data_1WF8 # _entry.id 1WF8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WF8 pdb_00001wf8 10.2210/pdb1wf8/pdb RCSB RCSB023514 ? ? WWPDB D_1000023514 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-06-07 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WF8 _pdbx_database_status.recvd_initial_deposition_date 2004-05-26 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk002001196 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.' 1 'Hayashi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the PDZ domain of Spinophilin/NeurabinII protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Neurabin-I _entity.formula_weight 10953.249 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'PDZ domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Spinophilin/NeurabinII, Neural tissue-specific F-actin binding protein I' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGLELFPVELEKDEDGLGISIIGMGVGADAGLEKLGIFVKTVTEGGAAQRDGRIQVNDQIVEVDGISLVGVTQNF AATVLRNTKGNVRFVIGREKPSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGLELFPVELEKDEDGLGISIIGMGVGADAGLEKLGIFVKTVTEGGAAQRDGRIQVNDQIVEVDGISLVGVTQNF AATVLRNTKGNVRFVIGREKPSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002001196 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LEU n 1 9 GLU n 1 10 LEU n 1 11 PHE n 1 12 PRO n 1 13 VAL n 1 14 GLU n 1 15 LEU n 1 16 GLU n 1 17 LYS n 1 18 ASP n 1 19 GLU n 1 20 ASP n 1 21 GLY n 1 22 LEU n 1 23 GLY n 1 24 ILE n 1 25 SER n 1 26 ILE n 1 27 ILE n 1 28 GLY n 1 29 MET n 1 30 GLY n 1 31 VAL n 1 32 GLY n 1 33 ALA n 1 34 ASP n 1 35 ALA n 1 36 GLY n 1 37 LEU n 1 38 GLU n 1 39 LYS n 1 40 LEU n 1 41 GLY n 1 42 ILE n 1 43 PHE n 1 44 VAL n 1 45 LYS n 1 46 THR n 1 47 VAL n 1 48 THR n 1 49 GLU n 1 50 GLY n 1 51 GLY n 1 52 ALA n 1 53 ALA n 1 54 GLN n 1 55 ARG n 1 56 ASP n 1 57 GLY n 1 58 ARG n 1 59 ILE n 1 60 GLN n 1 61 VAL n 1 62 ASN n 1 63 ASP n 1 64 GLN n 1 65 ILE n 1 66 VAL n 1 67 GLU n 1 68 VAL n 1 69 ASP n 1 70 GLY n 1 71 ILE n 1 72 SER n 1 73 LEU n 1 74 VAL n 1 75 GLY n 1 76 VAL n 1 77 THR n 1 78 GLN n 1 79 ASN n 1 80 PHE n 1 81 ALA n 1 82 ALA n 1 83 THR n 1 84 VAL n 1 85 LEU n 1 86 ARG n 1 87 ASN n 1 88 THR n 1 89 LYS n 1 90 GLY n 1 91 ASN n 1 92 VAL n 1 93 ARG n 1 94 PHE n 1 95 VAL n 1 96 ILE n 1 97 GLY n 1 98 ARG n 1 99 GLU n 1 100 LYS n 1 101 PRO n 1 102 SER n 1 103 GLY n 1 104 PRO n 1 105 SER n 1 106 SER n 1 107 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'Kazusa cNDA fh03567' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P021030-40 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 GLY 107 107 107 GLY GLY A . n # _exptl.entry_id 1WF8 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1WF8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1WF8 _struct.title 'Solution structure of the PDZ domain of Spinophilin/NeurabinII protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WF8 _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text ;PDZ domain, Spinophilin/NeurabinII protein, STRUCTURAL GENOMICS, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NEB1_HUMAN _struct_ref.pdbx_db_accession Q9ULJ8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LELFPVELEKDEDGLGISIIGMGVGADAGLEKLGIFVKTVTEGGAAQRDGRIQVNDQIVEVDGISLVGVTQNFAATVLRN TKGNVRFVIGREKP ; _struct_ref.pdbx_align_begin 144 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WF8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 101 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9ULJ8 _struct_ref_seq.db_align_beg 144 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 237 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 101 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WF8 GLY A 1 ? UNP Q9ULJ8 ? ? 'cloning artifact' 1 1 1 1WF8 SER A 2 ? UNP Q9ULJ8 ? ? 'cloning artifact' 2 2 1 1WF8 SER A 3 ? UNP Q9ULJ8 ? ? 'cloning artifact' 3 3 1 1WF8 GLY A 4 ? UNP Q9ULJ8 ? ? 'cloning artifact' 4 4 1 1WF8 SER A 5 ? UNP Q9ULJ8 ? ? 'cloning artifact' 5 5 1 1WF8 SER A 6 ? UNP Q9ULJ8 ? ? 'cloning artifact' 6 6 1 1WF8 GLY A 7 ? UNP Q9ULJ8 ? ? 'cloning artifact' 7 7 1 1WF8 SER A 102 ? UNP Q9ULJ8 ? ? 'cloning artifact' 102 8 1 1WF8 GLY A 103 ? UNP Q9ULJ8 ? ? 'cloning artifact' 103 9 1 1WF8 PRO A 104 ? UNP Q9ULJ8 ? ? 'cloning artifact' 104 10 1 1WF8 SER A 105 ? UNP Q9ULJ8 ? ? 'cloning artifact' 105 11 1 1WF8 SER A 106 ? UNP Q9ULJ8 ? ? 'cloning artifact' 106 12 1 1WF8 GLY A 107 ? UNP Q9ULJ8 ? ? 'cloning artifact' 107 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 51 ? GLY A 57 ? GLY A 51 GLY A 57 1 ? 7 HELX_P HELX_P2 2 THR A 77 ? THR A 88 ? THR A 77 THR A 88 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 8 ? GLU A 16 ? LEU A 8 GLU A 16 A 2 ASN A 91 ? GLU A 99 ? ASN A 91 GLU A 99 A 3 ILE A 65 ? VAL A 68 ? ILE A 65 VAL A 68 A 4 ILE A 71 ? SER A 72 ? ILE A 71 SER A 72 B 1 ILE A 24 ? VAL A 31 ? ILE A 24 VAL A 31 B 2 LYS A 39 ? VAL A 47 ? LYS A 39 VAL A 47 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 9 ? N GLU A 9 O ARG A 98 ? O ARG A 98 A 2 3 O VAL A 95 ? O VAL A 95 N GLU A 67 ? N GLU A 67 A 3 4 N VAL A 68 ? N VAL A 68 O ILE A 71 ? O ILE A 71 B 1 2 N MET A 29 ? N MET A 29 O GLY A 41 ? O GLY A 41 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A LYS 17 ? ? O A GLY 90 ? ? 