data_1WE9 # _entry.id 1WE9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WE9 pdb_00001we9 10.2210/pdb1we9/pdb RCSB RCSB023486 ? ? WWPDB D_1000023486 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id atr001002138.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WE9 _pdbx_database_status.recvd_initial_deposition_date 2004-05-24 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'He, F.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Shirouzu, M.' 5 'Terada, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of PHD domain in nucleic acid binding protein-like NP_197993' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, F.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Terada, T.' 6 ? primary 'Yokoyama, S.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PHD finger family protein' 6790.635 1 ? ? 'PHD domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGQCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGQCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier atr001002138.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLN n 1 9 CYS n 1 10 GLY n 1 11 ALA n 1 12 CYS n 1 13 GLY n 1 14 GLU n 1 15 SER n 1 16 TYR n 1 17 ALA n 1 18 ALA n 1 19 ASP n 1 20 GLU n 1 21 PHE n 1 22 TRP n 1 23 ILE n 1 24 CYS n 1 25 CYS n 1 26 ASP n 1 27 LEU n 1 28 CYS n 1 29 GLU n 1 30 MET n 1 31 TRP n 1 32 PHE n 1 33 HIS n 1 34 GLY n 1 35 LYS n 1 36 CYS n 1 37 VAL n 1 38 LYS n 1 39 ILE n 1 40 THR n 1 41 PRO n 1 42 ALA n 1 43 ARG n 1 44 ALA n 1 45 GLU n 1 46 HIS n 1 47 ILE n 1 48 LYS n 1 49 GLN n 1 50 TYR n 1 51 LYS n 1 52 CYS n 1 53 PRO n 1 54 SER n 1 55 CYS n 1 56 SER n 1 57 ASN n 1 58 LYS n 1 59 SER n 1 60 GLY n 1 61 PRO n 1 62 SER n 1 63 SER n 1 64 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'thale cress' _entity_src_gen.gene_src_genus Arabidopsis _entity_src_gen.pdbx_gene_src_gene RAFL05-17-I01 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name L030422-C06 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y5621_ARATH _struct_ref.pdbx_db_accession O81488 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNK _struct_ref.pdbx_align_begin 201 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WE9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 58 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O81488 _struct_ref_seq.db_align_beg 201 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 251 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 58 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WE9 GLY A 1 ? UNP O81488 ? ? 'cloning artifact' 1 1 1 1WE9 SER A 2 ? UNP O81488 ? ? 'cloning artifact' 2 2 1 1WE9 SER A 3 ? UNP O81488 ? ? 'cloning artifact' 3 3 1 1WE9 GLY A 4 ? UNP O81488 ? ? 'cloning artifact' 4 4 1 1WE9 SER A 5 ? UNP O81488 ? ? 'cloning artifact' 5 5 1 1WE9 SER A 6 ? UNP O81488 ? ? 'cloning artifact' 6 6 1 1WE9 GLY A 7 ? UNP O81488 ? ? 'cloning artifact' 7 7 1 1WE9 SER A 59 ? UNP O81488 ? ? 'cloning artifact' 59 8 1 1WE9 GLY A 60 ? UNP O81488 ? ? 'cloning artifact' 60 9 1 1WE9 PRO A 61 ? UNP O81488 ? ? 'cloning artifact' 61 10 1 1WE9 SER A 62 ? UNP O81488 ? ? 