data_1WNA # _entry.id 1WNA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1WNA RCSB RCSB023772 WWPDB D_1000023772 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1WN9 'alternative crystal form for the same protein' unspecified TargetDB ttk003001805.2 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WNA _pdbx_database_status.recvd_initial_deposition_date 2004-07-28 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pioszak, A.A.' 1 'Kishishita, S.' 2 'Shirouzu, M.' 3 'Kuramitsu, S.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Crystal structure of the hypothetical protein TT1805 from Thermus thermophillus HB8' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Pioszak, A.A.' 1 primary 'Kishishita, S.' 2 primary 'Shirouzu, M.' 3 primary 'Kuramitsu, S.' 4 primary 'Yokoyama, S.' 5 # _cell.entry_id 1WNA _cell.length_a 54.240 _cell.length_b 70.691 _cell.length_c 73.389 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1WNA _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'the hypothetical protein (TT1805)' 14389.194 1 ? ? ? ? 2 water nat water 18.015 117 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)VRVG(MSE)RAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEE ALSELVGLLLAQGARRFYEAVVSPGE(MSE)TALLDLPPEELLKRV(MSE)AIANPTDPGIYLKRAA ; _entity_poly.pdbx_seq_one_letter_code_can ;MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGL LLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ttk003001805.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 VAL n 1 3 ARG n 1 4 VAL n 1 5 GLY n 1 6 MSE n 1 7 ARG n 1 8 ALA n 1 9 ALA n 1 10 PRO n 1 11 ARG n 1 12 VAL n 1 13 SER n 1 14 LEU n 1 15 GLU n 1 16 ALA n 1 17 LEU n 1 18 LYS n 1 19 ALA n 1 20 ALA n 1 21 LEU n 1 22 GLY n 1 23 GLY n 1 24 LEU n 1 25 LYS n 1 26 LEU n 1 27 SER n 1 28 GLU n 1 29 ALA n 1 30 LYS n 1 31 VAL n 1 32 TYR n 1 33 LEU n 1 34 ILE n 1 35 THR n 1 36 ASP n 1 37 TRP n 1 38 GLN n 1 39 ASP n 1 40 LYS n 1 41 ARG n 1 42 ASP n 1 43 GLN n 1 44 ALA n 1 45 ARG n 1 46 TYR n 1 47 ALA n 1 48 LEU n 1 49 LEU n 1 50 LEU n 1 51 HIS n 1 52 THR n 1 53 GLY n 1 54 LYS n 1 55 LYS n 1 56 ASP n 1 57 LEU n 1 58 LEU n 1 59 VAL n 1 60 PRO n 1 61 ASP n 1 62 ALA n 1 63 PHE n 1 64 GLY n 1 65 PRO n 1 66 ALA n 1 67 PHE n 1 68 PRO n 1 69 GLY n 1 70 GLY n 1 71 GLU n 1 72 GLU n 1 73 ALA n 1 74 LEU n 1 75 SER n 1 76 GLU n 1 77 LEU n 1 78 VAL n 1 79 GLY n 1 80 LEU n 1 81 LEU n 1 82 LEU n 1 83 ALA n 1 84 GLN n 1 85 GLY n 1 86 ALA n 1 87 ARG n 1 88 ARG n 1 89 PHE n 1 90 TYR n 1 91 GLU n 1 92 ALA n 1 93 VAL n 1 94 VAL n 1 95 SER n 1 96 PRO n 1 97 GLY n 1 98 GLU n 1 99 MSE n 1 100 THR n 1 101 ALA n 1 102 LEU n 1 103 LEU n 1 104 ASP n 1 105 LEU n 1 106 PRO n 1 107 PRO n 1 108 GLU n 1 109 GLU n 1 110 LEU n 1 111 LEU n 1 112 LYS n 1 113 ARG n 1 114 VAL n 1 115 MSE n 1 116 ALA n 1 117 ILE n 1 118 ALA n 1 119 ASN n 1 120 PRO n 1 121 THR n 1 122 ASP n 1 123 PRO n 1 124 GLY n 1 125 ILE n 1 126 TYR n 1 127 LEU n 1 128 LYS n 1 129 ARG n 1 130 ALA n 1 131 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Thermus thermophilus' _entity_src_gen.gene_src_strain HB8 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 300852 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'B834(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5SI52_THET8 _struct_ref.pdbx_db_accession Q5SI52 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WNA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 131 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5SI52 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 131 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 131 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1WNA _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.6 _exptl_crystal.density_percent_sol 52.24 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5 _exptl_crystal_grow.pdbx_details '13% PEG 8000, 20% glycerol, 40mM Potassium dihydrogen phosphate, pH 5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'RIGAKU JUPITER 210' _diffrn_detector.pdbx_collection_date 2004-05-24 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97912 1.0 2 0.97944 1.0 3 0.964 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.97912, 0.97944, 0.964' # _reflns.entry_id 1WNA _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 37.12 _reflns.d_resolution_high 1.58 _reflns.number_obs 36267 _reflns.number_all ? _reflns.percent_possible_obs 98.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.071 _reflns.pdbx_netI_over_sigmaI 17.5556 _reflns.B_iso_Wilson_estimate 21.6 _reflns.pdbx_redundancy 4.61446 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.58 _reflns_shell.d_res_low 1.64 _reflns_shell.percent_possible_all 85.9 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.234 _reflns_shell.meanI_over_sigI_obs 4.52941 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1WNA _refine.ls_number_reflns_obs 35491 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 812070.46 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 37.12 _refine.ls_d_res_high 1.58 _refine.ls_percent_reflns_obs 95.0 _refine.ls_R_factor_obs 0.208 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.208 _refine.ls_R_factor_R_free 0.229 _refine.ls_R_factor_R_free_error 0.005 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 1758 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 27.2 _refine.aniso_B[1][1] -3.89 _refine.aniso_B[2][2] 5.03 _refine.aniso_B[3][3] -1.14 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.361438 _refine.solvent_model_param_bsol 48.0179 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1WNA _refine_analyze.Luzzati_coordinate_error_obs 0.19 _refine_analyze.Luzzati_sigma_a_obs 0.15 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.23 _refine_analyze.Luzzati_sigma_a_free 0.22 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 967 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 117 _refine_hist.number_atoms_total 1084 _refine_hist.d_res_high 1.58 _refine_hist.d_res_low 37.12 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 23.5 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.77 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 3.16 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 3.97 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 5.76 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 8.00 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.d_res_high 1.58 _refine_ls_shell.d_res_low 1.64 _refine_ls_shell.number_reflns_R_work 2582 _refine_ls_shell.R_factor_R_work 0.272 _refine_ls_shell.percent_reflns_obs 73.5 _refine_ls_shell.R_factor_R_free 0.278 _refine_ls_shell.R_factor_R_free_error 0.022 _refine_ls_shell.percent_reflns_R_free 5.9 _refine_ls_shell.number_reflns_R_free 162 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1WNA _struct.title 'Crystal structure of the hypothetical protein TT1805 from Thermus thermophillus HB8' _struct.pdbx_descriptor 'the hypothetical protein (TT1805)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WNA _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text 'Thermus thermophillus, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 9 ? GLY A 22 ? ALA A 9 GLY A 22 1 ? 