1.45 2 1 H A GLU 9 ? ? O A ARG 98 ? ? 1.50 3 1 H A ASP 69 ? ? O A ARG 93 ? ? 1.50 4 1 O A VAL 44 ? ? H A ASN 62 ? ? 1.54 5 1 O A MET 29 ? ? H A GLY 41 ? ? 1.55 6 1 O A GLN 78 ? ? H A ALA 82 ? ? 1.55 7 1 O A VAL 13 ? ? H A PHE 94 ? ? 1.58 8 1 H A ASP 18 ? ? O A GLY 21 ? ? 1.58 9 1 H A VAL 68 ? ? O A ILE 71 ? ? 1.59 10 2 H A GLU 9 ? ? O A ARG 98 ? ? 1.48 11 2 H A ASP 69 ? ? O A ARG 93 ? ? 1.51 12 2 H A LYS 17 ? ? O A GLY 90 ? ? 1.52 13 2 O A VAL 44 ? ? H A ASN 62 ? ? 1.54 14 2 O A VAL 13 ? ? H A PHE 94 ? ? 1.54 15 2 H A VAL 68 ? ? O A ILE 71 ? ? 1.58 16 2 H A ASP 18 ? ? O A GLY 21 ? ? 1.59 17 2 HZ1 A LYS 17 ? ? O A THR 88 ? ? 1.60 18 3 H A GLU 9 ? ? O A ARG 98 ? ? 1.47 19 3 H A LYS 17 ? ? O A GLY 90 ? ? 1.51 20 3 H A ASP 69 ? ? O A ARG 93 ? ? 1.52 21 3 O A MET 29 ? ? H A GLY 41 ? ? 1.52 22 3 H A VAL 68 ? ? O A ILE 71 ? ? 1.56 23 3 O A VAL 44 ? ? H A ASN 62 ? ? 1.56 24 4 H A GLU 9 ? ? O A ARG 98 ? ? 1.48 25 4 H A ASP 69 ? ? O A ARG 93 ? ? 1.50 26 4 O A VAL 44 ? ? H A ASN 62 ? ? 1.52 27 4 H A LYS 17 ? ? O A GLY 90 ? ? 1.53 28 4 H A VAL 68 ? ? O A ILE 71 ? ? 1.55 29 4 O A VAL 13 ? ? H A PHE 94 ? ? 1.60 30 5 H A ASP 69 ? ? O A ARG 93 ? ? 1.51 31 5 H A ASP 18 ? ? O A GLY 21 ? ? 1.53 32 5 O A MET 29 ? ? H A GLY 41 ? ? 1.53 33 5 H A GLU 9 ? ? O A ARG 98 ? ? 1.55 34 5 H A LYS 17 ? ? O A GLY 90 ? ? 1.56 35 5 H A GLN 60 ? ? OD2 A ASP 63 ? ? 1.57 36 5 O A VAL 13 ? ? H A PHE 94 ? ? 1.57 37 5 H A VAL 68 ? ? O A ILE 71 ? ? 1.58 38 6 H A LYS 17 ? ? O A GLY 90 ? ? 1.47 39 6 H A ASP 69 ? ? O A ARG 93 ? ? 1.49 40 6 H A GLU 9 ? ? O A ARG 98 ? ? 1.49 41 6 O A VAL 44 ? ? H A ASN 62 ? ? 1.58 42 6 H A GLN 60 ? ? OD2 A ASP 63 ? ? 1.59 43 7 O A MET 29 ? ? H A GLY 41 ? ? 1.46 44 7 H A LYS 17 ? ? O A GLY 90 ? ? 1.50 45 7 O A VAL 44 ? ? H A ASN 62 ? ? 1.51 46 7 H A ASP 69 ? ? O A ARG 93 ? ? 1.53 47 7 H A GLU 9 ? ? O A ARG 98 ? ? 1.56 48 7 H A VAL 68 ? ? O A ILE 71 ? ? 1.57 49 7 O A VAL 13 ? ? H A PHE 94 ? ? 1.59 50 8 H A LYS 17 ? ? O A GLY 90 ? ? 1.48 51 8 H A ASP 69 ? ? O A ARG 93 ? ? 1.48 52 8 O A VAL 44 ? ? H A ASN 62 ? ? 1.51 53 8 O A VAL 13 ? ? H A PHE 94 ? ? 1.56 54 8 H A GLU 9 ? ? O A ARG 98 ? ? 1.57 55 9 H A ASP 69 ? ? O A ARG 93 ? ? 1.47 56 9 H A ASP 18 ? ? O A GLY 21 ? ? 1.53 57 9 O A VAL 13 ? ? H A PHE 94 ? ? 1.53 58 9 H A VAL 68 ? ? O A ILE 71 ? ? 1.56 59 9 H A LYS 17 ? ? O A GLY 90 ? ? 1.56 60 9 H A GLU 9 ? ? O A ARG 98 ? ? 1.56 61 9 O A VAL 44 ? ? H A ASN 62 ? ? 1.57 62 10 H A LYS 17 ? ? O A GLY 90 ? ? 1.48 63 10 H A ASP 69 ? ? O A ARG 93 ? ? 1.49 64 10 O A VAL 44 ? ? H A ASN 62 ? ? 1.53 65 10 O A MET 29 ? ? H A GLY 41 ? ? 1.54 66 10 H A VAL 68 ? ? O A ILE 71 ? ? 1.55 67 10 HZ3 A LYS 17 ? ? O A THR 88 ? ? 1.56 68 10 O A VAL 13 ? ? H A PHE 94 ? ? 1.59 69 11 O A MET 29 ? ? H A GLY 41 ? ? 1.48 70 11 H A LYS 17 ? ? O A GLY 90 ? ? 1.51 71 11 H A ASP 69 ? ? O A ARG 93 ? ? 1.52 72 11 H A ASP 18 ? ? O A GLY 21 ? ? 1.52 73 11 O A VAL 13 ? ? H A PHE 94 ? ? 1.53 74 11 H A VAL 68 ? ? O A ILE 71 ? ? 1.54 75 11 H A GLU 9 ? ? O A ARG 98 ? ? 1.54 76 11 O A VAL 44 ? ? H A ASN 62 ? ? 1.55 77 11 O A GLN 78 ? ? H A ALA 82 ? ? 1.57 78 12 H A ASP 69 ? ? O A ARG 93 ? ? 1.49 79 12 H A LYS 17 ? ? O A GLY 90 ? ? 1.49 80 12 O A VAL 13 ? ? H A PHE 94 ? ? 1.51 81 12 H A GLU 9 ? ? O A ARG 98 ? ? 1.51 82 12 O A VAL 44 ? ? H A ASN 62 ? ? 1.55 83 12 H A VAL 68 ? ? O A ILE 71 ? ? 1.57 84 13 H A ASP 69 ? ? O A ARG 93 ? ? 1.47 85 13 H A GLU 9 ? ? O A ARG 98 ? ? 1.51 86 13 H A ASP 18 ? ? O A GLY 21 ? ? 1.51 87 13 H A LYS 17 ? ? O A GLY 90 ? ? 1.51 88 13 O A VAL 13 ? ? H A PHE 94 ? ? 1.52 89 13 O A VAL 44 ? ? H A ASN 62 ? ? 1.55 90 13 O A ASN 79 ? ? H A THR 83 ? ? 1.59 91 13 H A VAL 68 ? ? O A ILE 71 ? ? 1.59 92 13 O A GLN 78 ? ? H A ALA 82 ? ? 1.60 93 13 H A GLN 60 ? ? OD2 A ASP 63 ? ? 1.60 94 14 H A LYS 17 ? ? O A GLY 90 ? ? 1.51 95 14 H A ASP 69 ? ? O A ARG 93 ? ? 1.52 96 14 O A MET 29 ? ? H A GLY 41 ? ? 1.53 97 14 O A VAL 44 ? ? H A ASN 62 ? ? 1.56 98 14 H A ILE 27 ? ? O A PHE 43 ? ? 1.57 99 14 HZ2 A LYS 17 ? ? O A THR 88 ? ? 1.57 100 14 H A VAL 68 ? ? O A ILE 71 ? ? 1.57 101 14 H A GLN 60 ? ? OD2 A ASP 63 ? ? 1.58 102 14 O A VAL 13 ? ? H A PHE 94 ? ? 1.58 103 14 O A GLY 57 ? ? HE22 A GLN 60 ? ? 1.59 104 15 H A ASP 69 ? ? O A ARG 93 ? ? 1.46 105 15 H A GLU 9 ? ? O A ARG 98 ? ? 1.52 106 15 H A VAL 68 ? ? O A ILE 71 ? ? 1.55 107 15 H A GLN 60 ? ? OD2 A ASP 63 ? ? 1.56 108 15 H A ASP 18 ? ? O A GLY 21 ? ? 1.56 109 15 O A VAL 13 ? ? H A PHE 94 ? ? 1.56 110 15 O A VAL 84 ? ? H A ASN 87 ? ? 1.59 111 15 H A LYS 17 ? ? O A GLY 90 ? ? 1.59 112 16 H A ASP 69 ? ? O A ARG 93 ? ? 1.49 113 16 H A GLU 9 ? ? O A ARG 98 ? ? 1.50 114 16 HZ3 A LYS 17 ? ? O A THR 88 ? ? 1.51 115 16 H A ASP 18 ? ? O A GLY 21 ? ? 1.52 116 16 O A VAL 13 ? ? H A PHE 94 ? ? 1.54 117 16 O A VAL 44 ? ? H A ASN 62 ? ? 1.57 118 16 H A LYS 17 ? ? O A GLY 90 ? ? 1.58 119 16 H A VAL 68 ? ? O A ILE 71 ? ? 1.58 120 17 H A ASP 69 ? ? O A ARG 93 ? ? 1.48 121 17 O A VAL 13 ? ? H A PHE 94 ? ? 1.48 122 17 H A LYS 17 ? ? O A GLY 90 ? ? 1.49 123 17 O A VAL 44 ? ? H A ASN 62 ? ? 1.56 124 17 H A VAL 68 ? ? O A ILE 71 ? ? 1.57 125 17 H A VAL 13 ? ? O A PHE 94 ? ? 1.59 126 18 H A ASP 69 ? ? O A ARG 93 ? ? 1.44 127 18 O A MET 29 ? ? H A GLY 41 ? ? 1.47 128 18 O A VAL 13 ? ? H A PHE 94 ? ? 1.51 129 18 H A GLU 9 ? ? O A ARG 98 ? ? 1.53 130 18 H A ASP 18 ? ? O A GLY 21 ? ? 1.55 131 18 H A LYS 17 ? ? O A GLY 90 ? ? 1.56 132 18 H A VAL 68 ? ? O A ILE 71 ? ? 1.58 133 18 H A VAL 13 ? ? O A PHE 94 ? ? 1.60 134 18 H A GLN 60 ? ? OD2 A ASP 63 ? ? 1.60 135 18 O A VAL 44 ? ? H A ASN 62 ? ? 1.60 136 19 H A ASP 69 ? ? O A ARG 93 ? ? 1.48 137 19 H A GLU 9 ? ? O A ARG 98 ? ? 1.50 138 19 H A LYS 17 ? ? O A GLY 90 ? ? 1.51 139 19 H A VAL 68 ? ? O A ILE 71 ? ? 1.55 140 19 H A ASP 18 ? ? O A GLY 21 ? ? 1.56 141 19 O A VAL 13 ? ? H A PHE 94 ? ? 1.56 142 20 H A LYS 17 ? ? O A GLY 90 ? ? 1.47 143 20 H A ASP 69 ? ? O A ARG 93 ? ? 1.51 144 20 O A MET 29 ? ? H A GLY 41 ? ? 1.52 145 20 H A GLU 9 ? ? O A ARG 98 ? ? 1.55 146 20 O A VAL 13 ? ? H A PHE 94 ? ? 1.57 147 20 H A VAL 68 ? ? O A ILE 71 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -163.06 90.50 2 1 GLU A 19 ? ? -38.95 -29.80 3 1 ASP A 34 ? ? -116.93 61.92 4 1 ALA A 35 ? ? 78.11 -79.33 5 1 GLU A 49 ? ? -66.68 95.41 6 1 THR A 88 ? ? -38.73 158.44 7 1 SER A 102 ? ? -164.39 80.70 8 2 SER A 3 ? ? -134.35 -59.31 9 2 SER A 5 ? ? 178.59 147.89 10 2 LYS A 17 ? ? -39.12 158.01 11 2 ASP A 20 ? ? -119.57 51.21 12 2 ASP A 34 ? ? -87.81 47.64 13 2 ALA A 35 ? ? 76.32 -77.48 14 2 LEU A 37 ? ? -96.85 59.74 15 2 LEU A 73 ? ? -98.63 35.88 16 2 THR A 88 ? ? -39.83 160.27 17 2 SER A 102 ? ? -109.46 76.55 18 2 SER A 105 ? ? -146.60 -58.77 19 3 SER A 3 ? ? 66.45 165.35 20 3 SER A 6 ? ? -44.86 107.39 21 3 LYS A 17 ? ? -39.05 155.74 22 3 ASP A 34 ? ? -97.27 36.90 23 3 LEU A 37 ? ? -104.76 61.73 24 3 ARG A 58 ? ? -51.40 -70.03 25 3 THR A 88 ? ? -42.18 164.25 26 4 LYS A 17 ? ? -40.06 156.81 27 4 ASP A 34 ? ? -99.08 37.25 28 4 LEU A 37 ? ? -102.13 61.86 29 4 ARG A 58 ? ? -91.07 -67.11 30 4 THR A 88 ? ? -44.12 168.18 31 4 SER A 102 ? ? -164.37 77.53 32 4 SER A 105 ? ? 178.80 147.19 33 5 SER A 3 ? ? 51.96 99.32 34 5 ASP A 20 ? ? -118.04 51.41 35 5 GLU A 49 ? ? -68.36 95.66 36 5 ASN A 62 ? ? 77.34 -0.60 37 5 THR A 88 ? ? -37.18 155.73 38 5 SER A 102 ? ? -150.86 88.71 39 5 SER A 105 ? ? -150.60 -58.15 40 6 SER A 5 ? ? -159.03 -64.42 41 6 LYS A 17 ? ? -38.85 156.86 42 6 ASP A 34 ? ? -98.34 40.75 43 6 LEU A 37 ? ? -102.06 61.70 44 6 ASP A 69 ? ? 53.81 19.70 45 6 THR A 88 ? ? -42.35 164.19 46 6 SER A 102 ? ? 178.88 69.31 47 7 SER A 5 ? ? 63.07 155.95 48 7 LYS A 17 ? ? -40.39 155.70 49 7 THR A 88 ? ? -39.77 160.86 50 7 SER A 102 ? ? 70.95 56.11 51 8 SER A 5 ? ? -177.80 -60.78 52 8 LYS A 17 ? ? -40.65 159.60 53 8 VAL A 31 ? ? -80.21 -155.90 54 8 ASP A 34 ? ? -94.98 30.80 55 8 THR A 88 ? ? -43.59 168.28 56 8 SER A 102 ? ? -173.16 77.87 57 8 SER A 105 ? ? 55.88 107.28 58 9 SER A 3 ? ? 63.03 167.26 59 9 GLU A 19 ? ? -39.52 -29.34 60 9 ASP A 20 ? ? -118.43 51.36 61 9 ARG A 58 ? ? -47.31 -72.03 62 9 VAL A 61 ? ? -42.35 150.42 63 9 THR A 88 ? ? -40.11 161.94 64 10 SER A 3 ? ? 67.98 144.38 65 10 SER A 6 ? ? -179.59 91.87 66 10 LEU A 8 ? ? -127.98 -169.89 67 10 LYS A 17 ? ? -38.50 152.41 68 10 LEU A 37 ? ? -106.35 62.39 69 10 ARG A 58 ? ? -92.81 -65.92 70 10 THR A 88 ? ? -37.05 150.87 71 10 PRO A 101 ? ? -75.01 -168.57 72 10 SER A 102 ? ? -178.08 -38.02 73 10 SER A 105 ? ? -170.15 147.46 74 11 ASP A 34 ? ? -109.75 43.55 75 11 ARG A 58 ? ? -46.06 -70.52 76 11 VAL A 61 ? ? -40.97 150.47 77 11 THR A 88 ? ? -43.81 163.56 78 11 SER A 102 ? ? -176.86 79.27 79 12 SER A 3 ? ? 67.57 115.15 80 12 SER A 5 ? ? 62.04 150.51 81 12 SER A 6 ? ? 61.70 126.26 82 12 ASP A 34 ? ? -105.27 40.78 83 12 LEU A 37 ? ? -101.32 61.26 84 12 LEU A 73 ? ? -106.86 41.54 85 12 THR A 88 ? ? -41.54 163.33 86 13 SER A 3 ? ? -175.88 -56.18 87 13 SER A 6 ? ? -179.51 98.91 88 13 GLU A 19 ? ? -39.55 -29.73 89 13 ASP A 20 ? ? -111.74 52.10 90 13 GLU A 38 ? ? -54.42 96.67 91 13 SER A 102 ? ? -157.73 81.17 92 13 SER A 105 ? ? 177.82 153.74 93 14 SER A 5 ? ? 58.38 -87.54 94 14 SER A 6 ? ? -44.32 96.06 95 14 LYS A 17 ? ? -39.66 156.87 96 14 ALA A 35 ? ? -178.85 36.29 97 14 LEU A 37 ? ? -97.96 36.82 98 14 GLU A 49 ? ? -69.79 94.26 99 14 LEU A 73 ? ? -107.99 43.36 100 14 THR A 88 ? ? -38.07 155.59 101 14 SER A 102 ? ? -164.36 77.26 102 14 SER A 105 ? ? 179.53 149.24 103 15 SER A 5 ? ? 63.80 153.45 104 15 SER A 6 ? ? -39.21 140.10 105 15 GLU A 19 ? ? -38.69 -30.41 106 15 ASP A 20 ? ? -119.16 53.25 107 15 ASP A 34 ? ? -87.89 46.37 108 15 ALA A 35 ? ? 75.85 -75.41 109 15 LEU A 37 ? ? -101.20 61.41 110 15 ARG A 58 ? ? -49.60 -70.66 111 15 ASN A 62 ? ? 79.06 -1.07 112 15 THR A 88 ? ? -39.30 159.75 113 16 SER A 3 ? ? -178.62 125.41 114 16 GLU A 19 ? ? -39.39 -29.43 115 16 ASP A 20 ? ? -118.05 53.61 116 16 ASP A 34 ? ? -90.74 49.18 117 16 ALA A 35 ? ? 75.09 -75.25 118 16 LEU A 37 ? ? -94.55 58.08 119 16 THR A 88 ? ? -36.48 151.99 120 16 SER A 105 ? ? 62.37 132.76 121 17 LYS A 17 ? ? -39.27 154.91 122 17 ALA A 35 ? ? 88.66 40.60 123 17 GLN A 78 ? ? -39.70 -39.66 124 17 THR A 88 ? ? -42.90 164.11 125 17 SER A 102 ? ? -159.88 82.32 126 17 SER A 105 ? ? 179.14 143.87 127 18 SER A 3 ? ? -49.78 167.12 128 18 SER A 5 ? ? 64.50 120.29 129 18 GLU A 19 ? ? -38.76 -31.69 130 18 ASP A 20 ? ? -117.18 52.93 131 18 LEU A 37 ? ? -96.04 35.41 132 18 GLU A 38 ? ? -62.08 96.44 133 18 GLU A 49 ? ? -69.83 97.48 134 18 THR A 88 ? ? -40.66 161.71 135 18 SER A 105 ? ? -174.65 131.57 136 19 SER A 5 ? ? 70.12 173.67 137 19 SER A 6 ? ? 167.91 133.55 138 19 LYS A 17 ? ? -42.03 153.05 139 19 ASP A 34 ? ? -105.42 48.85 140 19 ALA A 35 ? ? 77.52 -79.05 141 19 LEU A 37 ? ? -96.49 30.14 142 19 ASN A 62 ? ? 77.68 -0.41 143 19 THR A 88 ? ? -38.93 159.25 144 19 SER A 105 ? ? -156.70 -58.51 145 20 SER A 5 ? ? -170.27 132.79 146 20 SER A 6 ? ? -172.38 145.66 147 20 LYS A 17 ? ? -38.46 156.10 148 20 ALA A 35 ? ? 156.52 -44.83 149 20 LEU A 37 ? ? -89.17 40.80 150 20 ASN A 62 ? ? 78.62 -1.46 151 20 THR A 88 ? ? -38.14 157.65 152 20 LYS A 89 ? ? -127.23 -166.96 153 20 SER A 102 ? ? -175.23 79.52 154 20 SER A 105 ? ? 179.77 118.38 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 1WF8 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WF8 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.05mM 13C, 15N-labeled protein; 20mM PiNa(pH6.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.entry_id 1WF8 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR 6.1C collection Varian 1 NMRPipe 20020425 processing Delaglio.F. 2 NMRView 5.0.4 'data analysis' 'Johnson, B.A.' 3 KUJIRA 0.854 'data analysis' 'Kobayashi, N.' 4 CYANA 1.0.7 'structure solution' 'Guentert, P.' 5 CYANA 1.0.7 refinement 'Guentert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 MET N N N N 192 MET CA C N S 193 MET C C N N 194 MET O O N N 195 MET CB C N N 196 MET CG C N N 197 MET SD S N N 198 MET CE C N N 199 MET OXT O N N 200 MET H H N N 201 MET H2 H N N 202 MET HA H N N 203 MET HB2 H N N 204 MET HB3 H N N 205 MET HG2 H N N 206 MET HG3 H N N 207 MET HE1 H N N 208 MET HE2 H N N 209 MET HE3 H N N 210 MET HXT H N N 211 PHE N N N N 212 PHE CA C N S 213 PHE C C N N 214 PHE O O N N 215 PHE CB C N N 216 PHE CG C Y N 217 PHE CD1 C Y N 218 PHE CD2 C Y N 219 PHE CE1 C Y N 220 PHE CE2 C Y N 221 PHE CZ C Y N 222 PHE OXT O N N 223 PHE H H N N 224 PHE H2 H N N 225 PHE HA H N N 226 PHE HB2 H N N 227 PHE HB3 H N N 228 PHE HD1 H N N 229 PHE HD2 H N N 230 PHE HE1 H N N 231 PHE HE2 H N N 232 PHE HZ H N N 233 PHE HXT H N N 234 PRO N N N N 235 PRO CA C N S 236 PRO C C N N 237 PRO O O N N 238 PRO CB C N N 239 PRO CG C N N 240 PRO CD C N N 241 PRO OXT O N N 242 PRO H H N N 243 PRO HA H N N 244 PRO HB2 H N N 245 PRO HB3 H N N 246 PRO HG2 H N N 247 PRO HG3 H N N 248 PRO HD2 H N N 249 PRO HD3 H N N 250 PRO HXT H N N 251 SER N N N N 252 SER CA C N S 253 SER C C N N 254 SER O O N N 255 SER CB C N N 256 SER OG O N N 257 SER OXT O N N 258 SER H H N N 259 SER H2 H N N 260 SER HA H N N 261 SER HB2 H N N 262 SER HB3 H N N 263 SER HG H N N 264 SER HXT H N N 265 THR N N N N 266 THR CA C N S 267 THR C C N N 268 THR O O N N 269 THR CB C N R 270 THR OG1 O N N 271 THR CG2 C N N 272 THR OXT O N N 273 THR H H N N 274 THR H2 H N N 275 THR HA H N N 276 THR HB H N N 277 THR HG1 H N N 278 THR HG21 H N N 279 THR HG22 H N N 280 THR HG23 H N N 281 THR HXT H N N 282 VAL N N N N 283 VAL CA C N S 284 VAL C C N N 285 VAL O O N N 286 VAL CB C N N 287 VAL CG1 C N N 288 VAL CG2 C N N 289 VAL OXT O N N 290 VAL H H N N 291 VAL H2 H N N 292 VAL HA H N N 293 VAL HB H N N 294 VAL HG11 H N N 295 VAL HG12 H N N 296 VAL HG13 H N N 297 VAL HG21 H N N 298 VAL HG22 H N N 299 VAL HG23 H N N 300 VAL HXT H N N 301 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 THR N CA sing N N 254 THR N H sing N N 255 THR N H2 sing N N 256 THR CA C sing N N 257 THR CA CB sing N N 258 THR CA HA sing N N 259 THR C O doub N N 260 THR C OXT sing N N 261 THR CB OG1 sing N N 262 THR CB CG2 sing N N 263 THR CB HB sing N N 264 THR OG1 HG1 sing N N 265 THR CG2 HG21 sing N N 266 THR CG2 HG22 sing N N 267 THR CG2 HG23 sing N N 268 THR OXT HXT sing N N 269 VAL N CA sing N N 270 VAL N H sing N N 271 VAL N H2 sing N N 272 VAL CA C sing N N 273 VAL CA CB sing N N 274 VAL CA HA sing N N 275 VAL C O doub N N 276 VAL C OXT sing N N 277 VAL CB CG1 sing N N 278 VAL CB CG2 sing N N 279 VAL CB HB sing N N 280 VAL CG1 HG11 sing N N 281 VAL CG1 HG12 sing N N 282 VAL CG1 HG13 sing N N 283 VAL CG2 HG21 sing N N 284 VAL CG2 HG22 sing N N 285 VAL CG2 HG23 sing N N 286 VAL OXT HXT sing N N 287 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 1WF8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_