'cloning artifact' 62 11 1 1WE9 SER A 63 ? UNP O81488 ? ? 'cloning artifact' 63 12 1 1WE9 GLY A 64 ? UNP O81488 ? ? 'cloning artifact' 64 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_13C-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8mM U-15, 13C; 20mM d-Tris-HCl(pH 7.5); 100mM NaCl; 0.1mM ZnCl2; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 # _pdbx_nmr_refine.entry_id 1WE9 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1WE9 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WE9 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 NMRPipe 20020425 processing Delaglio,F. 2 NMRView 5.0.4 'data analysis' Johnson,B.A. 3 KUJIRA 0.863 'data analysis' Cobayashi,N. 4 CYANA 2.0.17 'structure solution' Guentert,P. 5 CYANA 2.0.17 refinement Guentert,P. 6 # _exptl.entry_id 1WE9 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1WE9 _struct.title 'Solution structure of PHD domain in nucleic acid binding protein-like NP_197993' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WE9 _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'structural genomics, PHD domain, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 34 ? VAL A 37 ? GLY A 34 VAL A 37 1 ? 4 HELX_P HELX_P2 2 ARG A 43 ? HIS A 46 ? ARG A 43 HIS A 46 5 ? 4 HELX_P HELX_P3 3 PRO A 53 ? SER A 56 ? PRO A 53 SER A 56 1 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 9 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 9 A ZN 201 1_555 ? ? ? ? ? ? ? 2.324 ? ? metalc2 metalc ? ? A CYS 12 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 12 A ZN 201 1_555 ? ? ? ? ? ? ? 2.324 ? ? metalc3 metalc ? ? A CYS 25 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 25 A ZN 401 1_555 ? ? ? ? ? ? ? 2.335 ? ? metalc4 metalc ? ? A CYS 28 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 28 A ZN 401 1_555 ? ? ? ? ? ? ? 2.345 ? ? metalc5 metalc ? ? A HIS 33 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 33 A ZN 201 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc6 metalc ? ? A CYS 36 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 36 A ZN 201 1_555 ? ? ? ? ? ? ? 2.324 ? ? metalc7 metalc ? ? A CYS 52 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 52 A ZN 401 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc8 metalc ? ? A CYS 55 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 55 A ZN 401 1_555 ? ? ? ? ? ? ? 2.329 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 22 ? CYS A 24 ? TRP A 22 CYS A 24 A 2 TRP A 31 ? HIS A 33 ? TRP A 31 HIS A 33 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 23 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 23 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 32 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 32 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 5 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 9 ? CYS A 9 . ? 1_555 ? 2 AC1 5 ALA A 11 ? ALA A 11 . ? 1_555 ? 3 AC1 5 CYS A 12 ? CYS A 12 . ? 1_555 ? 4 AC1 5 HIS A 33 ? HIS A 33 . ? 1_555 ? 5 AC1 5 CYS A 36 ? CYS A 36 . ? 1_555 ? 6 AC2 4 CYS A 25 ? CYS A 25 . ? 1_555 ? 7 AC2 4 CYS A 28 ? CYS A 28 . ? 1_555 ? 8 AC2 4 CYS A 52 ? CYS A 52 . ? 1_555 ? 9 AC2 4 CYS A 55 ? CYS A 55 . ? 1_555 ? # _database_PDB_matrix.entry_id 1WE9 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WE9 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLY 64 64 64 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 9 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 12 ? A CYS 12 ? 1_555 118.5 ? 2 SG ? A CYS 9 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 33 ? A HIS 33 ? 1_555 86.8 ? 3 SG ? A CYS 12 ? A CYS 12 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 33 ? A HIS 33 ? 1_555 106.9 ? 4 SG ? A CYS 9 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 36 ? A CYS 36 ? 1_555 119.0 ? 5 SG ? A CYS 12 ? A CYS 12 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 36 ? A CYS 36 ? 1_555 118.9 ? 6 ND1 ? A HIS 33 ? A HIS 33 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 36 ? A CYS 36 ? 1_555 95.0 ? 7 SG ? A CYS 25 ? A CYS 25 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 28 ? A CYS 28 ? 1_555 103.9 ? 8 SG ? A CYS 25 ? A CYS 25 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 52 ? A CYS 52 ? 1_555 111.5 ? 9 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 52 ? A CYS 52 ? 1_555 113.8 ? 10 SG ? A CYS 25 ? A CYS 25 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 118.2 ? 11 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 102.3 ? 12 SG ? A CYS 52 ? A CYS 52 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 106.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-24 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_ref_seq_dif 9 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.value' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 29 4 'Structure model' '_struct_ref_seq_dif.details' 30 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 31 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 16 ? ? -68.47 91.01 2 1 ASP A 19 ? ? -132.74 -57.62 3 1 LEU A 27 ? ? -65.71 -70.93 4 1 ALA A 44 ? ? -37.43 -38.41 5 1 GLN A 49 ? ? 71.58 54.95 6 1 CYS A 52 ? ? -42.90 155.99 7 1 SER A 56 ? ? -36.49 -37.16 8 2 CYS A 12 ? ? -133.64 -46.54 9 2 GLU A 14 ? ? -69.63 -176.16 10 2 GLU A 20 ? ? -37.64 132.84 11 2 CYS A 52 ? ? -38.87 155.07 12 2 SER A 59 ? ? -106.97 -61.45 13 2 PRO A 61 ? ? -69.73 85.40 14 3 SER A 5 ? ? -171.90 116.86 15 3 SER A 6 ? ? -126.72 -50.65 16 3 GLU A 29 ? ? 72.72 43.77 17 3 ALA A 44 ? ? -38.74 -35.65 18 3 CYS A 52 ? ? -43.74 154.56 19 3 SER A 63 ? ? -120.77 -56.11 20 4 SER A 3 ? ? 39.56 42.79 21 4 ASP A 19 ? ? -80.98 43.04 22 4 CYS A 25 ? ? -46.09 151.18 23 4 LEU A 27 ? ? -88.44 -70.77 24 4 ALA A 44 ? ? -38.12 -37.06 25 4 LYS A 48 ? ? -90.02 -66.06 26 4 CYS A 52 ? ? -36.88 155.38 27 5 CYS A 12 ? ? -133.45 -46.50 28 5 GLU A 29 ? ? 73.41 39.13 29 5 CYS A 52 ? ? -41.04 153.00 30 5 SER A 63 ? ? -104.23 40.19 31 6 SER A 3 ? ? -96.89 42.37 32 6 SER A 5 ? ? -81.31 49.55 33 6 LYS A 48 ? ? -99.48 -64.41 34 6 CYS A 52 ? ? -45.46 153.81 35 6 ASN A 57 ? ? -88.13 37.97 36 6 PRO A 61 ? ? -69.79 0.96 37 6 SER A 62 ? ? -34.39 139.25 38 6 SER A 63 ? ? -46.97 154.44 39 7 TYR A 16 ? ? -54.79 99.90 40 7 GLU A 20 ? ? -49.69 156.89 41 7 LEU A 27 ? ? -77.24 -75.44 42 7 GLU A 29 ? ? 