14 HELX_P HELX_P2 2 GLY A 69 ? GLN A 84 ? GLY A 69 GLN A 84 1 ? 16 HELX_P HELX_P3 3 SER A 95 ? GLY A 97 ? SER A 95 GLY A 97 5 ? 3 HELX_P HELX_P4 4 GLU A 98 ? ASP A 104 ? GLU A 98 ASP A 104 1 ? 7 HELX_P HELX_P5 5 PRO A 106 ? ALA A 118 ? PRO A 106 ALA A 118 1 ? 13 HELX_P HELX_P6 6 ASP A 122 ? LEU A 127 ? ASP A 122 LEU A 127 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A MSE 1 C ? ? ? 1_555 A VAL 2 N ? ? A MSE 1 A VAL 2 1_555 ? ? ? ? ? ? ? 1.327 ? covale2 covale ? ? A GLY 5 C ? ? ? 1_555 A MSE 6 N ? ? A GLY 5 A MSE 6 1_555 ? ? ? ? ? ? ? 1.327 ? covale3 covale ? ? A MSE 6 C ? ? ? 1_555 A ARG 7 N ? ? A MSE 6 A ARG 7 1_555 ? ? ? ? ? ? ? 1.326 ? covale4 covale ? ? A GLU 98 C ? ? ? 1_555 A MSE 99 N ? ? A GLU 98 A MSE 99 1_555 ? ? ? ? ? ? ? 1.331 ? covale5 covale ? ? A MSE 99 C ? ? ? 1_555 A THR 100 N ? ? A MSE 99 A THR 100 1_555 ? ? ? ? ? ? ? 1.329 ? covale6 covale ? ? A VAL 114 C ? ? ? 1_555 A MSE 115 N ? ? A VAL 114 A MSE 115 1_555 ? ? ? ? ? ? ? 1.327 ? covale7 covale ? ? A MSE 115 C ? ? ? 1_555 A ALA 116 N ? ? A MSE 115 A ALA 116 1_555 ? ? ? ? ? ? ? 1.326 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 2 ? ARG A 3 ? VAL A 2 ARG A 3 A 2 ASP A 56 ? PHE A 63 ? ASP A 56 PHE A 63 A 3 TYR A 46 ? HIS A 51 ? TYR A 46 HIS A 51 A 4 LYS A 30 ? ASP A 36 ? LYS A 30 ASP A 36 A 5 ARG A 88 ? VAL A 94 ? ARG A 88 VAL A 94 A 6 ASN A 119 ? PRO A 120 ? ASN A 119 PRO A 120 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 2 ? N VAL A 2 O LEU A 58 ? O LEU A 58 A 2 3 O LEU A 57 ? O LEU A 57 N LEU A 50 ? N LEU A 50 A 3 4 O HIS A 51 ? O HIS A 51 N LYS A 30 ? N LYS A 30 A 4 5 N LEU A 33 ? N LEU A 33 O TYR A 90 ? O TYR A 90 A 5 6 N GLU A 91 ? N GLU A 91 O ASN A 119 ? O ASN A 119 # _database_PDB_matrix.entry_id 1WNA _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WNA _atom_sites.fract_transf_matrix[1][1] 0.018437 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014146 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013626 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 MSE 6 6 6 MSE MSE A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 MSE 99 99 99 MSE MSE A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 MSE 115 115 115 MSE MSE A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 TYR 126 126 126 TYR TYR A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 LYS 128 128 ? ? ? A . n A 1 129 ARG 129 129 ? ? ? A . n A 1 130 ALA 130 130 ? ? ? A . n A 1 131 ALA 131 131 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 132 1 HOH HOH A . B 2 HOH 2 133 2 HOH HOH A . B 2 HOH 3 134 3 HOH HOH A . B 2 HOH 4 135 4 HOH HOH A . B 2 HOH 5 136 5 HOH HOH A . B 2 HOH 6 137 6 HOH HOH A . B 2 HOH 7 138 7 HOH HOH A . B 2 HOH 8 139 8 HOH HOH A . B 2 HOH 9 140 9 HOH HOH A . B 2 HOH 10 141 10 HOH HOH A . B 2 HOH 11 142 11 HOH HOH A . B 2 HOH 12 143 12 HOH HOH A . B 2 HOH 13 144 13 HOH HOH A . B 2 HOH 14 145 14 HOH HOH A . B 2 HOH 15 146 15 HOH HOH A . B 2 HOH 16 147 16 HOH HOH A . B 2 HOH 17 148 17 HOH HOH A . B 2 HOH 18 149 18 HOH HOH A . B 2 HOH 19 150 19 HOH HOH A . B 2 HOH 20 151 20 HOH HOH A . B 2 HOH 21 152 21 HOH HOH A . B 2 HOH 22 153 22 HOH HOH A . B 2 HOH 23 154 23 HOH HOH A . B 2 HOH 24 155 24 HOH HOH A . B 2 HOH 25 156 25 HOH HOH A . B 2 HOH 26 157 26 HOH HOH A . B 2 HOH 27 158 27 HOH HOH A . B 2 HOH 28 159 28 HOH HOH A . B 2 HOH 29 160 29 HOH HOH A . B 2 HOH 30 161 30 HOH HOH A . B 2 HOH 31 162 31 HOH HOH A . B 2 HOH 32 163 32 HOH HOH A . B 2 HOH 33 164 33 HOH HOH A . B 2 HOH 34 165 34 HOH HOH A . B 2 HOH 35 166 35 HOH HOH A . B 2 HOH 36 167 36 HOH HOH A . B 2 HOH 37 168 37 HOH HOH A . B 2 HOH 38 169 38 HOH HOH A . B 2 HOH 39 170 39 HOH HOH A . B 2 HOH 40 171 40 HOH HOH A . B 2 HOH 41 172 41 HOH HOH A . B 2 HOH 42 173 42 HOH HOH A . B 2 HOH 43 174 43 HOH HOH A . B 2 HOH 44 175 44 HOH HOH A . B 2 HOH 45 176 45 HOH HOH A . B 2 HOH 46 177 46 HOH HOH A . B 2 HOH 47 178 47 HOH HOH A . B 2 HOH 48 179 48 HOH HOH A . B 2 HOH 49 180 49 HOH HOH A . B 2 HOH 50 181 50 HOH HOH A . B 2 HOH 51 182 51 HOH HOH A . B 2 HOH 52 183 52 HOH HOH A . B 2 HOH 53 184 53 HOH HOH A . B 2 HOH 54 185 54 HOH HOH A . B 2 HOH 55 186 55 HOH HOH A . B 2 HOH 56 187 56 HOH HOH A . B 2 HOH 57 188 57 HOH HOH A . B 2 HOH 58 189 58 HOH HOH A . B 2 HOH 59 190 59 HOH HOH A . B 2 HOH 60 191 60 HOH HOH A . B 2 HOH 61 192 61 HOH HOH A . B 2 HOH 62 193 62 HOH HOH A . B 2 HOH 63 194 63 HOH HOH A . B 2 HOH 64 195 64 HOH HOH A . B 2 HOH 65 196 65 HOH HOH A . B 2 HOH 66 197 66 HOH HOH A . B 2 HOH 67 198 67 HOH HOH A . B 2 HOH 68 199 68 HOH HOH A . B 2 HOH 69 200 69 HOH HOH A . B 2 HOH 70 201 70 HOH HOH A . B 2 HOH 71 202 71 HOH HOH A . B 2 HOH 72 203 72 HOH HOH A . B 2 HOH 73 204 73 HOH HOH A . B 2 HOH 74 205 74 HOH HOH A . B 2 HOH 75 206 75 HOH HOH A . B 2 HOH 76 207 76 HOH HOH A . B 2 HOH 77 208 77 HOH HOH A . B 2 HOH 78 209 78 HOH HOH A . B 2 HOH 79 210 79 HOH HOH A . B 2 HOH 80 211 80 HOH HOH A . B 2 HOH 81 212 81 HOH HOH A . B 2 HOH 82 213 82 HOH HOH A . B 2 HOH 83 214 83 HOH HOH A . B 2 HOH 84 215 84 HOH HOH A . B 2 HOH 85 216 85 HOH HOH A . B 2 HOH 86 217 86 HOH HOH A . B 2 HOH 87 218 87 HOH HOH A . B 2 HOH 88 219 88 HOH HOH A . B 2 HOH 89 220 89 HOH HOH A . B 2 HOH 90 221 90 HOH HOH A . B 2 HOH 91 222 91 HOH HOH A . B 2 HOH 92 223 92 HOH HOH A . B 2 HOH 93 224 93 HOH HOH A . B 2 HOH 94 225 94 HOH HOH A . B 2 HOH 95 226 95 HOH HOH A . B 2 HOH 96 227 96 HOH HOH A . B 2 HOH 97 228 97 HOH HOH A . B 2 HOH 98 229 98 HOH HOH A . B 2 HOH 99 230 99 HOH HOH A . B 2 HOH 100 231 100 HOH HOH A . B 2 HOH 101 232 101 HOH HOH A . B 2 HOH 102 233 102 HOH HOH A . B 2 HOH 103 234 103 HOH HOH A . B 2 HOH 104 235 104 HOH HOH A . B 2 HOH 105 236 105 HOH HOH A . B 2 HOH 106 237 106 HOH HOH A . B 2 HOH 107 238 107 HOH HOH A . B 2 HOH 108 239 108 HOH HOH A . B 2 HOH 109 240 109 HOH HOH A . B 2 HOH 110 241 110 HOH HOH A . B 2 HOH 111 242 111 HOH HOH A . B 2 HOH 112 243 112 HOH HOH A . B 2 HOH 113 244 113 HOH HOH A . B 2 HOH 114 245 114 HOH HOH A . B 2 HOH 115 246 115 HOH HOH A . B 2 HOH 116 247 116 HOH HOH A . B 2 HOH 117 248 117 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 6 A MSE 6 ? MET SELENOMETHIONINE 3 A MSE 99 A MSE 99 ? MET SELENOMETHIONINE 4 A MSE 115 A MSE 115 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 218 ? B HOH . 2 1 A HOH 220 ? B HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-01-28 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 HKL-2000 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 SOLVE phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 60 ? ? -69.24 -174.67 2 1 ARG A 87 ? ? -130.49 -32.35 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 128 ? A LYS 128 2 1 Y 1 A ARG 129 ? A ARG 129 3 1 Y 1 A ALA 130 ? A ALA 130 4 1 Y 1 A ALA 131 ? A ALA 131 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #