data_1WEM # _entry.id 1WEM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WEM pdb_00001wem 10.2210/pdb1wem/pdb RCSB RCSB023494 ? ? WWPDB D_1000023494 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-25 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_ref_seq_dif 9 4 'Structure model' struct_site 10 5 'Structure model' chem_comp_atom 11 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.value' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 29 4 'Structure model' '_struct_ref_seq_dif.details' 30 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 31 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WEM _pdbx_database_status.recvd_initial_deposition_date 2004-05-25 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmt007015491.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'He, F.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Shirouzu, M.' 5 'Terada, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of PHD domain in death inducer-obliterator 1(DIO-1)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, F.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Terada, T.' 6 ? primary 'Yokoyama, S.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Death associated transcription factor 1' 8388.311 1 ? ? 'PHD domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Death inducer-obliterator-1, DIO-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGECEVYDPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGECEVYDPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmt007015491.1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLU n 1 9 CYS n 1 10 GLU n 1 11 VAL n 1 12 TYR n 1 13 ASP n 1 14 PRO n 1 15 ASN n 1 16 ALA n 1 17 LEU n 1 18 TYR n 1 19 CYS n 1 20 ILE n 1 21 CYS n 1 22 ARG n 1 23 GLN n 1 24 PRO n 1 25 HIS n 1 26 ASN n 1 27 ASN n 1 28 ARG n 1 29 PHE n 1 30 MET n 1 31 ILE n 1 32 CYS n 1 33 CYS n 1 34 ASP n 1 35 ARG n 1 36 CYS n 1 37 GLU n 1 38 GLU n 1 39 TRP n 1 40 PHE n 1 41 HIS n 1 42 GLY n 1 43 ASP n 1 44 CYS n 1 45 VAL n 1 46 GLY n 1 47 ILE n 1 48 SER n 1 49 GLU n 1 50 ALA n 1 51 ARG n 1 52 GLY n 1 53 ARG n 1 54 LEU n 1 55 LEU n 1 56 GLU n 1 57 ARG n 1 58 ASN n 1 59 GLY n 1 60 GLU n 1 61 ASP n 1 62 TYR n 1 63 ILE n 1 64 CYS n 1 65 PRO n 1 66 ASN n 1 67 CYS n 1 68 THR n 1 69 ILE n 1 70 LEU n 1 71 SER n 1 72 GLY n 1 73 PRO n 1 74 SER n 1 75 SER n 1 76 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene 'RIKEN cDNA 3830408B01' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P030421-56 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLY 76 76 76 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _exptl.entry_id 1WEM _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1WEM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1WEM _struct.title 'Solution structure of PHD domain in death inducer-obliterator 1(DIO-1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WEM _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text ;structural genomics, PHD domain, death inducer-obliterator 1(DIO-1), RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DIDO1_MOUSE _struct_ref.pdbx_db_accession Q8C9B9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ECEVYDPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTIL _struct_ref.pdbx_align_begin 257 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WEM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8C9B9 _struct_ref_seq.db_align_beg 257 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 319 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 70 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WEM GLY A 1 ? UNP Q8C9B9 ? ? 'cloning artifact' 1 1 1 1WEM SER A 2 ? UNP Q8C9B9 ? ? 'cloning artifact' 2 2 1 1WEM SER A 3 ? UNP Q8C9B9 ? ? 'cloning artifact' 3 3 1 1WEM GLY A 4 ? UNP Q8C9B9 ? ? 'cloning artifact' 4 4 1 1WEM SER A 5 ? UNP Q8C9B9 ? ? 'cloning artifact' 5 5 1 1WEM SER A 6 ? UNP Q8C9B9 ? ? 'cloning artifact' 6 6 1 1WEM GLY A 7 ? UNP Q8C9B9 ? ? 'cloning artifact' 7 7 1 1WEM SER A 71 ? UNP Q8C9B9 ? ? 'cloning artifact' 71 8 1 1WEM GLY A 72 ? UNP Q8C9B9 ? ? 'cloning artifact' 72 9 1 1WEM PRO A 73 ? UNP Q8C9B9 ? ? 'cloning artifact' 73 10 1 1WEM SER A 74 ? UNP Q8C9B9 ? ? 'cloning artifact' 74 11 1 1WEM SER A 75 ? UNP Q8C9B9 ? ? 'cloning artifact' 75 12 1 1WEM GLY A 76 ? UNP Q8C9B9 ? ? 'cloning artifact' 76 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 42 ? VAL A 45 ? GLY A 42 VAL A 45 1 ? 4 HELX_P HELX_P2 2 GLU A 49 ? ASN A 58 ? GLU A 49 ASN A 58 1 ? 10 HELX_P HELX_P3 3 PRO A 65 ? LEU A 70 ? PRO A 65 LEU A 70 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 19 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 19 A ZN 201 1_555 ? ? ? ? ? ? ? 2.335 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.333 ? ? metalc3 metalc ? ? A CYS 33 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 33 A ZN 401 1_555 ? ? ? ? ? ? ? 2.336 ? ? metalc4 metalc ? ? A CYS 36 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 36 A ZN 401 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc5 metalc ? ? A HIS 41 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 41 A ZN 201 1_555 ? ? ? ? ? ? ? 2.338 ? ? metalc6 metalc ? ? A CYS 44 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 44 A ZN 201 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc7 metalc ? ? A CYS 64 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 64 A ZN 401 1_555 ? ? ? ? ? ? ? 2.337 ? ? metalc8 metalc ? ? A CYS 67 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 67 A ZN 401 1_555 ? ? ? ? ? ? ? 2.329 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 100.7 ? 2 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 41 ? A HIS 41 ? 1_555 100.7 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 41 ? A HIS 41 ? 1_555 102.9 ? 4 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 44 ? A CYS 44 ? 1_555 118.1 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 44 ? A CYS 44 ? 1_555 118.1 ? 6 ND1 ? A HIS 41 ? A HIS 41 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 44 ? A CYS 44 ? 1_555 113.7 ? 7 SG ? A CYS 33 ? A CYS 33 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 36 ? A CYS 36 ? 1_555 114.6 ? 8 SG ? A CYS 33 ? A CYS 33 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 64 ? A CYS 64 ? 1_555 114.2 ? 9 SG ? A CYS 36 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 64 ? A CYS 64 ? 1_555 117.7 ? 10 SG ? A CYS 33 ? A CYS 33 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 67 ? A CYS 67 ? 1_555 118.1 ? 11 SG ? A CYS 36 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 67 ? A CYS 67 ? 1_555 95.1 ? 12 SG ? A CYS 64 ? A CYS 64 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 67 ? A CYS 67 ? 1_555 94.2 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 30 ? CYS A 32 ? MET A 30 CYS A 32 A 2 TRP A 39 ? HIS A 41 ? TRP A 39 HIS A 41 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 31 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 31 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 40 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 40 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 19 ? CYS A 19 . ? 1_555 ? 2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 3 AC1 4 HIS A 41 ? HIS A 41 . ? 1_555 ? 4 AC1 4 CYS A 44 ? CYS A 44 . ? 1_555 ? 5 AC2 4 CYS A 33 ? CYS A 33 . ? 1_555 ? 6 AC2 4 CYS A 36 ? CYS A 36 . ? 1_555 ? 7 AC2 4 CYS A 64 ? CYS A 64 . ? 1_555 ? 8 AC2 4 CYS A 67 ? CYS A 67 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -35.57 123.49 2 1 GLU A 8 ? ? -47.13 150.70 3 1 ASP A 13 ? ? -38.65 116.79 4 1 TYR A 18 ? ? -117.71 -74.93 5 1 ASN A 27 ? ? -35.30 -36.75 6 1 ARG A 28 ? ? -39.45 147.60 7 1 ILE A 47 ? ? -37.32 122.49 8 1 CYS A 64 ? ? -41.86 156.77 9 1 SER A 74 ? ? -50.55 175.36 10 2 VAL A 11 ? ? -37.83 -27.79 11 2 ASP A 13 ? ? -55.39 108.60 12 2 TYR A 18 ? ? -123.41 -62.49 13 2 PRO A 24 ? ? -69.82 -173.05 14 2 ARG A 28 ? ? -34.57 149.47 15 2 CYS A 33 ? ? -40.27 161.25 16 2 ILE A 47 ? ? -37.81 142.72 17 2 LEU A 55 ? ? -34.61 -32.47 18 2 CYS A 64 ? ? -39.05 155.58 19 2 ILE A 69 ? ? -35.53 -39.02 20 2 SER A 74 ? ? -81.64 43.77 21 3 SER A 5 ? ? -58.34 174.27 22 3 SER A 6 ? ? -127.32 -57.65 23 3 TYR A 18 ? ? -127.58 -66.90 24 3 ARG A 28 ? ? -37.50 151.95 25 3 LEU A 55 ? ? -37.89 -27.47 26 3 CYS A 64 ? ? -39.60 156.77 27 4 CYS A 9 ? ? -36.51 123.68 28 4 TYR A 12 ? ? -56.06 178.57 29 4 TYR A 18 ? ? -130.29 -67.27 30 4 ASN A 26 ? ? -66.58 -174.54 31 4 ASN A 27 ? ? -80.23 42.14 32 4 ILE A 47 ? ? -35.82 150.54 33 4 LEU A 55 ? ? -38.67 -25.77 34 4 GLU A 56 ? ? -86.68 -71.25 35 4 ILE A 63 ? ? -46.61 97.08 36 4 CYS A 64 ? ? -37.75 156.50 37 4 PRO A 73 ? ? -69.81 87.20 38 5 SER A 5 ? ? -167.56 106.81 39 5 VAL A 11 ? ? -80.66 45.78 40 5 PRO A 24 ? ? -69.77 -171.51 41 5 ARG A 28 ? ? -33.51 148.48 42 5 CYS A 33 ? ? -51.15 170.18 43 5 LEU A 55 ? ? -36.68 -31.05 44 5 CYS A 64 ? ? -38.48 157.57 45 6 TYR A 18 ? ? -92.10 -75.41 46 