? A MSE 112 A CYS 113 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale9 covale both ? A GLU 133 C ? ? ? 1_555 A MSE 134 N ? ? A GLU 121 A MSE 122 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale10 covale both ? A MSE 134 C ? ? ? 1_555 A ASP 135 N ? ? A MSE 122 A ASP 123 1_555 ? ? ? ? ? ? ? 1.336 ? ? metalc1 metalc ? ? A ASP 4 OD1 ? ? ? 1_555 C ZN . ZN ? ? A ASP -8 A ZN 141 1_555 ? ? ? ? ? ? ? 2.699 ? ? metalc2 metalc ? ? A ASP 4 OD2 ? ? ? 1_555 C ZN . ZN ? ? A ASP -8 A ZN 141 1_555 ? ? ? ? ? ? ? 2.016 ? ? metalc3 metalc ? ? A LYS 5 NZ ? ? ? 7_555 F ZN . ZN ? ? A LYS -7 A ZN 144 1_555 ? ? ? ? ? ? ? 2.048 ? ? metalc4 metalc ? ? A HIS 7 ND1 ? ? ? 1_555 G ZN . ZN ? ? A HIS -5 A ZN 145 1_555 ? ? ? ? ? ? ? 2.410 ? ? metalc5 metalc ? ? A HIS 7 ND1 ? ? ? 4_665 G ZN . ZN ? ? A HIS -5 A ZN 145 1_555 ? ? ? ? ? ? ? 2.420 ? ? metalc6 metalc ? ? A HIS 8 ND1 ? ? ? 1_555 D ZN . ZN ? ? A HIS -4 A ZN 142 1_555 ? ? ? ? ? ? ? 1.992 ? ? metalc7 metalc ? ? A HIS 9 ND1 ? ? ? 4_665 C ZN . ZN ? ? A HIS -3 A ZN 141 1_555 ? ? ? ? ? ? ? 2.025 ? ? metalc8 metalc ? ? A HIS 10 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS -2 A ZN 142 1_555 ? ? ? ? ? ? ? 2.047 ? ? metalc9 metalc ? ? A HIS 11 NE2 ? ? ? 4_665 C ZN . ZN ? ? A HIS -1 A ZN 141 1_555 ? ? ? ? ? ? ? 1.968 ? ? metalc10 metalc ? ? A ASP 59 OD1 ? ? ? 4_665 D ZN . ZN ? ? A ASP 47 A ZN 142 1_555 ? ? ? ? ? ? ? 2.507 ? ? metalc11 metalc ? ? A ASP 59 OD2 ? ? ? 4_665 D ZN . ZN ? ? A ASP 47 A ZN 142 1_555 ? ? ? ? ? ? ? 2.111 ? ? metalc12 metalc ? ? A GLU 62 OE1 ? ? ? 1_555 D ZN . ZN ? ? A GLU 50 A ZN 142 1_555 ? ? ? ? ? ? ? 1.779 ? ? metalc13 metalc ? ? A HIS 88 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 76 A ZN 143 1_555 ? ? ? ? ? ? ? 2.061 ? ? metalc14 metalc ? ? A GLU 102 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 90 A ZN 140 1_555 ? ? ? ? ? ? ? 2.177 ? ? metalc15 metalc ? ? A GLU 102 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 90 A ZN 140 1_555 ? ? ? ? ? ? ? 2.456 ? ? metalc16 metalc ? ? A GLU 102 OE1 ? ? ? 10_665 B ZN . ZN ? ? A GLU 90 A ZN 140 1_555 ? ? ? ? ? ? ? 2.046 ? ? metalc17 metalc ? ? A GLU 102 OE2 ? ? ? 10_665 B ZN . ZN ? ? A GLU 90 A ZN 140 1_555 ? ? ? ? ? ? ? 2.134 ? ? metalc18 metalc ? ? A ASP 110 OD2 ? ? ? 1_555 E ZN . ZN ? ? A ASP 98 A ZN 143 1_555 ? ? ? ? ? ? ? 1.850 ? ? metalc19 metalc ? ? A ASP 136 OD1 ? ? ? 1_555 F ZN . ZN ? ? A ASP 124 A ZN 144 1_555 ? ? ? ? ? ? ? 1.881 ? ? metalc20 metalc ? ? C ZN . ZN ? ? ? 1_555 I HOH . O ? ? A ZN 141 A HOH 204 4_665 ? ? ? ? ? ? ? 2.535 ? ? metalc21 metalc ? ? E ZN . ZN ? ? ? 1_555 I HOH . O ? ? A ZN 143 A HOH 203 1_555 ? ? ? ? ? ? ? 2.213 ? ? metalc22 metalc ? ? E ZN . ZN ? ? ? 1_555 I HOH . O ? ? A ZN 143 A HOH 205 1_555 ? ? ? ? ? ? ? 2.725 ? ? metalc23 metalc ? ? F ZN . ZN ? ? ? 1_555 I HOH . O ? ? A ZN 144 A HOH 202 7_555 ? ? ? ? ? ? ? 2.354 ? ? metalc24 metalc ? ? F ZN . ZN ? ? ? 1_555 I HOH . O ? ? A ZN 144 A HOH 207 1_555 ? ? ? ? ? ? ? 2.554 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 4 ? A ASP -8 ? 1_555 ZN ? C ZN . ? A ZN 141 ? 1_555 OD2 ? A ASP 4 ? A ASP -8 ? 1_555 51.5 ? 2 OD1 ? A ASP 4 ? A ASP -8 ? 1_555 ZN ? C ZN . ? A ZN 141 ? 1_555 ND1 ? A HIS 9 ? A HIS -3 ? 4_665 84.3 ? 3 OD2 ? A ASP 4 ? A ASP -8 ? 1_555 ZN ? C ZN . ? A ZN 141 ? 1_555 ND1 ? A HIS 9 ? A HIS -3 ? 4_665 108.5 ? 4 OD1 ? A ASP 4 ? A ASP -8 ? 1_555 ZN ? C ZN . ? A ZN 141 ? 1_555 NE2 ? A HIS 11 ? A HIS -1 ? 4_665 87.0 ? 5 OD2 ? A ASP 4 ? A ASP -8 ? 1_555 ZN ? C ZN . ? A ZN 141 ? 1_555 NE2 ? A HIS 11 ? A HIS -1 ? 4_665 110.7 ? 6 ND1 ? A HIS 9 ? A HIS -3 ? 4_665 ZN ? C ZN . ? A ZN 141 ? 1_555 NE2 ? A HIS 11 ? A HIS -1 ? 4_665 120.8 ? 7 OD1 ? A ASP 4 ? A ASP -8 ? 1_555 ZN ? C ZN . ? A ZN 141 ? 1_555 O ? I HOH . ? A HOH 204 ? 4_665 167.8 ? 8 OD2 ? A ASP 4 ? A ASP -8 ? 1_555 ZN ? C ZN . ? A ZN 141 ? 1_555 O ? I HOH . ? A HOH 204 ? 4_665 116.5 ? 9 ND1 ? A HIS 9 ? A HIS -3 ? 4_665 ZN ? C ZN . ? A ZN 141 ? 1_555 O ? I HOH . ? A HOH 204 ? 4_665 99.5 ? 10 NE2 ? A HIS 11 ? A HIS -1 ? 4_665 ZN ? C ZN . ? A ZN 141 ? 1_555 O ? I HOH . ? A HOH 204 ? 4_665 100.6 ? 11 NZ ? A LYS 5 ? A LYS -7 ? 7_555 ZN ? F ZN . ? A ZN 144 ? 1_555 OD1 ? A ASP 136 ? A ASP 124 ? 1_555 98.4 ? 12 NZ ? A LYS 5 ? A LYS -7 ? 7_555 ZN ? F ZN . ? A ZN 144 ? 1_555 O ? I HOH . ? A HOH 202 ? 7_555 104.6 ? 13 OD1 ? A ASP 136 ? A ASP 124 ? 1_555 ZN ? F ZN . ? A ZN 144 ? 1_555 O ? I HOH . ? A HOH 202 ? 7_555 126.3 ? 14 NZ ? A LYS 5 ? A LYS -7 ? 7_555 ZN ? F ZN . ? A ZN 144 ? 1_555 O ? I HOH . ? A HOH 207 ? 1_555 113.1 ? 15 OD1 ? A ASP 136 ? A ASP 124 ? 1_555 ZN ? F ZN . ? A ZN 144 ? 1_555 O ? I HOH . ? A HOH 207 ? 1_555 102.4 ? 16 O ? I HOH . ? A HOH 202 ? 7_555 ZN ? F ZN . ? A ZN 144 ? 1_555 O ? I HOH . ? A HOH 207 ? 1_555 111.4 ? 17 ND1 ? A HIS 7 ? A HIS -5 ? 1_555 ZN ? G ZN . ? A ZN 145 ? 1_555 ND1 ? A HIS 7 ? A HIS -5 ? 4_665 112.7 ? 18 ND1 ? A HIS 8 ? A HIS -4 ? 1_555 ZN ? D ZN . ? A ZN 142 ? 1_555 NE2 ? A HIS 10 ? A HIS -2 ? 1_555 120.8 ? 19 ND1 ? A HIS 8 ? A HIS -4 ? 1_555 ZN ? D ZN . ? A ZN 142 ? 1_555 OD1 ? A ASP 59 ? A ASP 47 ? 4_665 102.0 ? 20 NE2 ? A HIS 10 ? A HIS -2 ? 1_555 ZN ? D ZN . ? A ZN 142 ? 1_555 OD1 ? A ASP 59 ? A ASP 47 ? 4_665 85.7 ? 21 ND1 ? A HIS 8 ? A HIS -4 ? 1_555 ZN ? D ZN . ? A ZN 142 ? 1_555 OD2 ? A ASP 59 ? A ASP 47 ? 4_665 114.7 ? 22 NE2 ? A HIS 10 ? A HIS -2 ? 1_555 ZN ? D ZN . ? A ZN 142 ? 1_555 OD2 ? A ASP 59 ? A ASP 47 ? 4_665 116.6 ? 23 OD1 ? A ASP 59 ? A ASP 47 ? 4_665 ZN ? D ZN . ? A ZN 142 ? 1_555 OD2 ? A ASP 59 ? A ASP 47 ? 4_665 54.2 ? 24 ND1 ? A HIS 8 ? A HIS -4 ? 1_555 ZN ? D ZN . ? A ZN 142 ? 1_555 OE1 ? A GLU 62 ? A GLU 50 ? 1_555 104.7 ? 25 NE2 ? A HIS 10 ? A HIS -2 ? 1_555 ZN ? D ZN . ? A ZN 142 ? 1_555 OE1 ? A GLU 62 ? A GLU 50 ? 1_555 106.7 ? 26 OD1 ? A ASP 59 ? A ASP 47 ? 4_665 ZN ? D ZN . ? A ZN 142 ? 1_555 OE1 ? A GLU 62 ? A GLU 50 ? 1_555 138.3 ? 27 OD2 ? A ASP 59 ? A ASP 47 ? 4_665 ZN ? D ZN . ? A ZN 142 ? 1_555 OE1 ? A GLU 62 ? A GLU 50 ? 1_555 85.5 ? 28 NE2 ? A HIS 88 ? A HIS 76 ? 1_555 ZN ? E ZN . ? A ZN 143 ? 1_555 OD2 ? A ASP 110 ? A ASP 98 ? 1_555 105.5 ? 29 NE2 ? A HIS 88 ? A HIS 76 ? 1_555 ZN ? E ZN . ? A ZN 143 ? 1_555 O ? I HOH . ? A HOH 203 ? 1_555 108.6 ? 30 OD2 ? A ASP 110 ? A ASP 98 ? 1_555 ZN ? E ZN . ? A ZN 143 ? 1_555 O ? I HOH . ? A HOH 203 ? 1_555 91.3 ? 31 NE2 ? A HIS 88 ? A HIS 76 ? 1_555 ZN ? E ZN . ? A ZN 143 ? 1_555 O ? I HOH . ? A HOH 205 ? 1_555 107.3 ? 32 OD2 ? A ASP 110 ? A ASP 98 ? 1_555 ZN ? E ZN . ? A ZN 143 ? 1_555 O ? I HOH . ? A HOH 205 ? 1_555 119.0 ? 33 O ? I HOH . ? A HOH 203 ? 1_555 ZN ? E ZN . ? A ZN 143 ? 1_555 O ? I HOH . ? A HOH 205 ? 1_555 123.3 ? 34 OE1 ? A GLU 102 ? A GLU 90 ? 1_555 ZN ? B ZN . ? A ZN 140 ? 1_555 OE2 ? A GLU 102 ? A GLU 90 ? 1_555 55.1 ? 35 OE1 ? A GLU 102 ? A GLU 90 ? 1_555 ZN ? B ZN . ? A ZN 140 ? 1_555 OE1 ? A GLU 102 ? A GLU 90 ? 10_665 141.2 ? 36 OE2 ? A GLU 102 ? A GLU 90 ? 1_555 ZN ? B ZN . ? A ZN 140 ? 1_555 OE1 ? A GLU 102 ? A GLU 90 ? 10_665 88.9 ? 37 OE1 ? A GLU 102 ? A GLU 90 ? 1_555 ZN ? B ZN . ? A ZN 140 ? 1_555 OE2 ? A GLU 102 ? A GLU 90 ? 10_665 94.5 ? 38 OE2 ? A GLU 102 ? A GLU 90 ? 1_555 ZN ? B ZN . ? A ZN 140 ? 1_555 OE2 ? A GLU 102 ? A GLU 90 ? 10_665 80.3 ? 39 OE1 ? A GLU 102 ? A GLU 90 ? 10_665 ZN ? B ZN . ? A ZN 140 ? 1_555 OE2 ? A GLU 102 ? A GLU 90 ? 10_665 62.1 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 70 ? . . . . MSE A 58 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 82 ? . . . . MSE A 70 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 100 ? . . . . MSE A 88 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 124 ? . . . . MSE A 112 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 134 ? . . . . MSE A 122 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 39 ? SER A 43 ? SER A 27 SER A 31 A 2 LEU A 32 ? TYR A 35 ? LEU A 20 TYR A 23 A 3 LEU A 65 ? VAL A 71 ? LEU A 53 VAL A 59 A 4 HIS A 86 ? SER A 93 ? HIS A 74 SER A 81 A 5 PHE A 107 ? ILE A 113 ? PHE A 95 ILE A 101 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 40 ? O ILE A 28 N ALA A 34 ? N ALA A 22 A 2 3 N TYR A 35 ? N TYR A 23 O LEU A 65 ? O LEU A 53 A 3 4 N VAL A 71 ? N VAL A 59 O VAL A 91 ? O VAL A 79 A 4 5 N ALA A 89 ? N ALA A 77 O SER A 108 ? O SER A 96 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 140 ? 3 'BINDING SITE FOR RESIDUE ZN A 140' AC2 Software A ZN 141 ? 4 'BINDING SITE FOR RESIDUE ZN A 141' AC3 Software A ZN 142 ? 4 'BINDING SITE FOR RESIDUE ZN A 142' AC4 Software A ZN 143 ? 4 'BINDING SITE FOR RESIDUE ZN A 143' AC5 Software A ZN 144 ? 4 'BINDING SITE FOR RESIDUE ZN A 144' AC6 Software A ZN 145 ? 2 'BINDING SITE FOR RESIDUE ZN A 145' AC7 Software A UNL 201 ? 17 'BINDING SITE FOR RESIDUE UNL A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 GLU A 102 ? GLU A 90 . ? 1_555 ? 2 AC1 3 GLU A 102 ? GLU A 90 . ? 10_665 ? 3 AC1 3 ASP A 135 ? ASP A 123 . ? 1_555 ? 4 AC2 4 ASP A 4 ? ASP A -8 . ? 1_555 ? 5 AC2 4 HIS A 9 ? HIS A -3 . ? 4_665 ? 6 AC2 4 HIS A 11 ? HIS A -1 . ? 4_665 ? 7 AC2 4 HOH I . ? HOH A 204 . ? 4_665 ? 8 AC3 4 HIS A 10 ? HIS A -2 . ? 1_555 ? 9 AC3 4 HIS A 8 ? HIS A -4 . ? 1_555 ? 10 AC3 4 ASP A 59 ? ASP A 47 . ? 4_665 ? 11 AC3 4 GLU A 62 ? GLU A 50 . ? 1_555 ? 12 AC4 4 HIS A 88 ? HIS A 76 . ? 1_555 ? 13 AC4 4 ASP A 110 ? ASP A 98 . ? 1_555 ? 14 AC4 4 HOH I . ? HOH A 203 . ? 1_555 ? 15 AC4 4 HOH I . ? HOH A 205 . ? 1_555 ? 16 AC5 4 LYS A 5 ? LYS A -7 . ? 7_555 ? 17 AC5 4 ASP A 136 ? ASP A 124 . ? 1_555 ? 18 AC5 4 HOH I . ? HOH A 202 . ? 7_555 ? 19 AC5 4 HOH I . ? HOH A 207 . ? 1_555 ? 20 AC6 2 HIS A 7 ? HIS A -5 . ? 1_555 ? 21 AC6 2 HIS A 7 ? HIS A -5 . ? 4_665 ? 22 AC7 17 SER A 31 ? SER A 19 . ? 1_555 ? 23 AC7 17 SER A 46 ? SER A 34 . ? 1_555 ? 24 AC7 17 GLY A 47 ? GLY A 35 . ? 1_555 ? 25 AC7 17 PRO A 50 ? PRO A 38 . ? 1_555 ? 26 AC7 17 ASP A 68 ? ASP A 56 . ? 1_555 ? 27 AC7 17 LYS A 69 ? LYS A 57 . ? 1_555 ? 28 AC7 17 MSE A 70 ? MSE A 58 . ? 1_555 ? 29 AC7 17 GLY A 72 ? GLY A 60 . ? 1_555 ? 30 AC7 17 LYS A 73 ? LYS A 61 . ? 1_555 ? 31 AC7 17 ALA A 74 ? ALA A 62 . ? 1_555 ? 32 AC7 17 ALA A 75 ? ALA A 63 . ? 1_555 ? 33 AC7 17 GLU A 111 ? GLU A 99 . ? 1_555 ? 34 AC7 17 CYS A 125 ? CYS A 113 . ? 1_555 ? 35 AC7 17 PHE A 127 ? PHE A 115 . ? 1_555 ? 36 AC7 17 GLU A 128 ? GLU A 116 . ? 1_555 ? 37 AC7 17 HOH I . ? HOH A 208 . ? 1_555 ? 38 AC7 17 HOH I . ? HOH A 210 . ? 1_555 ? # _pdbx_entry_details.entry_id 1VK9 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 99 ? ? O28 A UNL 201 ? ? 1.80 2 1 OD1 A ASP 56 ? ? O4 A UNL 201 ? ? 1.95 3 1 O28 A UNL 201 ? ? O A HOH 210 ? ? 1.99 4 1 SG A CYS 113 ? ? O29 A UNL 201 ? ? 2.00 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ASP _pdbx_validate_rmsd_angle.auth_seq_id_1 98 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ASP _pdbx_validate_rmsd_angle.auth_seq_id_2 98 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 OD2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ASP _pdbx_validate_rmsd_angle.auth_seq_id_3 98 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 124.38 _pdbx_validate_rmsd_angle.angle_target_value 118.30 _pdbx_validate_rmsd_angle.angle_deviation 6.08 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.90 _pdbx_validate_rmsd_angle.linker_flag N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 17 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 35.07 _pdbx_validate_torsion.psi 58.04 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Joint Center for Structural Genomics' _pdbx_SG_project.initial_of_center JCSG # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 70 A MSE 58 ? MET SELENOMETHIONINE 2 A MSE 82 A MSE 70 ? MET SELENOMETHIONINE 3 A MSE 100 A MSE 88 ? MET SELENOMETHIONINE 4 A MSE 124 A MSE 112 ? MET SELENOMETHIONINE 5 A MSE 134 A MSE 122 ? MET SELENOMETHIONINE # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id ZN _pdbx_struct_special_symmetry.auth_seq_id 145 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id G _pdbx_struct_special_symmetry.label_comp_id ZN _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.pdbx_refine_id 1 . refined 17.9770 62.1040 37.9580 0.1866 0.5788 0.2187 -0.0728 0.0225 0.0166 5.8079 2.3452 1.8169 -1.4426 -0.9293 0.1555 0.0888 0.1379 -0.2266 -1.2350 -0.0878 0.2366 0.1623 -0.0898 0.0375 'X-RAY DIFFRACTION' 2 . refined 7.2440 67.3930 41.7830 0.1025 0.1546 0.0629 0.0730 0.0781 0.0369 8.8792 5.7071 0.3174 9.6866 11.9416 6.1962 -0.3049 -0.0779 0.3828 -0.6762 0.0862 0.0819 0.5837 -0.6669 -0.1624 'X-RAY DIFFRACTION' # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.selection_details 1 1 A 2 A 148 ALL A -10 A 136 'X-RAY DIFFRACTION' ? 2 2 H 1 H 1 ALL A 201 A 201 'X-RAY DIFFRACTION' ? # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;SEQUENCE FOR THE VAL/MET CONFLICT AT RESIDUE 1: THIS GENE USES AN ALTERNATE INITIATION CODON THAT RESULTS IN A VALINE AT POSITION 1 WHEN EXPRESSED AS A FUSION. ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -11 ? A MET 1 2 1 Y 1 A THR 137 ? A THR 149 3 1 Y 1 A SER 138 ? A SER 150 4 1 Y 1 A LEU 139 ? A LEU 151 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MSE N N N N 250 MSE CA C N S 251 MSE C C N N 252 MSE O O N N 253 MSE OXT O N N 254 MSE CB C N N 255 MSE CG C N N 256 MSE SE SE N N 257 MSE CE C N N 258 MSE H H N N 259 MSE H2 H N N 260 MSE HA H N N 261 MSE HXT H N N 262 MSE HB2 H N N 263 MSE HB3 H N N 264 MSE HG2 H N N 265 MSE HG3 H N N 266 MSE HE1 H N N 267 MSE HE2 H N N 268 MSE HE3 H N N 269 PHE N N N N 270 PHE CA C N S 271 PHE C C N N 272 PHE O O N N 273 PHE CB C N N 274 PHE CG C Y N 275 PHE CD1 C Y N 276 PHE CD2 C Y N 277 PHE CE1 C Y N 278 PHE CE2 C Y N 279 PHE CZ C Y N 280 PHE OXT O N N 281 PHE H H N N 282 PHE H2 H N N 283 PHE HA H N N 284 PHE HB2 H N N 285 PHE HB3 H N N 286 PHE HD1 H N N 287 PHE HD2 H N N 288 PHE HE1 H N N 289 PHE HE2 H N N 290 PHE HZ H N N 291 PHE HXT H N N 292 PRO N N N N 293 PRO CA C N S 294 PRO C C N N 295 PRO O O N N 296 PRO CB C N N 297 PRO CG C N N 298 PRO CD C N N 299 PRO OXT O N N 300 PRO H H N N 301 PRO HA H N N 302 PRO HB2 H N N 303 PRO HB3 H N N 304 PRO HG2 H N N 305 PRO HG3 H N N 306 PRO HD2 H N N 307 PRO HD3 H N N 308 PRO HXT H N N 309 SER N N N N 310 SER CA C N S 311 SER C C N N 312 SER O O N N 313 SER CB C N N 314 SER OG O N N 315 SER OXT O N N 316 SER H H N N 317 SER H2 H N N 318 SER HA H N N 319 SER HB2 H N N 320 SER HB3 H N N 321 SER HG H N N 322 SER HXT H N N 323 THR N N N N 324 THR CA C N S 325 THR C C N N 326 THR O O N N 327 THR CB C N R 328 THR OG1 O N N 329 THR CG2 C N N 330 THR OXT O N N 331 THR H H N N 332 THR H2 H N N 333 THR HA H N N 334 THR HB H N N 335 THR HG1 H N N 336 THR HG21 H N N 337 THR HG22 H N N 338 THR HG23 H N N 339 THR HXT H N N 340 TYR N N N N 341 TYR CA C N S 342 TYR C C N N 343 TYR O O N N 344 TYR CB C N N 345 TYR CG C Y N 346 TYR CD1 C Y N 347 TYR CD2 C Y N 348 TYR CE1 C Y N 349 TYR CE2 C Y N 350 TYR CZ C Y N 351 TYR OH O N N 352 TYR OXT O N N 353 TYR H H N N 354 TYR H2 H N N 355 TYR HA H N N 356 TYR HB2 H N N 357 TYR HB3 H N N 358 TYR HD1 H N N 359 TYR HD2 H N N 360 TYR HE1 H N N 361 TYR HE2 H N N 362 TYR HH H N N 363 TYR HXT H N N 364 VAL N N N N 365 VAL CA C N S 366 VAL C C N N 367 VAL O O N N 368 VAL CB C N N 369 VAL CG1 C N N 370 VAL CG2 C N N 371 VAL OXT O N N 372 VAL H H N N 373 VAL H2 H N N 374 VAL HA H N N 375 VAL HB H N N 376 VAL HG11 H N N 377 VAL HG12 H N N 378 VAL HG13 H N N 379 VAL HG21 H N N 380 VAL HG22 H N N 381 VAL HG23 H N N 382 VAL HXT H N N 383 ZN ZN ZN N N 384 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 MSE N CA sing N N 237 MSE N H sing N N 238 MSE N H2 sing N N 239 MSE CA C sing N N 240 MSE CA CB sing N N 241 MSE CA HA sing N N 242 MSE C O doub N N 243 MSE C OXT sing N N 244 MSE OXT HXT sing N N 245 MSE CB CG sing N N 246 MSE CB HB2 sing N N 247 MSE CB HB3 sing N N 248 MSE CG SE sing N N 249 MSE CG HG2 sing N N 250 MSE CG HG3 sing N N 251 MSE SE CE sing N N 252 MSE CE HE1 sing N N 253 MSE CE HE2 sing N N 254 MSE CE HE3 sing N N 255 PHE N CA sing N N 256 PHE N H sing N N 257 PHE N H2 sing N N 258 PHE CA C sing N N 259 PHE CA CB sing N N 260 PHE CA HA sing N N 261 PHE C O doub N N 262 PHE C OXT sing N N 263 PHE CB CG sing N N 264 PHE CB HB2 sing N N 265 PHE CB HB3 sing N N 266 PHE CG CD1 doub Y N 267 PHE CG CD2 sing Y N 268 PHE CD1 CE1 sing Y N 269 PHE CD1 HD1 sing N N 270 PHE CD2 CE2 doub Y N 271 PHE CD2 HD2 sing N N 272 PHE CE1 CZ doub Y N 273 PHE CE1 HE1 sing N N 274 PHE CE2 CZ sing Y N 275 PHE CE2 HE2 sing N N 276 PHE CZ HZ sing N N 277 PHE OXT HXT sing N N 278 PRO N CA sing N N 279 PRO N CD sing N N 280 PRO N H sing N N 281 PRO CA C sing N N 282 PRO CA CB sing N N 283 PRO CA HA sing N N 284 PRO C O doub N N 285 PRO C OXT sing N N 286 PRO CB CG sing N N 287 PRO CB HB2 sing N N 288 PRO CB HB3 sing N N 289 PRO CG CD sing N N 290 PRO CG HG2 sing N N 291 PRO CG HG3 sing N N 292 PRO CD HD2 sing N N 293 PRO CD HD3 sing N N 294 PRO OXT HXT sing N N 295 SER N CA sing N N 296 SER N H sing N N 297 SER N H2 sing N N 298 SER CA C sing N N 299 SER CA CB sing N N 300 SER CA HA sing N N 301 SER C O doub N N 302 SER C OXT sing N N 303 SER CB OG sing N N 304 SER CB HB2 sing N N 305 SER CB HB3 sing N N 306 SER OG HG sing N N 307 SER OXT HXT sing N N 308 THR N CA sing N N 309 THR N H sing N N 310 THR N H2 sing N N 311 THR CA C sing N N 312 THR CA CB sing N N 313 THR CA HA sing N N 314 THR C O doub N N 315 THR C OXT sing N N 316 THR CB OG1 sing N N 317 THR CB CG2 sing N N 318 THR CB HB sing N N 319 THR OG1 HG1 sing N N 320 THR CG2 HG21 sing N N 321 THR CG2 HG22 sing N N 322 THR CG2 HG23 sing N N 323 THR OXT HXT sing N N 324 TYR N CA sing N N 325 TYR N H sing N N 326 TYR N H2 sing N N 327 TYR CA C sing N N 328 TYR CA CB sing N N 329 TYR CA HA sing N N 330 TYR C O doub N N 331 TYR C OXT sing N N 332 TYR CB CG sing N N 333 TYR CB HB2 sing N N 334 TYR CB HB3 sing N N 335 TYR CG CD1 doub Y N 336 TYR CG CD2 sing Y N 337 TYR CD1 CE1 sing Y N 338 TYR CD1 HD1 sing N N 339 TYR CD2 CE2 doub Y N 340 TYR CD2 HD2 sing N N 341 TYR CE1 CZ doub Y N 342 TYR CE1 HE1 sing N N 343 TYR CE2 CZ sing Y N 344 TYR CE2 HE2 sing N N 345 TYR CZ OH sing N N 346 TYR OH HH sing N N 347 TYR OXT HXT sing N N 348 VAL N CA sing N N 349 VAL N H sing N N 350 VAL N H2 sing N N 351 VAL CA C sing N N 352 VAL CA CB sing N N 353 VAL CA HA sing N N 354 VAL C O doub N N 355 VAL C OXT sing N N 356 VAL CB CG1 sing N N 357 VAL CB CG2 sing N N 358 VAL CB HB sing N N 359 VAL CG1 HG11 sing N N 360 VAL CG1 HG12 sing N N 361 VAL CG1 HG13 sing N N 362 VAL CG2 HG21 sing N N 363 VAL CG2 HG22 sing N N 364 VAL CG2 HG23 sing N N 365 VAL OXT HXT sing N N 366 # _atom_sites.entry_id 1VK9 _atom_sites.fract_transf_matrix[1][1] 0.007525 _atom_sites.fract_transf_matrix[1][2] 0.004345 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008689 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015065 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE ZN # loop_