data_1W4U # _entry.id 1W4U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1W4U pdb_00001w4u 10.2210/pdb1w4u/pdb PDBE EBI-20615 ? ? WWPDB D_1290020615 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-10 2 'Structure model' 1 1 2017-04-19 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' Other 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_mr' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1W4U _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2004-07-29 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1UR6 _pdbx_database_related.content_type unspecified _pdbx_database_related.details 'NMR BASED STRUCTURAL MODEL OF THE UBCH5B- CNOT4 COMPLEX' # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Houben, K.' 1 'Dominguez, C.' 2 'Van Schaik, F.M.A.' 3 'Timmers, H.T.M.' 4 'Bonvin, A.M.J.J.' 5 'Boelens, R.' 6 # _citation.id primary _citation.title 'Solution Structure of the Ubiquitin-Conjugating Enzyme Ubch5B' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 344 _citation.page_first 513 _citation.page_last ? _citation.year 2004 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15522302 _citation.pdbx_database_id_DOI 10.1016/J.JMB.2004.09.054 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Houben, K.' 1 ? primary 'Dominguez, C.' 2 ? primary 'Van Schaik, F.M.A.' 3 ? primary 'Timmers, H.T.M.' 4 ? primary 'Bonvin, A.M.J.J.' 5 ? primary 'Boelens, R.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'UBIQUITIN-CONJUGATING ENZYME E2-17 KDA 2' _entity.formula_weight 16755.227 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 6.3.2.19 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'UBCH5B, UBIQUITIN-PROTEIN LIGASE, UBIQUITIN CARRIER PROTEIN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS NGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM ; _entity_poly.pdbx_seq_one_letter_code_can ;MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS NGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 LEU n 1 4 LYS n 1 5 ARG n 1 6 ILE n 1 7 HIS n 1 8 LYS n 1 9 GLU n 1 10 LEU n 1 11 ASN n 1 12 ASP n 1 13 LEU n 1 14 ALA n 1 15 ARG n 1 16 ASP n 1 17 PRO n 1 18 PRO n 1 19 ALA n 1 20 GLN n 1 21 CYS n 1 22 SER n 1 23 ALA n 1 24 GLY n 1 25 PRO n 1 26 VAL n 1 27 GLY n 1 28 ASP n 1 29 ASP n 1 30 MET n 1 31 PHE n 1 32 HIS n 1 33 TRP n 1 34 GLN n 1 35 ALA n 1 36 THR n 1 37 ILE n 1 38 MET n 1 39 GLY n 1 40 PRO n 1 41 ASN n 1 42 ASP n 1 43 SER n 1 44 PRO n 1 45 TYR n 1 46 GLN n 1 47 GLY n 1 48 GLY n 1 49 VAL n 1 50 PHE n 1 51 PHE n 1 52 LEU n 1 53 THR n 1 54 ILE n 1 55 HIS n 1 56 PHE n 1 57 PRO n 1 58 THR n 1 59 ASP n 1 60 TYR n 1 61 PRO n 1 62 PHE n 1 63 LYS n 1 64 PRO n 1 65 PRO n 1 66 LYS n 1 67 VAL n 1 68 ALA n 1 69 PHE n 1 70 THR n 1 71 THR n 1 72 ARG n 1 