data_1WFE # _entry.id 1WFE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WFE pdb_00001wfe 10.2210/pdb1wfe/pdb RCSB RCSB023517 ? ? WWPDB D_1000023517 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-26 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.pdbx_dist_value' 6 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 11 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 13 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 17 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 18 4 'Structure model' '_struct_ref_seq_dif.details' 19 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 20 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 21 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WFE _pdbx_database_status.recvd_initial_deposition_date 2004-05-26 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmt007005089.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tomizawa, T.' 1 'Kigawa, T.' 2 'Saito, K.' 3 'Koshiba, S.' 4 'Inoue, M.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the 2nd zf-AN1 domain of mouse RIKEN cDNA 2310008M20 protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tomizawa, T.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Saito, K.' 3 ? primary 'Koshiba, S.' 4 ? primary 'Inoue, M.' 5 ? primary 'Yokoyama, S.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RIKEN cDNA 2310008M20 protein' 9434.673 1 ? ? 'zf-AN1 domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGCSEVNVVKERPKTDEHKSYSCSFKGCTDVELVAVICPYCEKNFCLRHRHQSDHDCEKLEVAKPRMAATQKLVR SGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGCSEVNVVKERPKTDEHKSYSCSFKGCTDVELVAVICPYCEKNFCLRHRHQSDHDCEKLEVAKPRMAATQKLVR SGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmt007005089.1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 CYS n 1 9 SER n 1 10 GLU n 1 11 VAL n 1 12 ASN n 1 13 VAL n 1 14 VAL n 1 15 LYS n 1 16 GLU n 1 17 ARG n 1 18 PRO n 1 19 LYS n 1 20 THR n 1 21 ASP n 1 22 GLU n 1 23 HIS n 1 24 LYS n 1 25 SER n 1 26 TYR n 1 27 SER n 1 28 CYS n 1 29 SER n 1 30 PHE n 1 31 LYS n 1 32 GLY n 1 33 CYS n 1 34 THR n 1 35 ASP n 1 36 VAL n 1 37 GLU n 1 38 LEU n 1 39 VAL n 1 40 ALA n 1 41 VAL n 1 42 ILE n 1 43 CYS n 1 44 PRO n 1 45 TYR n 1 46 CYS n 1 47 GLU n 1 48 LYS n 1 49 ASN n 1 50 PHE n 1 51 CYS n 1 52 LEU n 1 53 ARG n 1 54 HIS n 1 55 ARG n 1 56 HIS n 1 57 GLN n 1 58 SER n 1 59 ASP n 1 60 HIS n 1 61 ASP n 1 62 CYS n 1 63 GLU n 1 64 LYS n 1 65 LEU n 1 66 GLU n 1 67 VAL n 1 68 ALA n 1 69 LYS n 1 70 PRO n 1 71 ARG n 1 72 MET n 1 73 ALA n 1 74 ALA n 1 75 THR n 1 76 GLN n 1 77 LYS n 1 78 LEU n 1 79 VAL n 1 80 ARG n 1 81 SER n 1 82 GLY n 1 83 PRO n 1 84 SER n 1 85 SER n 1 86 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene 'RIKEN cDNA 5730471C05' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P030324-10 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 GLY 86 86 86 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _exptl.entry_id 1WFE _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1WFE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1WFE _struct.title 'Solution structure of the 2nd zf-AN1 domain of mouse RIKEN cDNA 2310008M20 protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WFE _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'zf-AN1 domain, zinc binding, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZFAN1_MOUSE _struct_ref.pdbx_db_accession Q8BFR6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code CSEVNVVKERPKTDEHKSYSCSFKGCTDVELVAVICPYCEKNFCLRHRHQSDHDCEKLEVAKPRMAATQKLVR _struct_ref.pdbx_align_begin 44 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WFE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 80 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8BFR6 _struct_ref_seq.db_align_beg 44 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 116 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 80 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WFE GLY A 1 ? UNP Q8BFR6 ? ? 'cloning artifact' 1 1 1 1WFE SER A 2 ? UNP Q8BFR6 ? ? 'cloning artifact' 2 2 1 1WFE SER A 3 ? UNP Q8BFR6 ? ? 'cloning artifact' 3 3 1 1WFE GLY A 4 ? UNP Q8BFR6 ? ? 'cloning artifact' 4 4 1 1WFE SER A 5 ? UNP Q8BFR6 ? ? 'cloning artifact' 5 5 1 1WFE SER A 6 ? UNP Q8BFR6 ? ? 'cloning artifact' 6 6 1 1WFE GLY A 7 ? UNP Q8BFR6 ? ? 'cloning artifact' 7 7 1 1WFE SER A 81 ? UNP Q8BFR6 ? ? 'cloning artifact' 81 8 1 1WFE GLY A 82 ? UNP Q8BFR6 ? ? 'cloning artifact' 82 9 1 1WFE PRO A 83 ? UNP Q8BFR6 ? ? 'cloning artifact' 83 10 1 1WFE SER A 84 ? UNP Q8BFR6 ? ? 'cloning artifact' 84 11 1 1WFE SER A 85 ? UNP Q8BFR6 ? ? 'cloning artifact' 85 12 1 1WFE GLY A 86 ? UNP Q8BFR6 ? ? 'cloning artifact' 86 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 51 ? ARG A 55 ? CYS A 51 ARG A 55 5 ? 5 HELX_P HELX_P2 2 GLN A 57 ? ASP A 61 ? GLN A 57 ASP A 61 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 28 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 28 A ZN 201 1_555 ? ? ? ? ? ? ? 2.368 ? ? metalc2 metalc ? ? A CYS 33 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 33 A ZN 201 1_555 ? ? ? ? ? ? ? 2.353 ? ? metalc3 metalc ? ? A CYS 43 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 43 A ZN 401 1_555 ? ? ? ? ? ? ? 2.371 ? ? metalc4 metalc ? ? A CYS 46 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 46 A ZN 401 1_555 ? ? ? ? ? ? ? 2.335 ? ? metalc5 metalc ? ? A CYS 51 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 51 A ZN 201 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc6 metalc ? ? A HIS 54 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 54 A ZN 201 1_555 ? ? ? ? ? ? ? 2.352 ? ? metalc7 metalc ? ? A HIS 60 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 60 A ZN 401 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc8 metalc ? ? A CYS 62 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 62 A ZN 401 1_555 ? ? ? ? ? ? ? 2.331 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 33 ? A CYS 33 ? 1_555 93.6 ? 2 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 51 ? A CYS 51 ? 1_555 113.8 ? 3 SG ? A CYS 33 ? A CYS 33 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 51 ? A CYS 51 ? 1_555 116.2 ? 4 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 54 ? A HIS 54 ? 1_555 115.6 ? 5 SG ? A CYS 33 ? A CYS 33 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 54 ? A HIS 54 ? 1_555 110.0 ? 6 SG ? A CYS 51 ? A CYS 51 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 54 ? A HIS 54 ? 1_555 107.4 ? 7 SG ? A CYS 43 ? A CYS 43 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 46 ? A CYS 46 ? 1_555 100.8 ? 8 SG ? A CYS 43 ? A CYS 43 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 60 ? A HIS 60 ? 1_555 114.6 ? 9 SG ? A CYS 46 ? A CYS 46 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 60 ? A HIS 60 ? 1_555 106.6 ? 10 SG ? A CYS 43 ? A CYS 43 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 62 ? A CYS 62 ? 1_555 116.7 ? 11 SG ? A CYS 46 ? A CYS 46 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 62 ? A CYS 62 ? 1_555 118.1 ? 12 NE2 ? A HIS 60 ? A HIS 60 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 62 ? A CYS 62 ? 1_555 100.2 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 26 ? SER A 27 ? TYR A 26 SER A 27 A 2 VAL A 36 ? GLU A 37 ? VAL A 36 GLU A 37 B 1 VAL A 41 ? ILE A 42 ? VAL A 41 ILE A 42 B 2 ASN A 49 ? PHE A 50 ? ASN A 49 PHE A 50 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 26 ? N TYR A 26 O GLU A 37 ? O GLU A 37 B 1 2 N VAL A 41 ? N VAL A 41 O PHE A 50 ? O PHE A 50 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 28 ? CYS A 28 . ? 1_555 ? 2 AC1 4 CYS A 33 ? CYS A 33 . ? 1_555 ? 3 AC1 4 CYS A 51 ? CYS A 51 . ? 1_555 ? 4 AC1 4 HIS A 54 ? HIS A 54 . ? 1_555 ? 5 AC2 4 CYS A 43 ? CYS A 43 . ? 1_555 ? 6 AC2 4 CYS A 46 ? CYS A 46 . ? 1_555 ? 7 AC2 4 HIS A 60 ? HIS A 60 . ? 1_555 ? 8 AC2 4 CYS A 62 ? CYS A 62 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 11 ? ? -175.09 128.15 2 1 LYS A 15 ? ? -32.49 146.99 3 1 PRO A 18 ? ? -69.82 84.07 4 1 LYS A 19 ? ? -35.77 138.66 5 1 LYS A 24 ? ? -164.06 119.56 6 1 SER A 29 ? ? -99.51 30.59 7 1 PRO A 44 ? ? -69.71 6.18 8 1 GLN A 57 ? ? -64.49 -75.25 9 1 LEU A 65 ? ? -37.28 153.69 10 1 GLU A 66 ? ? -93.24 48.11 11 1 LEU A 78 ? ? -39.49 132.63 12 2 VAL A 13 ? ? -166.15 119.76 13 2 GLU A 16 ? ? -43.63 98.70 14 2 PRO A 18 ? ? -69.71 96.31 15 2 GLU A 22 ? ? -132.28 -62.52 16 2 CYS A 28 ? ? -43.19 166.06 17 2 PRO A 44 ? ? -69.72 5.89 18 2 LEU A 65 ? ? -39.13 159.23 19 2 GLU A 66 ? ? -86.98 46.72 20 2 PRO A 70 ? ? -69.70 2.64 21 2 GLN A 76 ? ? -165.89 111.01 22 2 PRO A 83 ? ? -69.82 87.59 23 3 VAL A 11 ? ? -175.24 138.61 24 3 LYS A 19 ? ? -34.76 150.70 25 3 ASP A 21 ? ? -35.05 115.02 26 3 THR A 34 ? ? 31.69 53.80 27 3 PRO A 44 ? ? -69.82 5.86 28 3 LEU A 52 ? ? -38.40 -39.95 29 3 GLN A 57 ? ? -73.29 -71.61 30 3 LEU A 65 ? ? -49.14 178.22 31 3 GLU A 66 ? ? -82.45 42.46 32 3 ARG A 80 ? ? -174.99 129.52 33 3 PRO A 83 ? ? -69.78 83.49 34 4 PRO A 18 ? ? -69.76 -175.19 35 4 CYS A 28 ? ? -48.95 167.71 36 4 LYS A 31 ? ? -68.47 81.51 37 4 PRO A 44 ? ? -69.76 5.61 38 4 GLN A 57 ? ? -68.23 -74.93 39 4 LEU A 65 ? ? -39.52 159.54 40 4 GLU A 66 ? ? -78.90 47.73 41 4 VAL A 79 ? ? -83.17 36.27 42 4 SER A 81 ? ? -167.33 117.38 43 4 PRO A 83 ? ? -69.76 98.64 44 4 SER A 84 ? ? -171.45 128.30 45 5 SER A 5 ? ? -170.41 118.72 46 5 VAL A 11 ? ? -175.13 115.31 47 5 GLU A 16 ? ? -171.12 143.37 48 5 PRO A 18 ? ? -69.78 89.61 49 5 LYS A 19 ? ? -34.05 146.76 50 5 HIS A 23 ? ? -129.71 -60.48 51 5 SER A 29 ? ? -97.76 38.74 52 5 PRO A 44 ? ? -69.80 6.17 53 5 GLN A 57 ? ? -64.92 -76.16 54 5 HIS A 60 ? ? -98.54 33.17 55 5 ASP A 61 ? ? 39.94 48.23 56 5 LEU A 65 ? ? -42.49 165.94 57 5 GLU A 66 ? ? -80.31 43.86 58 5 PRO A 70 ? ? -69.81 2.09 59 5 LYS A 77 ? ? -40.20 155.04 60 5 LEU A 78 ? ? -40.80 160.50 61 5 ARG A 80 ? ? -174.54 115.39 62 6 SER A 9 ? ? -50.21 107.94 63 6 HIS A 23 ? ? -48.75 174.38 64 6 SER A 29 ? ? -94.92 32.40 65 6 PRO A 44 ? ? -69.77 5.27 66 6 TYR A 45 ? ? -108.90 -62.14 67 6 GLN A 57 ? ? -73.36 -73.46 68 6 CYS A 62 ? ? -44.29 100.87 69 6 LEU A 65 ? ? -41.21 162.87 70 6 ALA A 68 ? ? -35.54 138.02 71 6 LYS A 69 ? ? -33.91 140.24 72 6 ARG A 71 ? ? 36.36 40.95 73 6 THR A 75 ? ? -56.43 92.12 74 7 SER A 9 ? ? -168.45 110.39 75 7 GLU A 16 ? ? -171.16 140.37 76 7 PRO A 18 ? ? -69.75 95.34 77 7 ASP A 21 ? ? 36.76 41.63 78 7 PRO A 44 ? ? -69.68 6.26 79 7 GLN A 57 ? ? -68.34 -73.81 80 7 LEU A 65 ? ? -40.74 160.45 81 7 GLU A 66 ? ? -78.94 46.51 82 7 PRO A 70 ? ? -69.85 1.18 83 8 SER A 2 ? ? -51.56 99.89 84 8 SER A 5 ? ? -102.70 42.56 85 8 PRO A 44 ? ? -69.71 6.37 86 8 LEU A 52 ? ? -36.17 -39.72 87 8 SER A 58 ? ? -82.56 38.70 88 8 ASP A 59 ? ? -133.74 -34.72 89 8 LEU A 65 ? ? -39.22 156.32 90 8 GLU A 66 ? ? -81.11 45.38 91 8 MET A 72 ? ? -34.34 135.08 92 8 LYS A 77 ? ? -101.77 41.38 93 9 LYS A 31 ? ? -66.01 89.46 94 9 PRO A 44 ? ? -69.77 6.64 95 9 GLU A 66 ? ? -92.80 44.10 96 9 ALA A 68 ? ? -47.68 104.14 97 9 PRO A 70 ? ? -69.76 7.55 98 9 SER A 81 ? ? -43.24 157.40 99 9 PRO A 83 ? ? -69.76 6.60 100 10 SER A 2 ? ? -160.49 119.98 101 10 VAL A 13 ? ? -173.86 144.47 102 10 THR A 34 ? ? 31.99 53.22 103 10 PRO A 44 ? ? -69.82 5.44 104 10 TYR A 45 ? ? -109.23 -61.76 105 10 GLN A 57 ? ? -70.14 -74.40 106 10 LEU A 65 ? ? -43.28 166.41 107 10 GLU A 66 ? ? -91.78 34.65 108 10 LYS A 77 ? ? -175.11 128.82 109 10 VAL A 79 ? ? -170.63 136.16 110 10 PRO A 83 ? ? -69.77 88.58 111 11 THR A 20 ? ? -170.95 129.42 112 11 GLU A 22 ? ? 34.29 49.21 113 11 THR A 34 ? ? 30.54 53.56 114 11 PRO A 44 ? ? -69.73 6.37 115 11 LEU A 52 ? ? -37.00 -39.96 116 11 SER A 58 ? ? -80.69 39.85 117 11 ASP A 59 ? ? -134.26 -38.93 118 11 LEU A 65 ? ? -38.37 157.34 119 11 GLU A 66 ? ? -81.48 45.94 120 11 PRO A 70 ? ? -69.78 6.90 121 11 ARG A 71 ? ? -50.53 173.81 122 11 PRO A 83 ? ? -69.73 11.12 123 11 SER A 84 ? ? -33.13 93.23 124 12 ASN A 12 ? ? -162.59 110.37 125 12 LYS A 19 ? ? -97.98 34.57 126 12 PRO A 44 ? ? -69.77 5.81 127 12 GLN A 57 ? ? -68.13 -73.97 128 12 LEU A 65 ? ? -36.69 155.61 129 12 GLU A 66 ? ? -94.99 42.57 130 12 GLN A 76 ? ? -174.93 144.13 131 13 CYS A 8 ? ? -57.05 101.73 132 13 VAL A 13 ? ? -170.53 141.81 133 13 LYS A 19 ? ? -83.47 45.43 134 13 HIS A 23 ? ? -34.26 145.75 135 13 SER A 25 ? ? -34.18 120.37 136 13 SER A 29 ? ? -95.06 30.99 137 13 PRO A 44 ? ? -69.75 4.88 138 13 TYR A 45 ? ? -108.70 -61.53 139 13 GLN A 57 ? ? -70.21 -74.44 140 13 CYS A 62 ? ? -44.65 102.67 141 13 LEU A 65 ? ? -49.23 179.09 142 13 GLU A 66 ? ? -119.35 69.91 143 13 ALA A 68 ? ? -96.02 38.55 144 13 ALA A 74 ? ? -130.70 -63.40 145 14 CYS A 8 ? ? -174.66 133.90 146 14 ASP A 21 ? ? -100.20 43.06 147 14 HIS A 23 ? ? -45.51 166.80 148 14 PRO A 44 ? ? -69.78 6.24 149 14 HIS A 56 ? ? -56.70 -174.83 150 14 SER A 58 ? ? -83.48 36.78 151 14 LEU A 65 ? ? -40.36 158.11 152 14 GLU A 66 ? ? -101.10 49.71 153 14 LYS A 69 ? ? 33.72 54.29 154 14 PRO A 70 ? ? -69.75 0.71 155 14 ARG A 71 ? ? -92.75 41.79 156 14 MET A 72 ? ? -104.94 45.45 157 15 CYS A 8 ? ? -97.77 43.89 158 15 LYS A 15 ? ? -56.45 107.88 159 15 LYS A 31 ? ? -68.63 86.96 160 15 THR A 34 ? ? 30.93 54.98 161 15 PRO A 44 ? ? -69.80 6.50 162 15 LEU A 52 ? ? -35.85 -35.95 163 15 GLN A 57 ? ? -66.69 -74.82 164 15 LEU A 65 ? ? -44.97 162.81 165 15 GLU A 66 ? ? -89.40 46.98 166 15 ALA A 74 ? ? -123.99 -57.53 167 15 PRO A 83 ? ? -69.70 86.94 168 16 CYS A 8 ? ? -66.85 99.12 169 16 GLU A 16 ? ? -35.75 110.78 170 16 GLU A 22 ? ? -173.20 146.40 171 16 THR A 34 ? ? 