6 CYS A 19 ? ? -48.40 168.09 47 6 ASN A 27 ? ? -38.44 -36.81 48 6 ARG A 28 ? ? -42.18 153.53 49 6 ILE A 47 ? ? -35.87 135.32 50 6 LEU A 55 ? ? -39.53 -25.37 51 6 CYS A 64 ? ? -45.67 159.12 52 6 ILE A 69 ? ? -37.91 -39.12 53 7 GLU A 8 ? ? -47.71 151.59 54 7 VAL A 11 ? ? -173.99 124.50 55 7 TYR A 18 ? ? -91.39 -65.43 56 7 PRO A 24 ? ? -69.83 -174.47 57 7 ARG A 28 ? ? -36.64 146.57 58 7 ILE A 47 ? ? -38.03 149.35 59 7 CYS A 64 ? ? -38.32 156.40 60 7 CYS A 67 ? ? -77.92 -71.99 61 7 SER A 74 ? ? -67.36 83.91 62 8 TYR A 12 ? ? -130.67 -44.56 63 8 TYR A 18 ? ? -132.06 -63.08 64 8 PRO A 24 ? ? -69.78 -173.50 65 8 ASN A 26 ? ? -78.76 -72.70 66 8 ASN A 27 ? ? -132.16 -33.27 67 8 ARG A 28 ? ? -34.66 138.21 68 8 ILE A 47 ? ? -37.22 122.37 69 8 LEU A 55 ? ? -34.80 -32.33 70 8 GLU A 56 ? ? -64.01 -70.59 71 8 CYS A 64 ? ? -38.56 156.54 72 8 ILE A 69 ? ? -40.00 -26.27 73 8 SER A 71 ? ? -117.19 -74.99 74 9 ASP A 13 ? ? -38.76 128.81 75 9 PRO A 24 ? ? -69.74 -174.39 76 9 ARG A 28 ? ? -34.24 147.50 77 9 CYS A 33 ? ? -43.48 167.68 78 9 ILE A 47 ? ? -35.23 148.47 79 9 LEU A 55 ? ? -39.42 -38.26 80 9 GLU A 56 ? ? -55.83 -70.93 81 9 CYS A 64 ? ? -40.32 157.37 82 10 SER A 2 ? ? -164.36 108.81 83 10 GLU A 8 ? ? -56.80 106.08 84 10 VAL A 11 ? ? 34.05 32.71 85 10 PRO A 24 ? ? -69.77 -173.85 86 10 ARG A 28 ? ? -34.58 147.72 87 10 LEU A 55 ? ? -34.69 -34.42 88 10 CYS A 64 ? ? -41.48 155.93 89 11 TYR A 18 ? ? -131.42 -74.82 90 11 CYS A 19 ? ? -47.85 162.84 91 11 ARG A 28 ? ? -36.53 145.87 92 11 ILE A 47 ? ? -36.46 150.84 93 11 GLU A 56 ? ? -72.12 -70.76 94 11 CYS A 64 ? ? -41.07 158.37 95 11 CYS A 67 ? ? -77.39 -71.78 96 12 CYS A 9 ? ? 73.10 36.79 97 12 TYR A 12 ? ? -46.75 107.94 98 12 ASP A 13 ? ? -162.05 118.71 99 12 TYR A 18 ? ? -132.90 -74.99 100 12 PRO A 24 ? ? -69.74 -173.33 101 12 ARG A 35 ? ? -92.15 -64.17 102 12 ILE A 47 ? ? -38.95 128.42 103 12 GLU A 56 ? ? -79.79 -70.95 104 12 CYS A 64 ? ? -46.70 157.04 105 12 PRO A 73 ? ? -69.70 87.53 106 13 ASN A 27 ? ? -37.81 -39.33 107 13 ARG A 28 ? ? -37.03 141.94 108 13 ILE A 47 ? ? -39.20 124.86 109 13 CYS A 64 ? ? -42.33 156.08 110 13 CYS A 67 ? ? -78.10 -71.12 111 14 CYS A 9 ? ? -35.89 134.64 112 14 TYR A 12 ? ? -94.83 -62.16 113 14 TYR A 18 ? ? -132.59 -74.38 114 14 CYS A 19 ? ? -48.81 165.38 115 14 ARG A 28 ? ? -35.62 153.26 116 14 ILE A 47 ? ? -34.59 130.51 117 14 CYS A 64 ? ? -39.92 156.86 118 14 ILE A 69 ? ? -35.50 -37.61 119 15 ASP A 13 ? ? -42.71 103.08 120 15 ASN A 15 ? ? -109.90 41.66 121 15 TYR A 18 ? ? -100.91 -73.81 122 15 CYS A 19 ? ? -52.67 171.42 123 15 PRO A 24 ? ? -69.79 -174.73 124 15 GLU A 56 ? ? -85.33 -70.82 125 15 CYS A 64 ? ? -40.55 156.36 126 15 ASN A 66 ? ? -39.31 -31.68 127 15 PRO A 73 ? ? -69.75 2.74 128 16 VAL A 11 ? ? -84.10 37.29 129 16 TYR A 18 ? ? -132.88 -72.95 130 16 ARG A 28 ? ? -33.64 149.83 131 16 ILE A 47 ? ? -34.64 132.75 132 16 GLU A 56 ? ? -85.24 -71.08 133 16 CYS A 64 ? ? -41.48 159.26 134 16 LEU A 70 ? ? -70.27 -75.16 135 16 SER A 71 ? ? -90.98 -71.47 136 16 SER A 75 ? ? -98.36 -63.79 137 17 SER A 2 ? ? -83.43 42.18 138 17 CYS A 9 ? ? -44.88 98.73 139 17 PRO A 14 ? ? -69.77 1.94 140 17 TYR A 18 ? ? -129.81 -74.52 141 17 PRO A 24 ? ? -69.71 -165.31 142 17 HIS A 25 ? ? -110.24 73.44 143 17 LEU A 55 ? ? -36.96 -28.76 144 17 GLU A 56 ? ? -88.93 -70.99 145 17 CYS A 64 ? ? -40.36 156.87 146 17 CYS A 67 ? ? -75.16 -70.01 147 17 SER A 71 ? ? -85.59 47.73 148 17 PRO A 73 ? ? -69.75 3.72 149 17 SER A 74 ? ? -34.35 120.67 150 18 GLU A 10 ? ? -43.13 165.96 151 18 TYR A 12 ? ? 34.04 46.67 152 18 PRO A 24 ? ? -69.79 -172.44 153 18 ASN A 26 ? ? -92.62 -72.03 154 18 ASN A 27 ? ? -131.87 -31.72 155 18 ARG A 28 ? ? -36.94 139.38 156 18 ILE A 47 ? ? -35.99 149.20 157 18 LEU A 55 ? ? -38.25 -28.78 158 18 GLU A 56 ? ? -80.14 -71.03 159 18 CYS A 64 ? ? -39.14 158.15 160 19 CYS A 9 ? ? -49.96 155.74 161 19 TYR A 18 ? ? -123.97 -60.77 162 19 PRO A 24 ? ? -69.76 -179.39 163 19 ARG A 28 ? ? -34.71 149.80 164 19 ILE A 47 ? ? -34.37 139.27 165 19 LEU A 55 ? ? -33.14 -35.04 166 19 CYS A 64 ? ? -38.35 157.56 167 19 ILE A 69 ? ? -36.15 -35.67 168 19 PRO A 73 ? ? -69.73 1.04 169 20 SER A 3 ? ? -131.36 -57.37 170 20 PRO A 24 ? ? -69.74 -177.70 171 20 ARG A 28 ? ? -33.77 147.11 172 20 ILE A 47 ? ? -37.44 145.46 173 20 LEU A 55 ? ? -37.98 -27.36 174 20 ASP A 61 ? ? -64.21 97.59 175 20 CYS A 64 ? ? -41.16 157.34 176 20 PRO A 73 ? ? -69.74 0.57 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX AUTHOR DETERMINATION METHOD: AUTHOR DETERMINED ; # _pdbx_nmr_ensemble.entry_id 1WEM _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WEM _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8mM U-15, 13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 0.1mM ZnCl2; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_13C-separated_NOESY # _pdbx_nmr_refine.entry_id 1WEM _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 NMRPipe 20020425 processing Delaglio,F. 2 NMRView 5.0.5 'data analysis' Johnson,B.A. 3 KUJIRA 0.863 'data analysis' Cobayashi,N. 4 CYANA 2.0.17 'structure solution' Guentert,P. 5 CYANA 2.0.17 refinement Guentert,P. 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 MET N N N N 202 MET CA C N S 203 MET C C N N 204 MET O O N N 205 MET CB C N N 206 MET CG C N N 207 MET SD S N N 208 MET CE C N N 209 MET OXT O N N 210 MET H H N N 211 MET H2 H N N 212 MET HA H N N 213 MET HB2 H N N 214 MET HB3 H N N 215 MET HG2 H N N 216 MET HG3 H N N 217 MET HE1 H N N 218 MET HE2 H N N 219 MET HE3 H N N 220 MET HXT H N N 221 PHE N N N N 222 PHE CA C N S 223 PHE C C N N 224 PHE O O N N 225 PHE CB C N N 226 PHE CG C Y N 227 PHE CD1 C Y N 228 PHE CD2 C Y N 229 PHE CE1 C Y N 230 PHE CE2 C Y N 231 PHE CZ C Y N 232 PHE OXT O N N 233 PHE H H N N 234 PHE H2 H N N 235 PHE HA H N N 236 PHE HB2 H N N 237 PHE HB3 H N N 238 PHE HD1 H N N 239 PHE HD2 H N N 240 PHE HE1 H N N 241 PHE HE2 H N N 242 PHE HZ H N N 243 PHE HXT H N N 244 PRO N N N N 245 PRO CA C N S 246 PRO C C N N 247 PRO O O N N 248 PRO CB C N N 249 PRO CG C N N 250 PRO CD C N N 251 PRO OXT O N N 252 PRO H H N N 253 PRO HA H N N 254 PRO HB2 H N N 255 PRO HB3 H N N 256 PRO HG2 H N N 257 PRO HG3 H N N 258 PRO HD2 H N N 259 PRO HD3 H N N 260 PRO HXT H N N 261 SER N N N N 262 SER CA C N S 263 SER C C N N 264 SER O O N N 265 SER CB C N N 266 SER OG O N N 267 SER OXT O N N 268 SER H H N N 269 SER H2 H N N 270 SER HA H N N 271 SER HB2 H N N 272 SER HB3 H N N 273 SER HG H N N 274 SER HXT H N N 275 THR N N N N 276 THR CA C N S 277 THR C C N N 278 THR O O N N 279 THR CB C N R 280 THR OG1 O N N 281 THR CG2 C N N 282 THR OXT O N N 283 THR H H N N 284 THR H2 H N N 285 THR HA H N N 286 THR HB H N N 287 THR HG1 H N N 288 THR HG21 H N N 289 THR HG22 H N N 290 THR HG23 H N N 291 THR HXT H N N 292 TRP N N N N 293 TRP CA C N S 294 TRP C C N N 295 TRP O O N N 296 TRP CB C N N 297 TRP CG C Y N 298 TRP CD1 C Y N 299 TRP CD2 C Y N 300 TRP NE1 N Y N 301 TRP CE2 C Y N 302 TRP CE3 C Y N 303 TRP CZ2 C Y N 304 TRP CZ3 C Y N 305 TRP CH2 C Y N 306 TRP OXT O N N 307 TRP H H N N 308 TRP H2 H N N 309 TRP HA H N N 310 TRP HB2 H N N 311 TRP HB3 H N N 312 TRP HD1 H N N 313 TRP HE1 H N N 314 TRP HE3 H N N 315 TRP HZ2 H N N 316 TRP HZ3 H N N 317 TRP HH2 H N N 318 TRP HXT H N N 319 TYR N N N N 320 TYR CA C N S 321 TYR C C N N 322 TYR O O N N 323 TYR CB C N N 324 TYR CG C Y N 325 TYR CD1 C Y N 326 TYR CD2 C Y N 327 TYR CE1 C Y N 328 TYR CE2 C Y N 329 TYR CZ C Y N 330 TYR OH O N N 331 TYR OXT O N N 332 TYR H H N N 333 TYR H2 H N N 334 TYR HA H N N 335 TYR HB2 H N N 336 TYR HB3 H N N 337 TYR HD1 H N N 338 TYR HD2 H N N 339 TYR HE1 H N N 340 TYR HE2 H N N 341 TYR HH H N N 342 TYR HXT H N N 343 VAL N N N N 344 VAL CA C N S 345 VAL C C N N 346 VAL O O N N 347 VAL CB C N N 348 VAL CG1 C N N 349 VAL CG2 C N N 350 VAL OXT O N N 351 VAL H H N N 352 VAL H2 H N N 353 VAL HA H N N 354 VAL HB H N N 355 VAL HG11 H N N 356 VAL HG12 H N N 357 VAL HG13 H N N 358 VAL HG21 H N N 359 VAL HG22 H N N 360 VAL HG23 H N N 361 VAL HXT H N N 362 ZN ZN ZN N N 363 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 MET N CA sing N N 192 MET N H sing N N 193 MET N H2 sing N N 194 MET CA C sing N N 195 MET CA CB sing N N 196 MET CA HA sing N N 197 MET C O doub N N 198 MET C OXT sing N N 199 MET CB CG sing N N 200 MET CB HB2 sing N N 201 MET CB HB3 sing N N 202 MET CG SD sing N N 203 MET CG HG2 sing N N 204 MET CG HG3 sing N N 205 MET SD CE sing N N 206 MET CE HE1 sing N N 207 MET CE HE2 sing N N 208 MET CE HE3 sing N N 209 MET OXT HXT sing N N 210 PHE N CA sing N N 211 PHE N H sing N N 212 PHE N H2 sing N N 213 PHE CA C sing N N 214 PHE CA CB sing N N 215 PHE CA HA sing N N 216 PHE C O doub N N 217 PHE C OXT sing N N 218 PHE CB CG sing N N 219 PHE CB HB2 sing N N 220 PHE CB HB3 sing N N 221 PHE CG CD1 doub Y N 222 PHE CG CD2 sing Y N 223 PHE CD1 CE1 sing Y N 224 PHE CD1 HD1 sing N N 225 PHE CD2 CE2 doub Y N 226 PHE CD2 HD2 sing N N 227 PHE CE1 CZ doub Y N 228 PHE CE1 HE1 sing N N 229 PHE CE2 CZ sing Y N 230 PHE CE2 HE2 sing N N 231 PHE CZ HZ sing N N 232 PHE OXT HXT sing N N 233 PRO N CA sing N N 234 PRO N CD sing N N 235 PRO N H sing N N 236 PRO CA C sing N N 237 PRO CA CB sing N N 238 PRO CA HA sing N N 239 PRO C O doub N N 240 PRO C OXT sing N N 241 PRO CB CG sing N N 242 PRO CB HB2 sing N N 243 PRO CB HB3 sing N N 244 PRO CG CD sing N N 245 PRO CG HG2 sing N N 246 PRO CG HG3 sing N N 247 PRO CD HD2 sing N N 248 PRO CD HD3 sing N N 249 PRO OXT HXT sing N N 250 SER N CA sing N N 251 SER N H sing N N 252 SER N H2 sing N N 253 SER CA C sing N N 254 SER CA CB sing N N 255 SER CA HA sing N N 256 SER C O doub N N 257 SER C OXT sing N N 258 SER CB OG sing N N 259 SER CB HB2 sing N N 260 SER CB HB3 sing N N 261 SER OG HG sing N N 262 SER OXT HXT sing N N 263 THR N CA sing N N 264 THR N H sing N N 265 THR N H2 sing N N 266 THR CA C sing N N 267 THR CA CB sing N N 268 THR CA HA sing N N 269 THR C O doub N N 270 THR C OXT sing N N 271 THR CB OG1 sing N N 272 THR CB CG2 sing N N 273 THR CB HB sing N N 274 THR OG1 HG1 sing N N 275 THR CG2 HG21 sing N N 276 THR CG2 HG22 sing N N 277 THR CG2 HG23 sing N N 278 THR OXT HXT sing N N 279 TRP N CA sing N N 280 TRP N H sing N N 281 TRP N H2 sing N N 282 TRP CA C sing N N 283 TRP CA CB sing N N 284 TRP CA HA sing N N 285 TRP C O doub N N 286 TRP C OXT sing N N 287 TRP CB CG sing N N 288 TRP CB HB2 sing N N 289 TRP CB HB3 sing N N 290 TRP CG CD1 doub Y N 291 TRP CG CD2 sing Y N 292 TRP CD1 NE1 sing Y N 293 TRP CD1 HD1 sing N N 294 TRP CD2 CE2 doub Y N 295 TRP CD2 CE3 sing Y N 296 TRP NE1 CE2 sing Y N 297 TRP NE1 HE1 sing N N 298 TRP CE2 CZ2 sing Y N 299 TRP CE3 CZ3 doub Y N 300 TRP CE3 HE3 sing N N 301 TRP CZ2 CH2 doub Y N 302 TRP CZ2 HZ2 sing N N 303 TRP CZ3 CH2 sing Y N 304 TRP CZ3 HZ3 sing N N 305 TRP CH2 HH2 sing N N 306 TRP OXT HXT sing N N 307 TYR N CA sing N N 308 TYR N H sing N N 309 TYR N H2 sing N N 310 TYR CA C sing N N 311 TYR CA CB sing N N 312 TYR CA HA sing N N 313 TYR C O doub N N 314 TYR C OXT sing N N 315 TYR CB CG sing N N 316 TYR CB HB2 sing N N 317 TYR CB HB3 sing N N 318 TYR CG CD1 doub Y N 319 TYR CG CD2 sing Y N 320 TYR CD1 CE1 sing Y N 321 TYR CD1 HD1 sing N N 322 TYR CD2 CE2 doub Y N 323 TYR CD2 HD2 sing N N 324 TYR CE1 CZ doub Y N 325 TYR CE1 HE1 sing N N 326 TYR CE2 CZ sing Y N 327 TYR CE2 HE2 sing N N 328 TYR CZ OH sing N N 329 TYR OH HH sing N N 330 TYR OXT HXT sing N N 331 VAL N CA sing N N 332 VAL N H sing N N 333 VAL N H2 sing N N 334 VAL CA C sing N N 335 VAL CA CB sing N N 336 VAL CA HA sing N N 337 VAL C O doub N N 338 VAL C OXT sing N N 339 VAL CB CG1 sing N N 340 VAL CB CG2 sing N N 341 VAL CB HB sing N N 342 VAL CG1 HG11 sing N N 343 VAL CG1 HG12 sing N N 344 VAL CG1 HG13 sing N N 345 VAL CG2 HG21 sing N N 346 VAL CG2 HG22 sing N N 347 VAL CG2 HG23 sing N N 348 VAL OXT HXT sing N N 349 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 1WEM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_