73 ILE n 1 74 TYR n 1 75 HIS n 1 76 PRO n 1 77 ASN n 1 78 ILE n 1 79 ASN n 1 80 SER n 1 81 ASN n 1 82 GLY n 1 83 SER n 1 84 ILE n 1 85 CYS n 1 86 LEU n 1 87 ASP n 1 88 ILE n 1 89 LEU n 1 90 ARG n 1 91 SER n 1 92 GLN n 1 93 TRP n 1 94 SER n 1 95 PRO n 1 96 ALA n 1 97 LEU n 1 98 THR n 1 99 ILE n 1 100 SER n 1 101 LYS n 1 102 VAL n 1 103 LEU n 1 104 LEU n 1 105 SER n 1 106 ILE n 1 107 CYS n 1 108 SER n 1 109 LEU n 1 110 LEU n 1 111 CYS n 1 112 ASP n 1 113 PRO n 1 114 ASN n 1 115 PRO n 1 116 ASP n 1 117 ASP n 1 118 PRO n 1 119 LEU n 1 120 VAL n 1 121 PRO n 1 122 GLU n 1 123 ILE n 1 124 ALA n 1 125 ARG n 1 126 ILE n 1 127 TYR n 1 128 LYS n 1 129 THR n 1 130 ASP n 1 131 ARG n 1 132 GLU n 1 133 LYS n 1 134 TYR n 1 135 ASN n 1 136 ARG n 1 137 ILE n 1 138 ALA n 1 139 ARG n 1 140 GLU n 1 141 TRP n 1 142 THR n 1 143 GLN n 1 144 LYS n 1 145 TYR n 1 146 ALA n 1 147 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 TRP 33 33 33 TRP TRP A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 TRP 93 93 93 TRP TRP A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 CYS 107 107 107 CYS CYS A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 CYS 111 111 111 CYS CYS A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 TYR 134 134 134 TYR TYR A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 TRP 141 141 141 TRP TRP A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 TYR 145 145 145 TYR TYR A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 MET 147 147 147 MET MET A . n # _cell.entry_id 1W4U _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1W4U _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1W4U _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1W4U _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1W4U _struct.title 'NMR solution structure of the ubiquitin conjugating enzyme UbcH5B' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1W4U _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text 'UBIQUITINATION, E2 ENZYME, LIGASE, BL CONJUGATION PATHWAY' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UB5B_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P51669 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1W4U _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 147 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P51669 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 147 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 147 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 2 ? LEU A 10 ? ALA A 2 LEU A 10 1 ? 9 HELX_P HELX_P2 2 ASN A 11 ? ASP A 16 ? ASN A 11 ASP A 16 1 ? 6 HELX_P HELX_P3 3 LEU A 86 ? SER A 91 ? LEU A 86 SER A 91 1 ? 6 HELX_P HELX_P4 4 THR A 98 ? ASP A 112 ? THR A 98 ASP A 112 1 ? 15 HELX_P HELX_P5 5 GLU A 122 ? THR A 129 ? GLU A 122 THR A 129 1 ? 8 HELX_P HELX_P6 6 ASP A 130 ? TYR A 145 ? ASP A 130 TYR A 145 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 60 A . ? TYR 60 A PRO 61 A ? PRO 61 A 1 0.43 2 TYR 60 A . ? TYR 60 A PRO 61 A ? PRO 61 A 2 0.46 3 TYR 60 A . ? TYR 60 A PRO 61 A ? PRO 61 A 3 0.24 4 TYR 60 A . ? TYR 60 A PRO 61 A ? PRO 61 A 4 0.50 5 TYR 60 A . ? TYR 60 A PRO 61 A ? PRO 61 A 5 -0.76 6 TYR 60 A . ? TYR 60 A PRO 61 A ? PRO 61 A 6 0.41 7 TYR 60 A . ? TYR 60 A PRO 61 A ? PRO 61 A 7 0.25 8 TYR 60 A . ? TYR 60 A PRO 61 A ? PRO 61 A 8 -0.30 9 TYR 60 A . ? TYR 60 A PRO 61 A ? PRO 61 A 9 0.49 10 TYR 60 A . ? TYR 60 A PRO 61 A ? PRO 61 A 10 0.61 # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 TRP A 33 ? MET A 38 ? TRP A 33 MET A 38 AA 2 VAL A 49 ? HIS A 55 ? VAL A 49 HIS A 55 AA 3 LYS A 66 ? PHE A 69 ? LYS A 66 PHE A 69 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ILE A 37 ? N ILE A 37 O PHE A 50 ? O PHE A 50 AA 2 3 N HIS A 55 ? N HIS A 55 O LYS A 66 ? O LYS A 66 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG A CYS 85 ? ? OD1 A ASP 117 ? ? 1.56 2 1 O A ASP 87 ? ? H A SER 91 ? ? 1.56 3 1 HG A SER 43 ? ? O A LEU 110 ? ? 1.57 4 2 OE2 A GLU 140 ? ? HZ1 A LYS 144 ? ? 1.57 5 3 HH21 A ARG 5 ? ? HH A TYR 60 ? ? 1.01 6 3 O A GLU 140 ? ? H A LYS 144 ? ? 1.59 7 3 O A ASP 87 ? ? H A SER 91 ? ? 1.59 8 4 O A ASP 87 ? ? H A SER 91 ? ? 1.57 9 4 OE1 A GLU 140 ? ? HZ1 A LYS 144 ? ? 1.59 10 4 HG A CYS 85 ? ? OD2 A ASP 117 ? ? 1.59 11 5 O A GLU 122 ? ? H A ARG 125 ? ? 1.54 12 5 O A ARG 131 ? ? HD21 A ASN 135 ? ? 1.57 13 6 OD1 A ASP 116 ? ? HZ3 A LYS 128 ? ? 1.56 14 6 HH A TYR 45 ? ? O A TYR 74 ? ? 1.59 15 6 O A MET 38 ? ? HG A CYS 107 ? ? 1.60 16 7 OE1 A GLU 9 ? ? HZ1 A LYS 63 ? ? 1.48 17 7 O A ASP 87 ? ? H A GLN 92 ? ? 1.54 18 7 O A ASP 42 ? ? HG A CYS 111 ? ? 1.59 19 8 OE2 A GLU 140 ? ? HZ2 A LYS 144 ? ? 1.54 20 8 O A SER 108 ? ? H A ASP 112 ? ? 1.56 21 9 OE1 A GLU 9 ? ? HZ1 A LYS 63 ? ? 1.53 22 9 O A GLY 39 ? ? HG A SER 43 ? ? 1.59 23 10 O A ASP 87 ? ? H A GLN 92 ? ? 1.57 24 10 O A SER 108 ? ? H A ASP 112 ? ? 1.59 25 10 HZ2 A LYS 8 ? ? OE2 A GLU 9 ? ? 1.59 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 8 CE1 A TYR 45 ? ? CZ A TYR 45 ? ? 1.483 1.381 0.102 0.013 N 2 8 CZ A TYR 45 ? ? CE2 A TYR 45 ? ? 1.274 1.381 -0.107 0.013 N 3 9 CE1 A TYR 74 ? ? CZ A TYR 74 ? ? 1.303 1.381 -0.078 0.013 N 4 9 CZ A TYR 74 ? ? CE2 A TYR 74 ? ? 1.462 1.381 0.081 0.013 N 5 9 CE1 A TYR 127 ? ? CZ A TYR 127 ? ? 1.460 1.381 0.079 0.013 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 18 ? ? -84.60 -80.16 2 1 GLN A 20 ? ? 49.77 11.87 3 1 CYS A 21 ? ? -162.19 115.94 4 1 ASP A 28 ? ? 72.55 -4.45 5 1 PRO A 40 ? ? -24.22 94.10 6 1 ASN A 41 ? ? 171.27 -86.73 7 1 ASP A 42 ? ? -152.47 89.44 8 1 TYR A 45 ? ? -106.38 40.51 9 1 THR A 58 ? ? 24.46 68.63 10 1 TYR A 60 ? ? -39.96 142.33 11 1 HIS A 75 ? ? -179.99 141.03 12 1 SER A 80 ? ? -62.05 14.62 13 1 ILE A 88 ? ? -58.76 -1.04 14 1 PRO A 95 ? ? -66.36 22.76 15 1 PRO A 113 ? ? 0.36 103.89 16 1 PRO A 115 ? ? -101.71 45.61 17 1 ASP A 116 ? ? -119.95 -74.94 18 1 THR A 129 ? ? -151.61 -63.62 19 1 ARG A 131 ? ? -39.10 -29.60 20 1 ALA A 146 ? ? -99.41 -97.68 21 2 PRO A 18 ? ? -72.17 -70.33 22 2 GLN A 20 ? ? 57.74 -30.04 23 2 VAL A 26 ? ? -105.49 -62.32 24 2 ASP A 28 ? ? 74.16 -14.92 25 2 ASN A 41 ? ? 60.03 -78.97 26 2 THR A 58 ? ? 32.19 67.49 27 2 PHE A 62 ? ? -88.52 -86.06 28 2 LYS A 63 ? ? 87.82 77.40 29 2 HIS A 75 ? ? -53.97 92.62 30 2 ASN A 81 ? ? -82.41 -95.34 31 2 PRO A 95 ? ? -63.20 67.19 32 2 ALA A 96 ? ? -164.41 -19.83 33 2 PRO A 113 ? ? 1.01 108.28 34 2 ASP A 116 ? ? -78.58 -73.55 35 2 THR A 129 ? ? -152.56 -73.52 36 2 TYR A 145 ? ? -145.22 -16.27 37 2 ALA A 146 ? ? -125.94 -74.36 38 3 PRO A 18 ? ? -85.42 -70.81 39 3 GLN A 20 ? ? 52.51 1.36 40 3 SER A 22 ? ? -171.45 126.11 41 3 ASP A 28 ? ? 76.33 -10.60 42 3 ASN A 41 ? ? -37.41 115.25 43 3 THR A 58 ? ? 27.22 62.51 44 3 HIS A 75 ? ? 167.20 121.67 45 3 SER A 80 ? ? -28.53 -44.33 46 3 ASN A 81 ? ? -82.58 -94.50 47 3 ILE A 88 ? ? -57.36 -5.70 48 3 PRO A 95 ? ? -64.98 79.55 49 3 ALA A 96 ? ? -177.12 -36.72 50 3 CYS A 111 ? ? -94.34 -71.71 51 3 ASP A 112 ? ? -97.26 -60.94 52 3 PRO A 113 ? ? -116.98 -153.83 53 3 ASN A 114 ? ? 156.24 -4.29 54 3 PRO A 115 ? ? -62.78 85.57 55 3 ASP A 116 ? ? -146.56 -46.83 56 3 ASP A 117 ? ? 32.16 54.88 57 3 LEU A 119 ? ? -106.66 -82.81 58 3 THR A 129 ? ? -150.64 -74.29 59 3 ALA A 146 ? ? -119.73 -99.14 60 4 PRO A 18 ? ? -72.64 -80.05 61 4 ALA A 19 ? ? -161.00 -70.03 62 4 CYS A 21 ? ? -164.01 109.40 63 4 ASP A 28 ? ? 72.61 -4.95 64 4 PRO A 40 ? ? -73.36 -158.03 65 4 SER A 43 ? ? -171.19 147.85 66 4 TYR A 45 ? ? -107.88 42.87 67 4 THR A 58 ? ? 29.16 65.35 68 4 SER A 80 ? ? -57.47 -6.14 69 4 ILE A 88 ? ? -68.44 2.75 70 4 PRO A 95 ? ? -69.39 32.51 71 4 LEU A 97 ? ? -88.46 -142.84 72 4 THR A 98 ? ? 92.21 102.01 73 4 ILE A 99 ? ? 66.27 -77.47 74 4 PRO A 113 ? ? 7.78 96.47 75 4 ASP A 116 ? ? -138.24 -77.70 76 4 ASP A 117 ? ? -39.17 101.37 77 4 LEU A 119 ? ? -129.19 -58.01 78 4 THR A 129 ? ? -150.17 -73.16 79 4 ALA A 146 ? ? -108.74 -97.07 80 5 ALA A 19 ? ? -169.78 -70.35 81 5 PRO A 40 ? ? -16.04 136.20 82 5 ASN A 41 ? ? 77.42 165.11 83 5 ASP A 42 ? ? -62.98 85.83 84 5 THR A 58 ? ? 31.59 75.52 85 5 PHE A 62 ? ? -75.55 -88.51 86 5 LYS A 63 ? ? 83.76 87.56 87 5 PRO A 65 ? ? -64.60 99.06 88 5 ASN A 77 ? ? -175.74 34.48 89 5 SER A 80 ? ? -39.11 -39.60 90 5 ASN A 81 ? ? -107.87 46.66 91 5 SER A 91 ? ? -125.18 -52.65 92 5 PRO A 95 ? ? -63.18 71.31 93 5 ALA A 96 ? ? -169.06 -27.58 94 5 CYS A 111 ? ? -92.92 -71.46 95 5 ASP A 112 ? ? -100.62 -63.89 96 5 PRO A 113 ? ? -129.20 -157.21 97 5 PRO A 115 ? ? -60.11 2.99 98 5 ASP A 116 ? ? 54.43 74.74 99 5 PRO A 118 ? ? -65.67 67.08 100 5 THR A 129 ? ? -135.02 -77.18 101 5 ALA A 146 ? ? -148.61 -8.18 102 6 GLN A 20 ? ? 49.29 8.51 103 6 CYS A 21 ? ? -175.20 114.46 104 6 ASP A 28 ? ? 83.00 -17.93 105 6 MET A 30 ? ? -58.73 21.24 106 6 HIS A 32 ? ? -152.88 85.80 107 6 PRO A 40 ? ? -67.93 -164.51 108 6 ASP A 42 ? ? 61.74 96.06 109 6 THR A 58 ? ? 24.59 63.87 110 6 TYR A 60 ? ? -36.22 135.51 111 6 PRO A 64 ? ? -103.26 76.49 112 6 HIS A 75 ? ? 176.70 134.36 113 6 SER A 80 ? ? -65.47 10.74 114 6 SER A 91 ? ? -140.37 -44.74 115 6 PRO A 95 ? ? -63.07 65.52 116 6 ALA A 96 ? ? -156.27 -40.08 117 6 CYS A 111 ? ? -93.51 -73.31 118 6 ASP A 112 ? ? -99.87 -63.24 119 6 PRO A 113 ? ? -127.34 -165.05 120 6 PRO A 115 ? ? -62.99 11.51 121 6 ASP A 116 ? ? 50.04 75.02 122 6 PRO A 118 ? ? -67.74 65.65 123 6 THR A 129 ? ? -137.23 -78.37 124 6 ARG A 131 ? ? 79.70 -36.79 125 7 PRO A 18 ? ? -71.66 -71.02 126 7 ALA A 19 ? ? -165.66 -72.48 127 7 PRO A 25 ? ? -68.79 55.55 128 7 ASP A 28 ? ? 83.19 34.75 129 7 MET A 30 ? ? -63.46 16.20 130 7 PRO A 40 ? ? -27.82 146.38 131 7 ASN A 41 ? ? 89.22 -59.88 132 7 ASP A 42 ? ? -160.12 105.71 133 7 THR A 58 ? ? -57.04 65.21 134 7 PHE A 62 ? ? -67.56 -91.86 135 7 LYS A 63 ? ? 72.17 101.71 136 7 HIS A 75 ? ? -170.61 133.11 137 7 PRO A 76 ? ? -62.38 91.84 138 7 ASN A 77 ? ? 156.47 -13.93 139 7 SER A 80 ? ? -38.96 -39.78 140 7 ILE A 88 ? ? -56.99 -7.93 141 7 SER A 91 ? ? -147.29 -41.45 142 7 PRO A 95 ? ? -63.96 53.18 143 7 ALA A 96 ? ? -166.12 2.13 144 7 PRO A 113 ? ? 1.37 105.07 145 7 THR A 129 ? ? -141.78 -59.81 146 7 ARG A 131 ? ? 89.06 -37.53 147 7 ALA A 146 ? ? -145.85 -93.29 148 8 ALA A 19 ? ? -166.31 -77.50 149 8 GLN A 20 ? ? -79.32 22.34 150 8 ASP A 28 ? ? 71.77 -0.05 151 8 HIS A 32 ? ? -150.93 88.72 152 8 PRO A 40 ? ? -29.39 105.51 153 8 ASN A 41 ? ? 163.77 -72.13 154 8 ASP A 42 ? ? -173.42 100.96 155 8 GLN A 46 ? ? -60.73 98.57 156 8 THR A 58 ? ? 28.94 71.50 157 8 HIS A 75 ? ? 167.03 111.63 158 8 PRO A 76 ? ? -63.57 95.76 159 8 ASN A 77 ? ? 155.93 -16.96 160 8 SER A 80 ? ? -69.52 32.13 161 8 ASN A 81 ? ? -146.24 20.35 162 8 SER A 91 ? ? -145.54 -43.26 163 8 PRO A 95 ? ? -68.84 37.28 164 8 ALA A 96 ? ? -147.40 16.40 165 8 LEU A 97 ? ? -91.39 38.05 166 8 THR A 98 ? ? -66.95 -175.03 167 8 CYS A 111 ? ? -94.07 -68.50 168 8 ASP A 112 ? ? -97.24 -61.57 169 8 PRO A 113 ? ? -109.70 -152.65 170 8 ASN A 114 ? ? 171.47 -53.29 171 8 PRO A 115 ? ? -46.97 101.09 172 8 ASP A 116 ? ? -173.62 -70.92 173 8 ASP A 117 ? ? 44.58 102.63 174 8 LEU A 119 ? ? -100.15 -87.11 175 8 THR A 129 ? ? -146.25 -69.83 176 8 ASP A 130 ? ? -101.49 72.81 177 8 ALA A 146 ? ? -132.79 -71.88 178 9 PRO A 18 ? ? -81.76 -154.01 179 9 HIS A 32 ? ? -152.77 89.78 180 9 PRO A 40 ? ? -49.96 174.70 181 9 ASN A 41 ? ? 76.46 -90.58 182 9 THR A 58 ? ? 31.83 63.06 183 9 PHE A 62 ? ? -95.63 -82.20 184 9 LYS A 63 ? ? 87.18 69.23 185 9 HIS A 75 ? ? -38.58 106.53 186 9 ASN A 77 ? ? 110.54 28.05 187 9 SER A 80 ? ? -59.50 10.03 188 9 SER A 91 ? ? -145.84 -40.44 189 9 PRO A 95 ? ? -64.40 71.42 190 9 ALA A 96 ? ? -162.80 -37.70 191 9 PRO A 113 ? ? -0.90 104.83 192 9 ASP A 116 ? ? -155.62 -62.90 193 9 LEU A 119 ? ? -139.43 -62.41 194 9 THR A 129 ? ? -142.34 -71.95 195 9 ARG A 131 ? ? 78.67 -72.68 196 10 PRO A 17 ? ? -40.48 109.05 197 10 GLN A 20 ? ? 49.98 3.00 198 10 VAL A 26 ? ? -103.76 -60.79 199 10 ASP A 28 ? ? 73.52 -5.06 200 10 PRO A 40 ? ? -61.86 -172.80 201 10 TYR A 45 ? ? -111.19 52.71 202 10 THR A 58 ? ? 25.13 73.04 203 10 PHE A 62 ? ? 154.90 -78.25 204 10 LYS A 63 ? ? 70.33 80.60 205 10 PRO A 76 ? ? -68.75 7.73 206 10 SER A 80 ? ? -46.57 -16.75 207 10 SER A 91 ? ? -154.16 -36.66 208 10 TRP A 93 ? ? -131.62 -151.46 209 10 SER A 94 ? ? -174.11 -131.78 210 10 LEU A 97 ? ? -36.58 104.61 211 10 CYS A 111 ? ? -94.07 -71.79 212 10 ASP A 112 ? ? -99.98 -62.05 213 10 PRO A 113 ? ? -115.14 -150.69 214 10 ASN A 114 ? ? 168.44 79.29 215 10 ASP A 116 ? ? -118.50 -80.31 216 10 ASP A 117 ? ? 103.58 -65.89 217 10 PRO A 118 ? ? -87.84 38.16 218 10 THR A 129 ? ? -151.34 -73.94 219 10 ARG A 131 ? ? 81.71 -45.71 220 10 ALA A 146 ? ? -112.67 55.53 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 5 TYR A 134 ? ? 0.088 'SIDE CHAIN' 2 9 TYR A 127 ? ? 0.064 'SIDE CHAIN' 3 10 PHE A 50 ? ? 0.063 'SIDE CHAIN' # _pdbx_entry_details.entry_id 1W4U _pdbx_entry_details.compound_details ;CATALYZES THE COVALENT ATTACHMENT OF UBIQUITIN TO OTHER PROTEINS ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_nmr_ensemble.entry_id 1W4U _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST ENERGY' # _pdbx_nmr_representative.entry_id 1W4U _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20MM KPI, 150MM KCL, 0.01MM ZNCL2, 10%D2O, UBCH5B 0.3MM' _pdbx_nmr_sample_details.solvent_system ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300.0 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? # _pdbx_nmr_details.entry_id 1W4U _pdbx_nmr_details.text NONE # _pdbx_nmr_refine.entry_id 1W4U _pdbx_nmr_refine.method ARIA _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS, GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,READ, RICE,SIMONSON,WARREN' 1 'structure solution' CNS ? ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 700 ? 2 AVANCE Bruker 750 ? 3 AVANCE Bruker 900 ? 4 AVANCE Bruker 500 ? # _atom_sites.entry_id 1W4U _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_