32.51 54.41 172 16 PRO A 44 ? ? -69.77 6.07 173 16 GLN A 57 ? ? -66.94 -75.08 174 16 CYS A 62 ? ? -43.62 102.31 175 16 LEU A 65 ? ? -39.94 160.93 176 16 GLU A 66 ? ? -81.23 41.36 177 16 PRO A 70 ? ? -69.75 76.50 178 16 MET A 72 ? ? -170.19 136.17 179 17 VAL A 13 ? ? -174.33 147.52 180 17 THR A 20 ? ? 34.44 39.12 181 17 ASP A 21 ? ? -39.70 110.26 182 17 LYS A 31 ? ? -67.87 94.58 183 17 PRO A 44 ? ? -69.72 5.57 184 17 HIS A 56 ? ? -55.63 -175.47 185 17 SER A 58 ? ? -83.29 35.86 186 17 LEU A 65 ? ? -41.73 164.58 187 17 GLU A 66 ? ? -89.52 41.33 188 17 PRO A 70 ? ? -69.75 -83.07 189 17 LEU A 78 ? ? -62.49 99.04 190 17 ARG A 80 ? ? -164.05 118.57 191 18 VAL A 11 ? ? -172.73 128.60 192 18 THR A 20 ? ? -33.97 108.58 193 18 SER A 29 ? ? -93.69 35.58 194 18 ASP A 35 ? ? -47.71 152.06 195 18 PRO A 44 ? ? -69.79 5.60 196 18 TYR A 45 ? ? -109.76 -64.74 197 18 GLN A 57 ? ? -65.98 -73.60 198 18 HIS A 60 ? ? -99.67 33.72 199 18 ASP A 61 ? ? 38.01 49.42 200 18 LEU A 65 ? ? -48.06 177.68 201 18 GLU A 66 ? ? -76.30 47.29 202 18 PRO A 70 ? ? -69.77 12.54 203 18 ARG A 71 ? ? -37.06 122.28 204 18 THR A 75 ? ? -48.90 164.59 205 18 LYS A 77 ? ? -38.03 153.22 206 18 ARG A 80 ? ? -53.72 95.02 207 18 PRO A 83 ? ? -69.80 -177.55 208 19 ARG A 17 ? ? -36.61 152.02 209 19 PRO A 44 ? ? -69.75 5.67 210 19 GLN A 57 ? ? -64.61 -74.04 211 19 LEU A 65 ? ? -39.73 160.26 212 19 ALA A 68 ? ? -35.67 104.76 213 19 PRO A 70 ? ? -69.76 11.77 214 19 ARG A 71 ? ? -42.61 167.65 215 19 MET A 72 ? ? -44.21 167.72 216 19 LEU A 78 ? ? -57.93 109.45 217 20 VAL A 13 ? ? -173.83 142.49 218 20 PRO A 44 ? ? -69.76 5.94 219 20 SER A 58 ? ? -82.18 39.78 220 20 ASP A 59 ? ? -134.63 -35.38 221 20 LEU A 65 ? ? -41.62 159.95 222 20 GLU A 66 ? ? -79.72 46.00 223 20 VAL A 67 ? ? -113.81 77.62 224 20 PRO A 70 ? ? -69.78 5.96 225 20 MET A 72 ? ? -37.36 146.50 226 20 LEU A 78 ? ? -55.15 102.64 227 20 SER A 81 ? ? -173.50 131.14 228 20 PRO A 83 ? ? -69.76 -169.59 229 20 SER A 84 ? ? -51.55 104.55 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 1WFE _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WFE _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.09mM zf-AN1 domain U-15N, 13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.1mM ZnCl2; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.entry_id 1WFE _pdbx_nmr_refine.method 'torsion angle dynamics, restrainted molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 NMRPipe 20030801 processing 'Delaglio, F.' 2 NMRView 5.0.4 'data analysis' 'Johnson, B.A.' 3 KUJIRA 0.901 'data analysis' 'Kobayashi, N.' 4 CYANA 2.0.17 'structure solution' 'Guentert, P.' 5 CYANA 2.0.17 refinement 'Guentert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 ZN ZN ZN N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 1WFE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_