36.57 42.53 43 7 CYS A 52 ? ? -41.37 154.55 44 7 ASN A 57 ? ? -87.66 41.08 45 8 TYR A 16 ? ? -36.60 122.88 46 8 GLU A 20 ? ? -56.59 171.26 47 8 ASP A 26 ? ? -81.73 40.11 48 8 LEU A 27 ? ? -135.00 -66.58 49 8 ASN A 57 ? ? -96.56 38.57 50 8 SER A 63 ? ? -41.48 105.49 51 9 SER A 5 ? ? -120.02 -50.04 52 9 SER A 6 ? ? -166.49 115.25 53 9 TYR A 16 ? ? -66.75 91.68 54 9 GLU A 20 ? ? -39.70 151.26 55 9 LEU A 27 ? ? -63.57 -75.23 56 9 ALA A 44 ? ? -39.55 -38.97 57 9 CYS A 52 ? ? -40.76 157.99 58 9 LYS A 58 ? ? -39.53 150.56 59 10 TYR A 16 ? ? -38.93 118.91 60 10 ALA A 18 ? ? -104.26 -60.15 61 10 CYS A 52 ? ? -47.31 156.50 62 11 ALA A 18 ? ? -124.37 -58.90 63 11 ASP A 19 ? ? -88.87 49.17 64 11 GLU A 29 ? ? 70.68 43.45 65 11 CYS A 52 ? ? -41.17 154.19 66 11 PRO A 61 ? ? -69.75 -178.12 67 12 CYS A 12 ? ? -131.66 -45.42 68 12 GLU A 14 ? ? -55.92 170.40 69 12 TYR A 16 ? ? -37.41 110.29 70 12 ASP A 19 ? ? -116.87 71.11 71 12 ASP A 26 ? ? -82.27 36.67 72 12 LEU A 27 ? ? -134.95 -68.07 73 12 GLN A 49 ? ? -118.72 79.65 74 12 CYS A 52 ? ? -49.95 154.38 75 12 ASN A 57 ? ? -97.93 -62.16 76 12 PRO A 61 ? ? -69.74 10.76 77 12 SER A 62 ? ? -31.83 114.93 78 13 SER A 3 ? ? -36.23 109.90 79 13 SER A 6 ? ? -34.46 114.37 80 13 CYS A 12 ? ? -135.05 -46.26 81 13 ASP A 26 ? ? -83.62 33.86 82 13 LEU A 27 ? ? -134.91 -53.77 83 13 ALA A 44 ? ? -36.57 -39.25 84 13 LYS A 48 ? ? -125.18 -58.60 85 13 SER A 56 ? ? -35.06 -37.85 86 13 PRO A 61 ? ? -69.73 5.93 87 13 SER A 62 ? ? -37.60 156.54 88 14 LEU A 27 ? ? -79.35 -70.14 89 14 ALA A 44 ? ? -39.73 -38.96 90 14 PRO A 61 ? ? -69.74 3.50 91 15 ASP A 19 ? ? -104.62 64.61 92 15 LEU A 27 ? ? -75.89 -75.80 93 15 LYS A 48 ? ? -109.19 -67.02 94 15 CYS A 52 ? ? -36.76 155.17 95 15 ASN A 57 ? ? -119.55 58.72 96 16 GLN A 8 ? ? -39.95 141.80 97 16 GLU A 14 ? ? -52.49 177.86 98 16 ALA A 18 ? ? -101.33 42.26 99 16 ASP A 19 ? ? -132.08 -56.55 100 16 GLU A 20 ? ? -33.83 146.32 101 16 ASP A 26 ? ? -86.46 35.66 102 16 LEU A 27 ? ? -131.90 -67.27 103 16 CYS A 52 ? ? -43.63 157.11 104 16 SER A 59 ? ? 37.68 37.65 105 17 SER A 2 ? ? -55.60 172.98 106 17 ASP A 26 ? ? -82.74 36.92 107 17 LEU A 27 ? ? -134.93 -69.78 108 17 LYS A 48 ? ? -103.34 -62.90 109 17 CYS A 52 ? ? -37.54 157.43 110 17 ASN A 57 ? ? -96.36 38.88 111 17 LYS A 58 ? ? -170.23 120.52 112 17 PRO A 61 ? ? -69.70 95.59 113 18 SER A 6 ? ? -168.63 109.68 114 18 ASP A 19 ? ? -80.59 46.46 115 18 LEU A 27 ? ? -67.16 -71.68 116 18 CYS A 52 ? ? -36.40 156.42 117 18 SER A 56 ? ? -35.01 -32.18 118 18 ASN A 57 ? ? -85.75 44.56 119 18 SER A 59 ? ? -37.29 146.06 120 19 SER A 5 ? ? -54.33 99.48 121 19 TYR A 16 ? ? -36.74 102.21 122 19 ASP A 19 ? ? -82.52 43.49 123 19 SER A 56 ? ? -34.26 -34.91 124 20 TYR A 16 ? ? -57.91 97.16 125 20 LEU A 27 ? ? -67.16 -74.82 126 20 LYS A 48 ? ? -102.85 -67.40 127 20 CYS A 52 ? ? -36.33 156.36 128 20 SER A 56 ? ? -49.68 -17.65 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #