data_1WR0 # _entry.id 1WR0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WR0 pdb_00001wr0 10.2210/pdb1wr0/pdb RCSB RCSB023897 ? ? WWPDB D_1000023897 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id ar_001000797.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WR0 _pdbx_database_status.recvd_initial_deposition_date 2004-10-07 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Takasu, H.' 1 'Jee, J.G.' 2 'Ohno, A.' 3 'Goda, N.' 4 'Fujiwara, K.' 5 'Tochio, H.' 6 'Shirakawa, M.' 7 'Hiroaki, H.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title 'Structural characterization of the MIT domain from human Vps4b' _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_volume 334 _citation.page_first 460 _citation.page_last 465 _citation.year 2005 _citation.journal_id_ASTM BBRCA9 _citation.country US _citation.journal_id_ISSN 0006-291X _citation.journal_id_CSD 0146 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16018968 _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2005.06.110 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Takasu, H.' 1 ? primary 'Jee, J.G.' 2 ? primary 'Ohno, A.' 3 ? primary 'Goda, N.' 4 ? primary 'Fujiwara, K.' 5 ? primary 'Tochio, H.' 6 ? primary 'Shirakawa, M.' 7 ? primary 'Hiroaki, H.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SKD1 protein' _entity.formula_weight 9207.310 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'MIT DOMAIN' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Vacuolar sorting protein 4b' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSDHMSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYL K ; _entity_poly.pdbx_seq_one_letter_code_can ;GSDHMSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYL K ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ar_001000797.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ASP n 1 4 HIS n 1 5 MET n 1 6 SER n 1 7 SER n 1 8 THR n 1 9 SER n 1 10 PRO n 1 11 ASN n 1 12 LEU n 1 13 GLN n 1 14 LYS n 1 15 ALA n 1 16 ILE n 1 17 ASP n 1 18 LEU n 1 19 ALA n 1 20 SER n 1 21 LYS n 1 22 ALA n 1 23 ALA n 1 24 GLN n 1 25 GLU n 1 26 ASP n 1 27 LYS n 1 28 ALA n 1 29 GLY n 1 30 ASN n 1 31 TYR n 1 32 GLU n 1 33 GLU n 1 34 ALA n 1 35 LEU n 1 36 GLN n 1 37 LEU n 1 38 TYR n 1 39 GLN n 1 40 HIS n 1 41 ALA n 1 42 VAL n 1 43 GLN n 1 44 TYR n 1 45 PHE n 1 46 LEU n 1 47 HIS n 1 48 VAL n 1 49 VAL n 1 50 LYS n 1 51 TYR n 1 52 GLU n 1 53 ALA n 1 54 GLN n 1 55 GLY n 1 56 ASP n 1 57 LYS n 1 58 ALA n 1 59 LYS n 1 60 GLN n 1 61 SER n 1 62 ILE n 1 63 ARG n 1 64 ALA n 1 65 LYS n 1 66 CYS n 1 67 THR n 1 68 GLU n 1 69 TYR n 1 70 LEU n 1 71 ASP n 1 72 ARG n 1 73 ALA n 1 74 GLU n 1 75 LYS n 1 76 LEU n 1 77 LYS n 1 78 GLU n 1 79 TYR n 1 80 LEU n 1 81 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PRESAT _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VPS4B_HUMAN _struct_ref.pdbx_db_accession O75351 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLK _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WR0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 81 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O75351 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 77 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 81 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WR0 GLY A 1 ? UNP O75351 ? ? 'expression tag' 1 1 1 1WR0 SER A 2 ? UNP O75351 ? ? 'expression tag' 2 2 1 1WR0 ASP A 3 ? UNP O75351 ? ? 'expression tag' 3 3 1 1WR0 HIS A 4 ? UNP O75351 ? ? 'expression tag' 4 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 2 1 3D_13C-separated_NOESY 3 1 1 HNHA # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 'NaCl 50mM' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM protein U-15N; 20mM Tris buffer; 50mM NaCl; 95% H2O, 5% D2O; 1mM DTT' '95% H2O/5% D2O' 2 '1mM protein U-15N,13C; 20mM Tris buffer; 50mM NaCl; 95% H2O, 5% D2O; 1mM DTT' '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 500 2 ? Bruker DRX 800 # _pdbx_nmr_refine.entry_id 1WR0 _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing, molecular dynamics, energy minimization' _pdbx_nmr_refine.details 'the structures are based on a total of 1539 restraints, 1471 are NOE-derived distance constraints, 68 dihedral angle restraints.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1WR0 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 1WR0 _pdbx_nmr_ensemble.conformers_calculated_total_number 94 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 3.5 collection ? 1 NMRPipe 2.1 processing Delaglio 2 Sparky 3.110 'data analysis' Goddard 3 CYANA 2.0 'structure solution' Guntert 4 Amber 7.0 refinement Pearlman 5 # _exptl.entry_id 1WR0 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1WR0 _struct.title 'Structural characterization of the MIT domain from human Vps4b' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WR0 _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' _struct_keywords.text ;VPS4b, SKD1, MIT DOMAIN, ESCORT, MVB, SNPs, PROTEIN TRANSPORT, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 9 ? ALA A 28 ? SER A 9 ALA A 28 1 ? 20 HELX_P HELX_P2 2 GLU A 33 ? GLU A 52 ? GLU A 33 GLU A 52 1 ? 20 HELX_P HELX_P3 3 GLY A 55 ? ALA A 58 ? GLY A 55 ALA A 58 5 ? 4 HELX_P HELX_P4 4 LYS A 59 ? LYS A 77 ? LYS A 59 LYS A 77 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1WR0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WR0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LYS 81 81 81 LYS LYS A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-08-02 2 'Structure model' 1 1 2007-10-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' database_2 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.Cartn_x' 2 4 'Structure model' '_atom_site.Cartn_y' 3 4 'Structure model' '_atom_site.Cartn_z' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_pdbx_nmr_software.name' 7 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 8 NE A ARG 72 ? ? CZ A ARG 72 ? ? NH1 A ARG 72 ? ? 123.86 120.30 3.56 0.50 N 2 9 NE A ARG 72 ? ? CZ A ARG 72 ? ? NH1 A ARG 72 ? ? 123.75 120.30 3.45 0.50 N 3 11 NE A ARG 72 ? ? CZ A ARG 72 ? ? NH1 A ARG 72 ? ? 123.33 120.30 3.03 0.50 N 4 14 NE A ARG 72 ? ? CZ A ARG 72 ? ? NH1 A ARG 72 ? ? 123.32 120.30 3.02 0.50 N 5 17 NE A ARG 72 ? ? CZ A ARG 72 ? ? NH1 A ARG 72 ? ? 123.78 120.30 3.48 0.50 N 6 19 NE A ARG 72 ? ? CZ A ARG 72 ? ? NH1 A ARG 72 ? ? 124.10 120.30 3.80 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 3 ? ? 38.72 52.23 2 1 HIS A 4 ? ? 61.28 -22.44 3 1 TYR A 31 ? ? 36.17 55.90 4 1 GLU A 32 ? ? -130.85 -75.16 5 1 ASP A 56 ? ? 48.86 -89.45 6 1 LEU A 80 ? ? -38.54 107.20 7 2 MET A 5 ? ? 49.12 -9.67 8 2 SER A 7 ? ? 60.93 -2.34 9 2 TYR A 31 ? ? 35.97 54.35 10 2 GLU A 32 ? ? -134.79 -71.42 11 3 SER A 6 ? ? 62.36 -33.87 12 3 TYR A 31 ? ? 34.37 55.09 13 3 GLU A 32 ? ? -132.40 -76.12 14 3 GLU A 52 ? ? -136.40 -147.91 15 3 ALA A 53 ? ? 66.25 178.81 16 3 ASP A 56 ? ? -125.17 -65.47 17 4 MET A 5 ? ? 66.76 -37.47 18 4 TYR A 31 ? ? 32.95 54.98 19 4 GLU A 32 ? ? -130.14 -78.82 20 4 ASP A 56 ? ? 39.87 -91.38 21 5 SER A 2 ? ? -143.04 -11.15 22 5 MET A 5 ? ? 55.41 -73.33 23 5 SER A 7 ? ? 67.37 -28.31 24 5 TYR A 31 ? ? -63.56 71.32 25 5 GLU A 32 ? ? -160.15 -67.91 26 5 GLU A 52 ? ? -141.49 38.12 27 5 LEU A 80 ? ? -34.93 105.86 28 6 TYR A 31 ? ? 35.00 54.13 29 6 GLU A 32 ? ? -132.84 -79.26 30 7 TYR A 31 ? ? 35.85 56.56 31 7 GLU A 32 ? ? -128.95 -57.48 32 7 GLU A 52 ? ? -146.56 32.80 33 7 ASP A 56 ? ? -80.53 -83.69 34 7 LEU A 80 ? ? -41.77 104.89 35 8 MET A 5 ? ? 48.20 -1.19 36 8 TYR A 31 ? ? 25.21 65.65 37 8 GLU A 32 ? ? -141.80 -79.08 38 8 ALA A 53 ? ? -49.16 109.11 39 9 TYR A 31 ? ? 28.58 62.90 40 9 GLU A 32 ? ? -139.11 -72.73 41 9 ASP A 56 ? ? -75.36 -70.07 42 10 HIS A 4 ? ? -150.46 -30.46 43 10 SER A 6 ? ? 62.79 -24.39 44 10 TYR A 31 ? ? 35.86 54.88 45 10 GLU A 32 ? ? -131.54 -75.63 46 10 ASP A 56 ? ? -103.50 -76.94 47 11 MET A 5 ? ? -76.74 31.08 48 11 TYR A 31 ? ? 35.16 54.97 49 11 GLU A 32 ? ? -132.94 -78.96 50 11 ASP A 56 ? ? -68.98 -70.31 51 12 HIS A 4 ? ? -67.92 95.82 52 12 MET A 5 ? ? 58.80 15.07 53 12 SER A 6 ? ? -62.45 98.00 54 12 SER A 7 ? ? 62.84 -57.29 55 12 TYR A 31 ? ? 36.74 53.16 56 12 GLU A 32 ? ? -131.15 -78.21 57 12 LYS A 57 ? ? 57.91 -21.13 58 13 ASP A 3 ? ? 61.75 -19.75 59 13 TYR A 31 ? ? 36.71 55.30 60 13 GLU A 32 ? ? -121.95 -83.46 61 13 ALA A 53 ? ? -52.46 107.97 62 13 LYS A 57 ? ? 57.21 -21.17 63 13 LYS A 77 ? ? -59.61 -8.79 64 14 TYR A 31 ? ? 34.27 53.92 65 14 GLU A 32 ? ? -133.76 -75.83 66 15 SER A 7 ? ? 58.92 -173.36 67 15 TYR A 31 ? ? 35.71 54.85 68 15 GLU A 32 ? ? -136.24 -74.64 69 15 ASP A 56 ? ? 45.34 -96.23 70 16 SER A 2 ? ? -74.59 46.90 71 16 THR A 8 ? ? 61.74 122.93 72 16 TYR A 31 ? ? 35.71 54.48 73 16 GLU A 32 ? ? -127.30 -73.92 74 16 GLU A 52 ? ? -151.30 28.95 75 16 LEU A 80 ? ? -39.07 110.19 76 17 TYR A 31 ? ? 37.45 54.34 77 17 GLU A 32 ? ? -126.31 -68.87 78 17 GLU A 52 ? ? -140.21 53.45 79 18 TYR A 31 ? ? 33.05 54.63 80 18 GLU A 32 ? ? -134.88 -78.63 81 19 HIS A 4 ? ? -132.52 -39.93 82 19 THR A 8 ? ? 72.05 155.15 83 19 TYR A 31 ? ? 35.54 53.55 84 19 GLU A 32 ? ? -138.60 -71.08 85 19 LYS A 57 ? ? 58.24 -16.68 86 20 TYR A 31 ? ? 37.11 53.20 87 20 GLU A 32 ? ? -133.63 -73.89 88 20 LYS A 57 ? ? -141.77 -13.29 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 5 ARG A 72 ? ? 0.077 'SIDE CHAIN' 2 16 ARG A 72 ? ? 0.079 'SIDE CHAIN' #