data_1WF7
# 
_entry.id   1WF7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1WF7         pdb_00001wf7 10.2210/pdb1wf7/pdb 
RCSB  RCSB023513   ?            ?                   
WWPDB D_1000023513 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-11-26 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-03-02 
5 'Structure model' 1 4 2024-05-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2            
2 4 'Structure model' pdbx_nmr_software     
3 4 'Structure model' pdbx_struct_assembly  
4 4 'Structure model' pdbx_struct_oper_list 
5 4 'Structure model' struct_ref_seq_dif    
6 5 'Structure model' chem_comp_atom        
7 5 'Structure model' chem_comp_bond        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_pdbx_nmr_software.name'             
4 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1WF7 
_pdbx_database_status.recvd_initial_deposition_date   2004-05-26 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          mmt007006937.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Qin, X.'                                                1 
'Tochio, N.'                                             2 
'Kigawa, T.'                                             3 
'Hayashi, F.'                                            4 
'Yokoyama, S.'                                           5 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the PDZ domain of Enigma homologue protein' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Qin, X.'      1 ? 
primary 'Tochio, N.'   2 ? 
primary 'Kigawa, T.'   3 ? 
primary 'Hayashi, F.'  4 ? 
primary 'Yokoyama, S.' 5 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Enigma homologue protein' 
_entity.formula_weight             10309.564 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'PDZ domain' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSL
NMTLQRASAAAKSEPVSSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSL
NMTLQRASAAAKSEPVSSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         mmt007006937.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   SER n 
1 9   VAL n 
1 10  SER n 
1 11  LEU n 
1 12  VAL n 
1 13  GLY n 
1 14  PRO n 
1 15  ALA n 
1 16  PRO n 
1 17  TRP n 
1 18  GLY n 
1 19  PHE n 
1 20  ARG n 
1 21  LEU n 
1 22  GLN n 
1 23  GLY n 
1 24  GLY n 
1 25  LYS n 
1 26  ASP n 
1 27  PHE n 
1 28  ASN n 
1 29  MET n 
1 30  PRO n 
1 31  LEU n 
1 32  THR n 
1 33  ILE n 
1 34  SER n 
1 35  SER n 
1 36  LEU n 
1 37  LYS n 
1 38  ASP n 
1 39  GLY n 
1 40  GLY n 
1 41  LYS n 
1 42  ALA n 
1 43  SER n 
1 44  GLN n 
1 45  ALA n 
1 46  HIS n 
1 47  VAL n 
1 48  ARG n 
1 49  ILE n 
1 50  GLY n 
1 51  ASP n 
1 52  VAL n 
1 53  VAL n 
1 54  LEU n 
1 55  SER n 
1 56  ILE n 
1 57  ASP n 
1 58  GLY n 
1 59  ILE n 
1 60  SER n 
1 61  ALA n 
1 62  GLN n 
1 63  GLY n 
1 64  MET n 
1 65  THR n 
1 66  HIS n 
1 67  LEU n 
1 68  GLU n 
1 69  ALA n 
1 70  GLN n 
1 71  ASN n 
1 72  LYS n 
1 73  ILE n 
1 74  LYS n 
1 75  ALA n 
1 76  CYS n 
1 77  THR n 
1 78  GLY n 
1 79  SER n 
1 80  LEU n 
1 81  ASN n 
1 82  MET n 
1 83  THR n 
1 84  LEU n 
1 85  GLN n 
1 86  ARG n 
1 87  ALA n 
1 88  SER n 
1 89  ALA n 
1 90  ALA n 
1 91  ALA n 
1 92  LYS n 
1 93  SER n 
1 94  GLU n 
1 95  PRO n 
1 96  VAL n 
1 97  SER n 
1 98  SER n 
1 99  GLY n 
1 100 PRO n 
1 101 SER n 
1 102 SER n 
1 103 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 'RIKEN 1110001A05' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P030203-44 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell free protein synthesis' 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   1   GLY GLY A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   SER 6   6   6   SER SER A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   SER 8   8   8   SER SER A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  SER 10  10  10  SER SER A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  ALA 15  15  15  ALA ALA A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  TRP 17  17  17  TRP TRP A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  PHE 19  19  19  PHE PHE A . n 
A 1 20  ARG 20  20  20  ARG ARG A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  LYS 25  25  25  LYS LYS A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  PHE 27  27  27  PHE PHE A . n 
A 1 28  ASN 28  28  28  ASN ASN A . n 
A 1 29  MET 29  29  29  MET MET A . n 
A 1 30  PRO 30  30  30  PRO PRO A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  THR 32  32  32  THR THR A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  ASP 38  38  38  ASP ASP A . n 
A 1 39  GLY 39  39  39  GLY GLY A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  GLN 44  44  44  GLN GLN A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  HIS 46  46  46  HIS HIS A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  ARG 48  48  48  ARG ARG A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  ASP 57  57  57  ASP ASP A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  ILE 59  59  59  ILE ILE A . n 
A 1 60  SER 60  60  60  SER SER A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  GLN 62  62  62  GLN GLN A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  MET 64  64  64  MET MET A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  HIS 66  66  66  HIS HIS A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  GLU 68  68  68  GLU GLU A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  LYS 72  72  72  LYS LYS A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  CYS 76  76  76  CYS CYS A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  MET 82  82  82  MET MET A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  ARG 86  86  86  ARG ARG A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  SER 97  97  97  SER SER A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 SER 101 101 101 SER SER A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
# 
_exptl.entry_id          1WF7 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_database_PDB_matrix.entry_id          1WF7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1WF7 
_struct.title                     'Solution structure of the PDZ domain of Enigma homologue protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1WF7 
_struct_keywords.pdbx_keywords   'Structural genomics, unknown function' 
_struct_keywords.text            
'PDZ domain, Enigma homologue protein, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PDLI5_MOUSE 
_struct_ref.pdbx_db_accession          Q8CI51 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRA
SAAAKSEPVS
;
_struct_ref.pdbx_align_begin           5 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1WF7 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 97 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8CI51 
_struct_ref_seq.db_align_beg                  5 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  94 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       97 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1WF7 GLY A 1   ? UNP Q8CI51 ? ? 'cloning artifact' 1   1  
1 1WF7 SER A 2   ? UNP Q8CI51 ? ? 'cloning artifact' 2   2  
1 1WF7 SER A 3   ? UNP Q8CI51 ? ? 'cloning artifact' 3   3  
1 1WF7 GLY A 4   ? UNP Q8CI51 ? ? 'cloning artifact' 4   4  
1 1WF7 SER A 5   ? UNP Q8CI51 ? ? 'cloning artifact' 5   5  
1 1WF7 SER A 6   ? UNP Q8CI51 ? ? 'cloning artifact' 6   6  
1 1WF7 GLY A 7   ? UNP Q8CI51 ? ? 'cloning artifact' 7   7  
1 1WF7 SER A 98  ? UNP Q8CI51 ? ? 'cloning artifact' 98  8  
1 1WF7 GLY A 99  ? UNP Q8CI51 ? ? 'cloning artifact' 99  9  
1 1WF7 PRO A 100 ? UNP Q8CI51 ? ? 'cloning artifact' 100 10 
1 1WF7 SER A 101 ? UNP Q8CI51 ? ? 'cloning artifact' 101 11 
1 1WF7 SER A 102 ? UNP Q8CI51 ? ? 'cloning artifact' 102 12 
1 1WF7 GLY A 103 ? UNP Q8CI51 ? ? 'cloning artifact' 103 13 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 40 ? ALA A 45 ? GLY A 40 ALA A 45 1 ? 6  
HELX_P HELX_P2 2 THR A 65 ? CYS A 76 ? THR A 65 CYS A 76 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 7  ? VAL A 12 ? GLY A 7  VAL A 12 
A 2 SER A 79 ? LEU A 84 ? SER A 79 LEU A 84 
A 3 VAL A 53 ? ILE A 56 ? VAL A 53 ILE A 56 
A 4 ILE A 59 ? SER A 60 ? ILE A 59 SER A 60 
B 1 LEU A 21 ? GLY A 24 ? LEU A 21 GLY A 24 
B 2 MET A 29 ? ILE A 33 ? MET A 29 ILE A 33 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 9  ? N VAL A 9  O MET A 82 ? O MET A 82 
A 2 3 O THR A 83 ? O THR A 83 N LEU A 54 ? N LEU A 54 
A 3 4 N ILE A 56 ? N ILE A 56 O ILE A 59 ? O ILE A 59 
B 1 2 N GLY A 24 ? N GLY A 24 O MET A 29 ? O MET A 29 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1  O A HIS 46 ? ? HH21 A ARG 48 ? ? 1.53 
2  1  O A GLY 40 ? ? H    A GLN 44 ? ? 1.60 
3  2  O A HIS 46 ? ? HH21 A ARG 48 ? ? 1.56 
4  3  O A LEU 67 ? ? H    A ASN 71 ? ? 1.57 
5  4  O A HIS 46 ? ? HH21 A ARG 48 ? ? 1.54 
6  5  O A HIS 46 ? ? HH21 A ARG 48 ? ? 1.52 
7  7  O A HIS 46 ? ? HH21 A ARG 48 ? ? 1.50 
8  7  O A LEU 67 ? ? H    A ASN 71 ? ? 1.55 
9  8  H A ILE 56 ? ? O    A ILE 59 ? ? 1.55 
10 8  O A HIS 46 ? ? HH21 A ARG 48 ? ? 1.56 
11 8  O A ILE 56 ? ? H    A ILE 59 ? ? 1.57 
12 9  O A LEU 67 ? ? H    A ASN 71 ? ? 1.52 
13 10 O A GLY 40 ? ? HG   A SER 43 ? ? 1.57 
14 11 O A HIS 46 ? ? HH21 A ARG 48 ? ? 1.53 
15 11 O A LEU 67 ? ? H    A ASN 71 ? ? 1.60 
16 12 O A HIS 46 ? ? HH21 A ARG 48 ? ? 1.52 
17 12 O A LEU 67 ? ? H    A ASN 71 ? ? 1.60 
18 13 O A HIS 46 ? ? HH21 A ARG 48 ? ? 1.51 
19 13 O A HIS 66 ? ? H    A GLN 70 ? ? 1.52 
20 13 O A ILE 56 ? ? H    A ILE 59 ? ? 1.52 
21 13 H A ILE 56 ? ? O    A ILE 59 ? ? 1.57 
22 14 H A ILE 56 ? ? O    A ILE 59 ? ? 1.53 
23 14 O A LEU 67 ? ? H    A ASN 71 ? ? 1.57 
24 14 H A ASP 57 ? ? O    A ASN 81 ? ? 1.60 
25 15 O A HIS 46 ? ? HH21 A ARG 48 ? ? 1.54 
26 15 H A ILE 56 ? ? O    A ILE 59 ? ? 1.55 
27 15 O A LEU 54 ? ? H    A ALA 61 ? ? 1.55 
28 15 O A ILE 56 ? ? H    A ILE 59 ? ? 1.56 
29 15 O A LEU 67 ? ? H    A ASN 71 ? ? 1.58 
30 15 H A ASP 57 ? ? O    A ASN 81 ? ? 1.58 
31 15 O A GLY 24 ? ? H    A MET 29 ? ? 1.59 
32 19 O A ILE 73 ? ? H    A CYS 76 ? ? 1.52 
33 19 O A GLY 24 ? ? H    A MET 29 ? ? 1.53 
34 19 O A LEU 67 ? ? H    A ASN 71 ? ? 1.53 
35 20 O A HIS 66 ? ? H    A GLN 70 ? ? 1.52 
36 20 O A HIS 46 ? ? HH21 A ARG 48 ? ? 1.54 
37 20 O A GLY 18 ? ? H    A LYS 37 ? ? 1.59 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  SER A 6  ? ? -43.75  161.54  
2   1  ALA A 15 ? ? 161.94  -50.36  
3   1  ASN A 28 ? ? 80.46   33.12   
4   1  ALA A 61 ? ? -98.81  36.52   
5   1  SER A 88 ? ? 41.63   -162.97 
6   1  ALA A 90 ? ? -108.74 72.86   
7   2  SER A 5  ? ? -98.15  -69.03  
8   2  SER A 6  ? ? 54.13   170.71  
9   2  ALA A 15 ? ? 162.14  -50.38  
10  2  ASN A 28 ? ? 77.12   44.57   
11  2  ASP A 57 ? ? 71.31   44.51   
12  2  ALA A 61 ? ? -92.67  31.13   
13  2  GLU A 68 ? ? -49.22  -70.61  
14  2  CYS A 76 ? ? -67.37  95.52   
15  2  ALA A 89 ? ? 63.00   69.07   
16  2  ALA A 90 ? ? -152.06 73.57   
17  3  SER A 2  ? ? 69.37   85.29   
18  3  SER A 3  ? ? -170.08 124.29  
19  3  SER A 5  ? ? -173.62 -59.22  
20  3  SER A 6  ? ? 62.37   167.02  
21  3  ALA A 15 ? ? 161.52  -50.19  
22  3  ASP A 57 ? ? 74.06   56.10   
23  3  ALA A 90 ? ? -171.58 68.21   
24  3  SER A 98 ? ? -48.36  106.87  
25  4  SER A 6  ? ? -132.19 -89.60  
26  4  ALA A 15 ? ? 162.07  -50.29  
27  4  MET A 64 ? ? -39.58  127.96  
28  4  ALA A 89 ? ? -169.70 78.62   
29  4  LYS A 92 ? ? -68.06  97.09   
30  5  SER A 2  ? ? -161.01 112.59  
31  5  SER A 3  ? ? 59.96   162.57  
32  5  ALA A 15 ? ? 161.51  -50.05  
33  5  ASN A 28 ? ? 81.61   37.65   
34  5  ASP A 57 ? ? 74.66   46.50   
35  5  MET A 64 ? ? -39.00  124.46  
36  5  ALA A 87 ? ? -102.90 75.26   
37  5  ALA A 91 ? ? 62.28   118.51  
38  6  SER A 2  ? ? 69.36   -69.94  
39  6  SER A 6  ? ? -50.71  173.59  
40  6  ALA A 15 ? ? 161.89  -50.22  
41  6  ASN A 28 ? ? 81.03   56.18   
42  6  ASP A 57 ? ? 71.64   49.76   
43  6  SER A 88 ? ? -152.59 84.27   
44  6  ALA A 89 ? ? -172.33 104.78  
45  6  ALA A 90 ? ? 56.70   173.25  
46  6  ALA A 91 ? ? 62.75   117.17  
47  7  SER A 3  ? ? -97.56  -62.27  
48  7  SER A 5  ? ? -127.26 -51.85  
49  7  SER A 6  ? ? 60.70   164.96  
50  7  ALA A 15 ? ? 161.72  -50.09  
51  7  PRO A 30 ? ? -74.98  -161.56 
52  7  ALA A 89 ? ? 64.65   176.87  
53  8  SER A 3  ? ? 73.87   -59.41  
54  8  SER A 6  ? ? -52.86  173.30  
55  8  ALA A 15 ? ? 161.26  -49.57  
56  8  ALA A 61 ? ? -89.51  43.17   
57  8  CYS A 76 ? ? -58.26  105.23  
58  9  ALA A 15 ? ? 161.80  -50.15  
59  9  ASN A 28 ? ? 78.29   36.64   
60  9  ASP A 57 ? ? 71.57   43.86   
61  9  ALA A 61 ? ? -102.35 40.21   
62  9  ALA A 89 ? ? -170.86 100.11  
63  10 SER A 2  ? ? 59.82   106.89  
64  10 SER A 6  ? ? 53.69   174.89  
65  10 ALA A 15 ? ? 161.67  -50.14  
66  10 ASN A 28 ? ? 72.78   43.50   
67  10 ASP A 57 ? ? 71.23   50.65   
68  10 GLN A 62 ? ? -92.97  53.51   
69  10 ALA A 89 ? ? 54.93   88.28   
70  11 SER A 2  ? ? 65.40   153.57  
71  11 SER A 3  ? ? 64.83   -76.45  
72  11 ALA A 15 ? ? 161.89  -50.52  
73  11 ASP A 57 ? ? 75.81   55.26   
74  11 ALA A 75 ? ? -94.55  45.80   
75  11 THR A 77 ? ? -173.24 120.63  
76  11 ALA A 87 ? ? -163.96 98.42   
77  11 SER A 98 ? ? -171.96 147.48  
78  12 SER A 5  ? ? -101.41 -64.68  
79  12 SER A 6  ? ? -134.31 -46.90  
80  12 ALA A 15 ? ? 161.96  -50.25  
81  12 ASN A 28 ? ? 70.04   35.48   
82  12 ASP A 57 ? ? 76.73   46.57   
83  12 SER A 88 ? ? 38.88   87.16   
84  12 ALA A 89 ? ? 52.49   -177.11 
85  13 ALA A 15 ? ? 161.26  -49.63  
86  13 ASN A 28 ? ? 77.80   46.16   
87  13 ALA A 61 ? ? -89.54  42.86   
88  13 ALA A 89 ? ? -168.24 107.08  
89  13 ALA A 91 ? ? -175.11 86.39   
90  14 SER A 2  ? ? -152.99 -57.01  
91  14 SER A 5  ? ? -165.21 -57.89  
92  14 ALA A 15 ? ? 161.72  -50.14  
93  14 ASN A 28 ? ? 75.49   39.42   
94  14 ALA A 61 ? ? -88.19  44.58   
95  14 CYS A 76 ? ? -42.14  150.90  
96  14 ALA A 91 ? ? -170.31 130.44  
97  15 SER A 6  ? ? -86.38  -80.91  
98  15 ALA A 15 ? ? 161.94  -49.87  
99  15 ASN A 28 ? ? 72.25   36.37   
100 15 ALA A 61 ? ? -87.51  44.66   
101 15 GLN A 62 ? ? -103.30 41.27   
102 15 ALA A 87 ? ? -161.22 97.79   
103 15 ALA A 89 ? ? 179.81  172.91  
104 15 ALA A 90 ? ? 59.75   90.45   
105 15 LYS A 92 ? ? 59.80   82.47   
106 15 SER A 98 ? ? -175.39 84.34   
107 16 SER A 3  ? ? -121.20 -62.12  
108 16 SER A 6  ? ? 50.27   -178.82 
109 16 ALA A 15 ? ? 161.47  -49.93  
110 16 CYS A 76 ? ? -59.23  91.41   
111 16 THR A 77 ? ? -104.28 72.20   
112 16 ALA A 87 ? ? -110.76 79.37   
113 16 ALA A 89 ? ? 63.77   78.72   
114 16 SER A 98 ? ? -178.20 118.14  
115 17 SER A 5  ? ? -178.01 144.71  
116 17 SER A 6  ? ? -64.76  -176.12 
117 17 ALA A 15 ? ? 161.69  -50.19  
118 17 ALA A 61 ? ? -94.59  31.61   
119 17 ALA A 89 ? ? 61.97   163.65  
120 17 ALA A 90 ? ? 62.91   124.68  
121 17 ALA A 91 ? ? 62.36   76.35   
122 17 SER A 98 ? ? -170.21 139.97  
123 18 SER A 2  ? ? 61.70   95.66   
124 18 SER A 6  ? ? -122.23 -84.00  
125 18 ALA A 15 ? ? 161.67  -50.04  
126 18 ASN A 28 ? ? 70.82   41.46   
127 18 ASP A 57 ? ? 72.76   43.65   
128 18 ALA A 87 ? ? -171.09 94.10   
129 18 SER A 88 ? ? -46.27  169.06  
130 18 SER A 98 ? ? -172.33 140.71  
131 19 SER A 5  ? ? 49.61   95.83   
132 19 SER A 6  ? ? 53.79   172.58  
133 19 ALA A 15 ? ? 161.78  -50.07  
134 19 ASP A 57 ? ? 75.26   42.06   
135 19 ALA A 89 ? ? 63.51   127.28  
136 19 ALA A 91 ? ? 54.52   95.53   
137 19 LYS A 92 ? ? -47.79  150.42  
138 19 SER A 98 ? ? -166.51 106.97  
139 20 SER A 3  ? ? -105.24 -64.38  
140 20 ALA A 15 ? ? 161.37  -49.71  
141 20 ASN A 28 ? ? 73.12   42.48   
142 20 GLN A 62 ? ? -98.88  43.44   
143 20 ALA A 87 ? ? -159.44 80.44   
144 20 ALA A 89 ? ? -173.52 94.37   
145 20 ALA A 90 ? ? -174.51 124.33  
146 20 ALA A 91 ? ? 65.41   -169.30 
147 20 SER A 98 ? ? -166.97 108.10  
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'RIKEN Structural Genomics/Proteomics Initiative' 
_pdbx_SG_project.initial_of_center     RSGI 
# 
_pdbx_nmr_ensemble.entry_id                                      1WF7 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations, structures with the lowest energy, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1WF7 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1.06mM 13C, 15N-labeled protein; 20mM PiNa(pH6.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_refine.entry_id           1WF7 
_pdbx_nmr_refine.method             'torsion angle dynamic' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
VNMR    6.1C     collection           Varian          1 
NMRPipe 20020425 processing           Delaglio.F.     2 
NMRView 5.0.4    'data analysis'      'Johnson, B.A.' 3 
KUJIRA  0.854    'data analysis'      'Kobayashi, N.' 4 
CYANA   1.0.7    'structure solution' 'Guentert, P.'  5 
CYANA   1.0.7    refinement           'Guentert, P.'  6 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
ILE N    N N N 158 
ILE CA   C N S 159 
ILE C    C N N 160 
ILE O    O N N 161 
ILE CB   C N S 162 
ILE CG1  C N N 163 
ILE CG2  C N N 164 
ILE CD1  C N N 165 
ILE OXT  O N N 166 
ILE H    H N N 167 
ILE H2   H N N 168 
ILE HA   H N N 169 
ILE HB   H N N 170 
ILE HG12 H N N 171 
ILE HG13 H N N 172 
ILE HG21 H N N 173 
ILE HG22 H N N 174 
ILE HG23 H N N 175 
ILE HD11 H N N 176 
ILE HD12 H N N 177 
ILE HD13 H N N 178 
ILE HXT  H N N 179 
LEU N    N N N 180 
LEU CA   C N S 181 
LEU C    C N N 182 
LEU O    O N N 183 
LEU CB   C N N 184 
LEU CG   C N N 185 
LEU CD1  C N N 186 
LEU CD2  C N N 187 
LEU OXT  O N N 188 
LEU H    H N N 189 
LEU H2   H N N 190 
LEU HA   H N N 191 
LEU HB2  H N N 192 
LEU HB3  H N N 193 
LEU HG   H N N 194 
LEU HD11 H N N 195 
LEU HD12 H N N 196 
LEU HD13 H N N 197 
LEU HD21 H N N 198 
LEU HD22 H N N 199 
LEU HD23 H N N 200 
LEU HXT  H N N 201 
LYS N    N N N 202 
LYS CA   C N S 203 
LYS C    C N N 204 
LYS O    O N N 205 
LYS CB   C N N 206 
LYS CG   C N N 207 
LYS CD   C N N 208 
LYS CE   C N N 209 
LYS NZ   N N N 210 
LYS OXT  O N N 211 
LYS H    H N N 212 
LYS H2   H N N 213 
LYS HA   H N N 214 
LYS HB2  H N N 215 
LYS HB3  H N N 216 
LYS HG2  H N N 217 
LYS HG3  H N N 218 
LYS HD2  H N N 219 
LYS HD3  H N N 220 
LYS HE2  H N N 221 
LYS HE3  H N N 222 
LYS HZ1  H N N 223 
LYS HZ2  H N N 224 
LYS HZ3  H N N 225 
LYS HXT  H N N 226 
MET N    N N N 227 
MET CA   C N S 228 
MET C    C N N 229 
MET O    O N N 230 
MET CB   C N N 231 
MET CG   C N N 232 
MET SD   S N N 233 
MET CE   C N N 234 
MET OXT  O N N 235 
MET H    H N N 236 
MET H2   H N N 237 
MET HA   H N N 238 
MET HB2  H N N 239 
MET HB3  H N N 240 
MET HG2  H N N 241 
MET HG3  H N N 242 
MET HE1  H N N 243 
MET HE2  H N N 244 
MET HE3  H N N 245 
MET HXT  H N N 246 
PHE N    N N N 247 
PHE CA   C N S 248 
PHE C    C N N 249 
PHE O    O N N 250 
PHE CB   C N N 251 
PHE CG   C Y N 252 
PHE CD1  C Y N 253 
PHE CD2  C Y N 254 
PHE CE1  C Y N 255 
PHE CE2  C Y N 256 
PHE CZ   C Y N 257 
PHE OXT  O N N 258 
PHE H    H N N 259 
PHE H2   H N N 260 
PHE HA   H N N 261 
PHE HB2  H N N 262 
PHE HB3  H N N 263 
PHE HD1  H N N 264 
PHE HD2  H N N 265 
PHE HE1  H N N 266 
PHE HE2  H N N 267 
PHE HZ   H N N 268 
PHE HXT  H N N 269 
PRO N    N N N 270 
PRO CA   C N S 271 
PRO C    C N N 272 
PRO O    O N N 273 
PRO CB   C N N 274 
PRO CG   C N N 275 
PRO CD   C N N 276 
PRO OXT  O N N 277 
PRO H    H N N 278 
PRO HA   H N N 279 
PRO HB2  H N N 280 
PRO HB3  H N N 281 
PRO HG2  H N N 282 
PRO HG3  H N N 283 
PRO HD2  H N N 284 
PRO HD3  H N N 285 
PRO HXT  H N N 286 
SER N    N N N 287 
SER CA   C N S 288 
SER C    C N N 289 
SER O    O N N 290 
SER CB   C N N 291 
SER OG   O N N 292 
SER OXT  O N N 293 
SER H    H N N 294 
SER H2   H N N 295 
SER HA   H N N 296 
SER HB2  H N N 297 
SER HB3  H N N 298 
SER HG   H N N 299 
SER HXT  H N N 300 
THR N    N N N 301 
THR CA   C N S 302 
THR C    C N N 303 
THR O    O N N 304 
THR CB   C N R 305 
THR OG1  O N N 306 
THR CG2  C N N 307 
THR OXT  O N N 308 
THR H    H N N 309 
THR H2   H N N 310 
THR HA   H N N 311 
THR HB   H N N 312 
THR HG1  H N N 313 
THR HG21 H N N 314 
THR HG22 H N N 315 
THR HG23 H N N 316 
THR HXT  H N N 317 
TRP N    N N N 318 
TRP CA   C N S 319 
TRP C    C N N 320 
TRP O    O N N 321 
TRP CB   C N N 322 
TRP CG   C Y N 323 
TRP CD1  C Y N 324 
TRP CD2  C Y N 325 
TRP NE1  N Y N 326 
TRP CE2  C Y N 327 
TRP CE3  C Y N 328 
TRP CZ2  C Y N 329 
TRP CZ3  C Y N 330 
TRP CH2  C Y N 331 
TRP OXT  O N N 332 
TRP H    H N N 333 
TRP H2   H N N 334 
TRP HA   H N N 335 
TRP HB2  H N N 336 
TRP HB3  H N N 337 
TRP HD1  H N N 338 
TRP HE1  H N N 339 
TRP HE3  H N N 340 
TRP HZ2  H N N 341 
TRP HZ3  H N N 342 
TRP HH2  H N N 343 
TRP HXT  H N N 344 
VAL N    N N N 345 
VAL CA   C N S 346 
VAL C    C N N 347 
VAL O    O N N 348 
VAL CB   C N N 349 
VAL CG1  C N N 350 
VAL CG2  C N N 351 
VAL OXT  O N N 352 
VAL H    H N N 353 
VAL H2   H N N 354 
VAL HA   H N N 355 
VAL HB   H N N 356 
VAL HG11 H N N 357 
VAL HG12 H N N 358 
VAL HG13 H N N 359 
VAL HG21 H N N 360 
VAL HG22 H N N 361 
VAL HG23 H N N 362 
VAL HXT  H N N 363 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MET N   CA   sing N N 216 
MET N   H    sing N N 217 
MET N   H2   sing N N 218 
MET CA  C    sing N N 219 
MET CA  CB   sing N N 220 
MET CA  HA   sing N N 221 
MET C   O    doub N N 222 
MET C   OXT  sing N N 223 
MET CB  CG   sing N N 224 
MET CB  HB2  sing N N 225 
MET CB  HB3  sing N N 226 
MET CG  SD   sing N N 227 
MET CG  HG2  sing N N 228 
MET CG  HG3  sing N N 229 
MET SD  CE   sing N N 230 
MET CE  HE1  sing N N 231 
MET CE  HE2  sing N N 232 
MET CE  HE3  sing N N 233 
MET OXT HXT  sing N N 234 
PHE N   CA   sing N N 235 
PHE N   H    sing N N 236 
PHE N   H2   sing N N 237 
PHE CA  C    sing N N 238 
PHE CA  CB   sing N N 239 
PHE CA  HA   sing N N 240 
PHE C   O    doub N N 241 
PHE C   OXT  sing N N 242 
PHE CB  CG   sing N N 243 
PHE CB  HB2  sing N N 244 
PHE CB  HB3  sing N N 245 
PHE CG  CD1  doub Y N 246 
PHE CG  CD2  sing Y N 247 
PHE CD1 CE1  sing Y N 248 
PHE CD1 HD1  sing N N 249 
PHE CD2 CE2  doub Y N 250 
PHE CD2 HD2  sing N N 251 
PHE CE1 CZ   doub Y N 252 
PHE CE1 HE1  sing N N 253 
PHE CE2 CZ   sing Y N 254 
PHE CE2 HE2  sing N N 255 
PHE CZ  HZ   sing N N 256 
PHE OXT HXT  sing N N 257 
PRO N   CA   sing N N 258 
PRO N   CD   sing N N 259 
PRO N   H    sing N N 260 
PRO CA  C    sing N N 261 
PRO CA  CB   sing N N 262 
PRO CA  HA   sing N N 263 
PRO C   O    doub N N 264 
PRO C   OXT  sing N N 265 
PRO CB  CG   sing N N 266 
PRO CB  HB2  sing N N 267 
PRO CB  HB3  sing N N 268 
PRO CG  CD   sing N N 269 
PRO CG  HG2  sing N N 270 
PRO CG  HG3  sing N N 271 
PRO CD  HD2  sing N N 272 
PRO CD  HD3  sing N N 273 
PRO OXT HXT  sing N N 274 
SER N   CA   sing N N 275 
SER N   H    sing N N 276 
SER N   H2   sing N N 277 
SER CA  C    sing N N 278 
SER CA  CB   sing N N 279 
SER CA  HA   sing N N 280 
SER C   O    doub N N 281 
SER C   OXT  sing N N 282 
SER CB  OG   sing N N 283 
SER CB  HB2  sing N N 284 
SER CB  HB3  sing N N 285 
SER OG  HG   sing N N 286 
SER OXT HXT  sing N N 287 
THR N   CA   sing N N 288 
THR N   H    sing N N 289 
THR N   H2   sing N N 290 
THR CA  C    sing N N 291 
THR CA  CB   sing N N 292 
THR CA  HA   sing N N 293 
THR C   O    doub N N 294 
THR C   OXT  sing N N 295 
THR CB  OG1  sing N N 296 
THR CB  CG2  sing N N 297 
THR CB  HB   sing N N 298 
THR OG1 HG1  sing N N 299 
THR CG2 HG21 sing N N 300 
THR CG2 HG22 sing N N 301 
THR CG2 HG23 sing N N 302 
THR OXT HXT  sing N N 303 
TRP N   CA   sing N N 304 
TRP N   H    sing N N 305 
TRP N   H2   sing N N 306 
TRP CA  C    sing N N 307 
TRP CA  CB   sing N N 308 
TRP CA  HA   sing N N 309 
TRP C   O    doub N N 310 
TRP C   OXT  sing N N 311 
TRP CB  CG   sing N N 312 
TRP CB  HB2  sing N N 313 
TRP CB  HB3  sing N N 314 
TRP CG  CD1  doub Y N 315 
TRP CG  CD2  sing Y N 316 
TRP CD1 NE1  sing Y N 317 
TRP CD1 HD1  sing N N 318 
TRP CD2 CE2  doub Y N 319 
TRP CD2 CE3  sing Y N 320 
TRP NE1 CE2  sing Y N 321 
TRP NE1 HE1  sing N N 322 
TRP CE2 CZ2  sing Y N 323 
TRP CE3 CZ3  doub Y N 324 
TRP CE3 HE3  sing N N 325 
TRP CZ2 CH2  doub Y N 326 
TRP CZ2 HZ2  sing N N 327 
TRP CZ3 CH2  sing Y N 328 
TRP CZ3 HZ3  sing N N 329 
TRP CH2 HH2  sing N N 330 
TRP OXT HXT  sing N N 331 
VAL N   CA   sing N N 332 
VAL N   H    sing N N 333 
VAL N   H2   sing N N 334 
VAL CA  C    sing N N 335 
VAL CA  CB   sing N N 336 
VAL CA  HA   sing N N 337 
VAL C   O    doub N N 338 
VAL C   OXT  sing N N 339 
VAL CB  CG1  sing N N 340 
VAL CB  CG2  sing N N 341 
VAL CB  HB   sing N N 342 
VAL CG1 HG11 sing N N 343 
VAL CG1 HG12 sing N N 344 
VAL CG1 HG13 sing N N 345 
VAL CG2 HG21 sing N N 346 
VAL CG2 HG22 sing N N 347 
VAL CG2 HG23 sing N N 348 
VAL OXT HXT  sing N N 349 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.field_strength    800 
# 
_atom_sites.entry_id                    1WF7 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_