data_1WU0
# 
_entry.id   1WU0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1WU0         pdb_00001wu0 10.2210/pdb1wu0/pdb 
RCSB  RCSB023996   ?            ?                   
WWPDB D_1000023996 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-12-13 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-03-02 
5 'Structure model' 1 4 2024-05-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2            
2 4 'Structure model' pdbx_nmr_spectrometer 
3 4 'Structure model' pdbx_struct_assembly  
4 4 'Structure model' pdbx_struct_oper_list 
5 5 'Structure model' chem_comp_atom        
6 5 'Structure model' chem_comp_bond        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_pdbx_nmr_spectrometer.model'        
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1WU0 
_pdbx_database_status.recvd_initial_deposition_date   2004-11-29 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1A91 'F1FO ATPASE SUBUNIT C' unspecified 
PDB 1C0V 'PROTEIN (F1FO ATPASE SUBUNIT C)' unspecified 
PDB 1C99 'PROTEOLIPID F1FO ATPASE SUBUNIT C' unspecified 
PDB 1C17 'ATP SYNTHASE SUBUNIT C' unspecified 
PDB 1QO1 
'ATP SYNTHASE ALPHA CHAIN, ATP SYNTHASE BETA CHAIN, ATP SYNTHASE GAMMA CHAIN, ATP SYNTHASE DELTA CHAIN, ATP SYNTHASE PROTEIN 9' 
unspecified 
PDB 1ATY 
'F1FO ATP SYNTHASE (E.C.3.6.1.34) SUBUNIT C (RESIDUES 9 - 26, 52 - 79) MUTANT WITH ALA 67 REPLACED BY CYS (A67C) (NMR, 9 STRUCTURES)' 
unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nakano, T.'  1 
'Ikegami, T.' 2 
'Suzuki, T.'  3 
'Yoshida, M.' 4 
'Akutsu, H.'  5 
# 
_citation.id                        primary 
_citation.title                     'solution structure TF1Fo subunit c' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Nakano, T.'  1 ? 
primary 'Ikegami, T.' 2 ? 
primary 'Suzuki, T.'  3 ? 
primary 'Yoshida, M.' 4 ? 
primary 'Akutsu, H.'  5 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'ATP synthase C chain' 
_entity.formula_weight             7337.780 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    3.6.3.14 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'F1Fo-ATPase subunit c, Lipid-binding protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MSLGVLAAAIAVGLGALGAGIGNGLIVSRTIEGIARQPELRPVLQTTMFIGVALVEALPIIGVVFSFIYLGR 
_entity_poly.pdbx_seq_one_letter_code_can   MSLGVLAAAIAVGLGALGAGIGNGLIVSRTIEGIARQPELRPVLQTTMFIGVALVEALPIIGVVFSFIYLGR 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  SER n 
1 3  LEU n 
1 4  GLY n 
1 5  VAL n 
1 6  LEU n 
1 7  ALA n 
1 8  ALA n 
1 9  ALA n 
1 10 ILE n 
1 11 ALA n 
1 12 VAL n 
1 13 GLY n 
1 14 LEU n 
1 15 GLY n 
1 16 ALA n 
1 17 LEU n 
1 18 GLY n 
1 19 ALA n 
1 20 GLY n 
1 21 ILE n 
1 22 GLY n 
1 23 ASN n 
1 24 GLY n 
1 25 LEU n 
1 26 ILE n 
1 27 VAL n 
1 28 SER n 
1 29 ARG n 
1 30 THR n 
1 31 ILE n 
1 32 GLU n 
1 33 GLY n 
1 34 ILE n 
1 35 ALA n 
1 36 ARG n 
1 37 GLN n 
1 38 PRO n 
1 39 GLU n 
1 40 LEU n 
1 41 ARG n 
1 42 PRO n 
1 43 VAL n 
1 44 LEU n 
1 45 GLN n 
1 46 THR n 
1 47 THR n 
1 48 MET n 
1 49 PHE n 
1 50 ILE n 
1 51 GLY n 
1 52 VAL n 
1 53 ALA n 
1 54 LEU n 
1 55 VAL n 
1 56 GLU n 
1 57 ALA n 
1 58 LEU n 
1 59 PRO n 
1 60 ILE n 
1 61 ILE n 
1 62 GLY n 
1 63 VAL n 
1 64 VAL n 
1 65 PHE n 
1 66 SER n 
1 67 PHE n 
1 68 ILE n 
1 69 TYR n 
1 70 LEU n 
1 71 GLY n 
1 72 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Bacillus 
_entity_src_gen.pdbx_gene_src_gene                 atpE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus sp. PS3' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2334 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTR19-C2 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  1  MET MET A . n 
A 1 2  SER 2  2  2  SER SER A . n 
A 1 3  LEU 3  3  3  LEU LEU A . n 
A 1 4  GLY 4  4  4  GLY GLY A . n 
A 1 5  VAL 5  5  5  VAL VAL A . n 
A 1 6  LEU 6  6  6  LEU LEU A . n 
A 1 7  ALA 7  7  7  ALA ALA A . n 
A 1 8  ALA 8  8  8  ALA ALA A . n 
A 1 9  ALA 9  9  9  ALA ALA A . n 
A 1 10 ILE 10 10 10 ILE ILE A . n 
A 1 11 ALA 11 11 11 ALA ALA A . n 
A 1 12 VAL 12 12 12 VAL VAL A . n 
A 1 13 GLY 13 13 13 GLY GLY A . n 
A 1 14 LEU 14 14 14 LEU LEU A . n 
A 1 15 GLY 15 15 15 GLY GLY A . n 
A 1 16 ALA 16 16 16 ALA ALA A . n 
A 1 17 LEU 17 17 17 LEU LEU A . n 
A 1 18 GLY 18 18 18 GLY GLY A . n 
A 1 19 ALA 19 19 19 ALA ALA A . n 
A 1 20 GLY 20 20 20 GLY GLY A . n 
A 1 21 ILE 21 21 21 ILE ILE A . n 
A 1 22 GLY 22 22 22 GLY GLY A . n 
A 1 23 ASN 23 23 23 ASN ASN A . n 
A 1 24 GLY 24 24 24 GLY GLY A . n 
A 1 25 LEU 25 25 25 LEU LEU A . n 
A 1 26 ILE 26 26 26 ILE ILE A . n 
A 1 27 VAL 27 27 27 VAL VAL A . n 
A 1 28 SER 28 28 28 SER SER A . n 
A 1 29 ARG 29 29 29 ARG ARG A . n 
A 1 30 THR 30 30 30 THR THR A . n 
A 1 31 ILE 31 31 31 ILE ILE A . n 
A 1 32 GLU 32 32 32 GLU GLU A . n 
A 1 33 GLY 33 33 33 GLY GLY A . n 
A 1 34 ILE 34 34 34 ILE ILE A . n 
A 1 35 ALA 35 35 35 ALA ALA A . n 
A 1 36 ARG 36 36 36 ARG ARG A . n 
A 1 37 GLN 37 37 37 GLN GLN A . n 
A 1 38 PRO 38 38 38 PRO PRO A . n 
A 1 39 GLU 39 39 39 GLU GLU A . n 
A 1 40 LEU 40 40 40 LEU LEU A . n 
A 1 41 ARG 41 41 41 ARG ARG A . n 
A 1 42 PRO 42 42 42 PRO PRO A . n 
A 1 43 VAL 43 43 43 VAL VAL A . n 
A 1 44 LEU 44 44 44 LEU LEU A . n 
A 1 45 GLN 45 45 45 GLN GLN A . n 
A 1 46 THR 46 46 46 THR THR A . n 
A 1 47 THR 47 47 47 THR THR A . n 
A 1 48 MET 48 48 48 MET MET A . n 
A 1 49 PHE 49 49 49 PHE PHE A . n 
A 1 50 ILE 50 50 50 ILE ILE A . n 
A 1 51 GLY 51 51 51 GLY GLY A . n 
A 1 52 VAL 52 52 52 VAL VAL A . n 
A 1 53 ALA 53 53 53 ALA ALA A . n 
A 1 54 LEU 54 54 54 LEU LEU A . n 
A 1 55 VAL 55 55 55 VAL VAL A . n 
A 1 56 GLU 56 56 56 GLU GLU A . n 
A 1 57 ALA 57 57 57 ALA ALA A . n 
A 1 58 LEU 58 58 58 LEU LEU A . n 
A 1 59 PRO 59 59 59 PRO PRO A . n 
A 1 60 ILE 60 60 60 ILE ILE A . n 
A 1 61 ILE 61 61 61 ILE ILE A . n 
A 1 62 GLY 62 62 62 GLY GLY A . n 
A 1 63 VAL 63 63 63 VAL VAL A . n 
A 1 64 VAL 64 64 64 VAL VAL A . n 
A 1 65 PHE 65 65 65 PHE PHE A . n 
A 1 66 SER 66 66 66 SER SER A . n 
A 1 67 PHE 67 67 67 PHE PHE A . n 
A 1 68 ILE 68 68 68 ILE ILE A . n 
A 1 69 TYR 69 69 69 TYR TYR A . n 
A 1 70 LEU 70 70 70 LEU LEU A . n 
A 1 71 GLY 71 71 71 GLY GLY A . n 
A 1 72 ARG 72 72 72 ARG ARG A . n 
# 
_exptl.entry_id          1WU0 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_database_PDB_matrix.entry_id          1WU0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1WU0 
_struct.title                     'Solution structure of subunit c of F1Fo-ATP synthase from the thermophilic bacillus PS3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1WU0 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'ATPase, ATP synthase, membrane protein, hydrogen ion transport, hydrolase' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ATPL_BACP3 
_struct_ref.pdbx_db_accession          P00845 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   MSLGVLAAAIAVGLGALGAGIGNGLIVSRTIEGIARQPELRPVLQTTMFIGVALVEALPIIGVVFSFIYLGR 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1WU0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 72 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00845 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  72 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       72 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 3  ? ARG A 36 ? LEU A 3  ARG A 36 1 ? 34 
HELX_P HELX_P2 2 PRO A 42 ? GLU A 56 ? PRO A 42 GLU A 56 1 ? 15 
HELX_P HELX_P3 3 GLU A 56 ? GLY A 71 ? GLU A 56 GLY A 71 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  2  O A LEU 44 ? ? HG1 A THR 47 ? ? 1.42 
2  4  O A ILE 68 ? ? H   A GLY 71 ? ? 1.60 
3  7  O A LEU 44 ? ? HG1 A THR 47 ? ? 1.60 
4  10 O A LEU 44 ? ? HG1 A THR 47 ? ? 1.51 
5  16 O A VAL 27 ? ? HG1 A THR 30 ? ? 1.56 
6  16 O A PHE 67 ? ? H   A ARG 72 ? ? 1.60 
7  17 O A LEU 44 ? ? HG1 A THR 47 ? ? 1.58 
8  21 O A LEU 44 ? ? HG1 A THR 47 ? ? 1.57 
9  27 O A PHE 67 ? ? H   A ARG 72 ? ? 1.57 
10 28 O A LEU 44 ? ? HG1 A THR 47 ? ? 1.47 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  SER A 2  ? ? -168.67 -169.31 
2  2  SER A 2  ? ? 178.91  -176.12 
3  2  GLN A 37 ? ? -45.46  161.49  
4  3  GLN A 37 ? ? -43.64  160.90  
5  4  SER A 2  ? ? 176.93  -169.50 
6  4  GLN A 37 ? ? -41.43  162.90  
7  4  LEU A 40 ? ? -92.66  33.00   
8  5  SER A 2  ? ? 175.03  179.06  
9  6  SER A 2  ? ? 174.61  -171.65 
10 7  SER A 2  ? ? -66.15  -175.17 
11 7  LEU A 40 ? ? -98.63  31.58   
12 8  SER A 2  ? ? -161.32 -163.95 
13 8  GLN A 37 ? ? -43.79  163.95  
14 9  SER A 2  ? ? 170.74  -174.92 
15 9  GLN A 37 ? ? -42.35  158.13  
16 9  LEU A 40 ? ? -92.81  34.06   
17 10 SER A 2  ? ? 177.57  -176.38 
18 10 GLN A 37 ? ? -42.30  162.20  
19 11 SER A 2  ? ? 169.01  -174.33 
20 11 GLN A 37 ? ? -43.47  166.08  
21 12 SER A 2  ? ? -178.14 -177.78 
22 12 LEU A 40 ? ? -98.99  31.70   
23 13 SER A 2  ? ? -168.99 -155.27 
24 13 GLN A 37 ? ? -43.08  159.03  
25 14 SER A 2  ? ? -178.67 -170.64 
26 14 GLN A 37 ? ? -43.13  158.85  
27 14 LEU A 40 ? ? -93.06  32.98   
28 15 SER A 2  ? ? -55.94  -165.57 
29 16 SER A 2  ? ? -176.40 -151.68 
30 17 SER A 2  ? ? 177.54  -175.67 
31 17 GLN A 37 ? ? -41.86  164.14  
32 18 SER A 2  ? ? -160.82 -163.27 
33 19 SER A 2  ? ? -175.64 148.49  
34 19 GLN A 37 ? ? -40.24  161.59  
35 20 SER A 2  ? ? 173.62  -174.12 
36 20 LEU A 40 ? ? -93.85  31.82   
37 21 SER A 2  ? ? -170.10 -156.79 
38 21 GLN A 37 ? ? -40.59  161.70  
39 21 LEU A 40 ? ? -97.59  33.12   
40 22 SER A 2  ? ? 175.72  -158.93 
41 22 GLN A 37 ? ? -41.94  164.40  
42 22 LEU A 40 ? ? -98.30  32.66   
43 23 GLN A 37 ? ? -49.38  163.98  
44 24 SER A 2  ? ? -163.28 -164.38 
45 24 GLN A 37 ? ? -42.75  165.99  
46 24 LEU A 40 ? ? -98.79  32.23   
47 27 SER A 2  ? ? -174.46 -176.54 
48 27 GLN A 37 ? ? -38.09  157.63  
49 28 SER A 2  ? ? -170.13 -169.56 
50 28 GLN A 37 ? ? -44.37  161.14  
51 30 GLN A 37 ? ? -42.13  162.82  
52 30 LEU A 40 ? ? -95.76  33.04   
# 
_pdbx_nmr_ensemble.entry_id                                      1WU0 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             30 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1WU0 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '2mM subunit c, organic solvent' 
_pdbx_nmr_sample_details.solvent_system   'CDCl3:CD3OH = 3:1' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  2.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1  1 1 15N-1H-HSQC  
2  1 1 '2D NOESY'   
3  1 1 'CBCA(CO)NH' 
4  1 1 CBCANH       
5  1 1 HNCO         
6  1 1 'HN(CA)CO'   
7  1 1 HBHANH       
8  1 1 'HBHA(CO)NH' 
9  1 1 'H(CCO)NH'   
10 1 1 'C(CO)NH'    
# 
_pdbx_nmr_details.entry_id   1WU0 
_pdbx_nmr_details.text       'The structure was determined using triple-resonance NMR spectroscopy.' 
# 
_pdbx_nmr_refine.entry_id           1WU0 
_pdbx_nmr_refine.method             'simulated annealing torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
NMRPipe 2.2            processing           'Delaglio, F.'  1 
Sparky  3.106          'data analysis'      'Goddard, T.D.' 2 
CYANA   1.0.6          'structure solution' 'Guentert, P.'  3 
TALOS   2003.027.13.05 'data analysis'      'Delaglio, F.'  4 
CYANA   1.0.6          refinement           'Guentert, P.'  5 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
GLN N    N N N 58  
GLN CA   C N S 59  
GLN C    C N N 60  
GLN O    O N N 61  
GLN CB   C N N 62  
GLN CG   C N N 63  
GLN CD   C N N 64  
GLN OE1  O N N 65  
GLN NE2  N N N 66  
GLN OXT  O N N 67  
GLN H    H N N 68  
GLN H2   H N N 69  
GLN HA   H N N 70  
GLN HB2  H N N 71  
GLN HB3  H N N 72  
GLN HG2  H N N 73  
GLN HG3  H N N 74  
GLN HE21 H N N 75  
GLN HE22 H N N 76  
GLN HXT  H N N 77  
GLU N    N N N 78  
GLU CA   C N S 79  
GLU C    C N N 80  
GLU O    O N N 81  
GLU CB   C N N 82  
GLU CG   C N N 83  
GLU CD   C N N 84  
GLU OE1  O N N 85  
GLU OE2  O N N 86  
GLU OXT  O N N 87  
GLU H    H N N 88  
GLU H2   H N N 89  
GLU HA   H N N 90  
GLU HB2  H N N 91  
GLU HB3  H N N 92  
GLU HG2  H N N 93  
GLU HG3  H N N 94  
GLU HE2  H N N 95  
GLU HXT  H N N 96  
GLY N    N N N 97  
GLY CA   C N N 98  
GLY C    C N N 99  
GLY O    O N N 100 
GLY OXT  O N N 101 
GLY H    H N N 102 
GLY H2   H N N 103 
GLY HA2  H N N 104 
GLY HA3  H N N 105 
GLY HXT  H N N 106 
ILE N    N N N 107 
ILE CA   C N S 108 
ILE C    C N N 109 
ILE O    O N N 110 
ILE CB   C N S 111 
ILE CG1  C N N 112 
ILE CG2  C N N 113 
ILE CD1  C N N 114 
ILE OXT  O N N 115 
ILE H    H N N 116 
ILE H2   H N N 117 
ILE HA   H N N 118 
ILE HB   H N N 119 
ILE HG12 H N N 120 
ILE HG13 H N N 121 
ILE HG21 H N N 122 
ILE HG22 H N N 123 
ILE HG23 H N N 124 
ILE HD11 H N N 125 
ILE HD12 H N N 126 
ILE HD13 H N N 127 
ILE HXT  H N N 128 
LEU N    N N N 129 
LEU CA   C N S 130 
LEU C    C N N 131 
LEU O    O N N 132 
LEU CB   C N N 133 
LEU CG   C N N 134 
LEU CD1  C N N 135 
LEU CD2  C N N 136 
LEU OXT  O N N 137 
LEU H    H N N 138 
LEU H2   H N N 139 
LEU HA   H N N 140 
LEU HB2  H N N 141 
LEU HB3  H N N 142 
LEU HG   H N N 143 
LEU HD11 H N N 144 
LEU HD12 H N N 145 
LEU HD13 H N N 146 
LEU HD21 H N N 147 
LEU HD22 H N N 148 
LEU HD23 H N N 149 
LEU HXT  H N N 150 
MET N    N N N 151 
MET CA   C N S 152 
MET C    C N N 153 
MET O    O N N 154 
MET CB   C N N 155 
MET CG   C N N 156 
MET SD   S N N 157 
MET CE   C N N 158 
MET OXT  O N N 159 
MET H    H N N 160 
MET H2   H N N 161 
MET HA   H N N 162 
MET HB2  H N N 163 
MET HB3  H N N 164 
MET HG2  H N N 165 
MET HG3  H N N 166 
MET HE1  H N N 167 
MET HE2  H N N 168 
MET HE3  H N N 169 
MET HXT  H N N 170 
PHE N    N N N 171 
PHE CA   C N S 172 
PHE C    C N N 173 
PHE O    O N N 174 
PHE CB   C N N 175 
PHE CG   C Y N 176 
PHE CD1  C Y N 177 
PHE CD2  C Y N 178 
PHE CE1  C Y N 179 
PHE CE2  C Y N 180 
PHE CZ   C Y N 181 
PHE OXT  O N N 182 
PHE H    H N N 183 
PHE H2   H N N 184 
PHE HA   H N N 185 
PHE HB2  H N N 186 
PHE HB3  H N N 187 
PHE HD1  H N N 188 
PHE HD2  H N N 189 
PHE HE1  H N N 190 
PHE HE2  H N N 191 
PHE HZ   H N N 192 
PHE HXT  H N N 193 
PRO N    N N N 194 
PRO CA   C N S 195 
PRO C    C N N 196 
PRO O    O N N 197 
PRO CB   C N N 198 
PRO CG   C N N 199 
PRO CD   C N N 200 
PRO OXT  O N N 201 
PRO H    H N N 202 
PRO HA   H N N 203 
PRO HB2  H N N 204 
PRO HB3  H N N 205 
PRO HG2  H N N 206 
PRO HG3  H N N 207 
PRO HD2  H N N 208 
PRO HD3  H N N 209 
PRO HXT  H N N 210 
SER N    N N N 211 
SER CA   C N S 212 
SER C    C N N 213 
SER O    O N N 214 
SER CB   C N N 215 
SER OG   O N N 216 
SER OXT  O N N 217 
SER H    H N N 218 
SER H2   H N N 219 
SER HA   H N N 220 
SER HB2  H N N 221 
SER HB3  H N N 222 
SER HG   H N N 223 
SER HXT  H N N 224 
THR N    N N N 225 
THR CA   C N S 226 
THR C    C N N 227 
THR O    O N N 228 
THR CB   C N R 229 
THR OG1  O N N 230 
THR CG2  C N N 231 
THR OXT  O N N 232 
THR H    H N N 233 
THR H2   H N N 234 
THR HA   H N N 235 
THR HB   H N N 236 
THR HG1  H N N 237 
THR HG21 H N N 238 
THR HG22 H N N 239 
THR HG23 H N N 240 
THR HXT  H N N 241 
TYR N    N N N 242 
TYR CA   C N S 243 
TYR C    C N N 244 
TYR O    O N N 245 
TYR CB   C N N 246 
TYR CG   C Y N 247 
TYR CD1  C Y N 248 
TYR CD2  C Y N 249 
TYR CE1  C Y N 250 
TYR CE2  C Y N 251 
TYR CZ   C Y N 252 
TYR OH   O N N 253 
TYR OXT  O N N 254 
TYR H    H N N 255 
TYR H2   H N N 256 
TYR HA   H N N 257 
TYR HB2  H N N 258 
TYR HB3  H N N 259 
TYR HD1  H N N 260 
TYR HD2  H N N 261 
TYR HE1  H N N 262 
TYR HE2  H N N 263 
TYR HH   H N N 264 
TYR HXT  H N N 265 
VAL N    N N N 266 
VAL CA   C N S 267 
VAL C    C N N 268 
VAL O    O N N 269 
VAL CB   C N N 270 
VAL CG1  C N N 271 
VAL CG2  C N N 272 
VAL OXT  O N N 273 
VAL H    H N N 274 
VAL H2   H N N 275 
VAL HA   H N N 276 
VAL HB   H N N 277 
VAL HG11 H N N 278 
VAL HG12 H N N 279 
VAL HG13 H N N 280 
VAL HG21 H N N 281 
VAL HG22 H N N 282 
VAL HG23 H N N 283 
VAL HXT  H N N 284 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
GLN N   CA   sing N N 55  
GLN N   H    sing N N 56  
GLN N   H2   sing N N 57  
GLN CA  C    sing N N 58  
GLN CA  CB   sing N N 59  
GLN CA  HA   sing N N 60  
GLN C   O    doub N N 61  
GLN C   OXT  sing N N 62  
GLN CB  CG   sing N N 63  
GLN CB  HB2  sing N N 64  
GLN CB  HB3  sing N N 65  
GLN CG  CD   sing N N 66  
GLN CG  HG2  sing N N 67  
GLN CG  HG3  sing N N 68  
GLN CD  OE1  doub N N 69  
GLN CD  NE2  sing N N 70  
GLN NE2 HE21 sing N N 71  
GLN NE2 HE22 sing N N 72  
GLN OXT HXT  sing N N 73  
GLU N   CA   sing N N 74  
GLU N   H    sing N N 75  
GLU N   H2   sing N N 76  
GLU CA  C    sing N N 77  
GLU CA  CB   sing N N 78  
GLU CA  HA   sing N N 79  
GLU C   O    doub N N 80  
GLU C   OXT  sing N N 81  
GLU CB  CG   sing N N 82  
GLU CB  HB2  sing N N 83  
GLU CB  HB3  sing N N 84  
GLU CG  CD   sing N N 85  
GLU CG  HG2  sing N N 86  
GLU CG  HG3  sing N N 87  
GLU CD  OE1  doub N N 88  
GLU CD  OE2  sing N N 89  
GLU OE2 HE2  sing N N 90  
GLU OXT HXT  sing N N 91  
GLY N   CA   sing N N 92  
GLY N   H    sing N N 93  
GLY N   H2   sing N N 94  
GLY CA  C    sing N N 95  
GLY CA  HA2  sing N N 96  
GLY CA  HA3  sing N N 97  
GLY C   O    doub N N 98  
GLY C   OXT  sing N N 99  
GLY OXT HXT  sing N N 100 
ILE N   CA   sing N N 101 
ILE N   H    sing N N 102 
ILE N   H2   sing N N 103 
ILE CA  C    sing N N 104 
ILE CA  CB   sing N N 105 
ILE CA  HA   sing N N 106 
ILE C   O    doub N N 107 
ILE C   OXT  sing N N 108 
ILE CB  CG1  sing N N 109 
ILE CB  CG2  sing N N 110 
ILE CB  HB   sing N N 111 
ILE CG1 CD1  sing N N 112 
ILE CG1 HG12 sing N N 113 
ILE CG1 HG13 sing N N 114 
ILE CG2 HG21 sing N N 115 
ILE CG2 HG22 sing N N 116 
ILE CG2 HG23 sing N N 117 
ILE CD1 HD11 sing N N 118 
ILE CD1 HD12 sing N N 119 
ILE CD1 HD13 sing N N 120 
ILE OXT HXT  sing N N 121 
LEU N   CA   sing N N 122 
LEU N   H    sing N N 123 
LEU N   H2   sing N N 124 
LEU CA  C    sing N N 125 
LEU CA  CB   sing N N 126 
LEU CA  HA   sing N N 127 
LEU C   O    doub N N 128 
LEU C   OXT  sing N N 129 
LEU CB  CG   sing N N 130 
LEU CB  HB2  sing N N 131 
LEU CB  HB3  sing N N 132 
LEU CG  CD1  sing N N 133 
LEU CG  CD2  sing N N 134 
LEU CG  HG   sing N N 135 
LEU CD1 HD11 sing N N 136 
LEU CD1 HD12 sing N N 137 
LEU CD1 HD13 sing N N 138 
LEU CD2 HD21 sing N N 139 
LEU CD2 HD22 sing N N 140 
LEU CD2 HD23 sing N N 141 
LEU OXT HXT  sing N N 142 
MET N   CA   sing N N 143 
MET N   H    sing N N 144 
MET N   H2   sing N N 145 
MET CA  C    sing N N 146 
MET CA  CB   sing N N 147 
MET CA  HA   sing N N 148 
MET C   O    doub N N 149 
MET C   OXT  sing N N 150 
MET CB  CG   sing N N 151 
MET CB  HB2  sing N N 152 
MET CB  HB3  sing N N 153 
MET CG  SD   sing N N 154 
MET CG  HG2  sing N N 155 
MET CG  HG3  sing N N 156 
MET SD  CE   sing N N 157 
MET CE  HE1  sing N N 158 
MET CE  HE2  sing N N 159 
MET CE  HE3  sing N N 160 
MET OXT HXT  sing N N 161 
PHE N   CA   sing N N 162 
PHE N   H    sing N N 163 
PHE N   H2   sing N N 164 
PHE CA  C    sing N N 165 
PHE CA  CB   sing N N 166 
PHE CA  HA   sing N N 167 
PHE C   O    doub N N 168 
PHE C   OXT  sing N N 169 
PHE CB  CG   sing N N 170 
PHE CB  HB2  sing N N 171 
PHE CB  HB3  sing N N 172 
PHE CG  CD1  doub Y N 173 
PHE CG  CD2  sing Y N 174 
PHE CD1 CE1  sing Y N 175 
PHE CD1 HD1  sing N N 176 
PHE CD2 CE2  doub Y N 177 
PHE CD2 HD2  sing N N 178 
PHE CE1 CZ   doub Y N 179 
PHE CE1 HE1  sing N N 180 
PHE CE2 CZ   sing Y N 181 
PHE CE2 HE2  sing N N 182 
PHE CZ  HZ   sing N N 183 
PHE OXT HXT  sing N N 184 
PRO N   CA   sing N N 185 
PRO N   CD   sing N N 186 
PRO N   H    sing N N 187 
PRO CA  C    sing N N 188 
PRO CA  CB   sing N N 189 
PRO CA  HA   sing N N 190 
PRO C   O    doub N N 191 
PRO C   OXT  sing N N 192 
PRO CB  CG   sing N N 193 
PRO CB  HB2  sing N N 194 
PRO CB  HB3  sing N N 195 
PRO CG  CD   sing N N 196 
PRO CG  HG2  sing N N 197 
PRO CG  HG3  sing N N 198 
PRO CD  HD2  sing N N 199 
PRO CD  HD3  sing N N 200 
PRO OXT HXT  sing N N 201 
SER N   CA   sing N N 202 
SER N   H    sing N N 203 
SER N   H2   sing N N 204 
SER CA  C    sing N N 205 
SER CA  CB   sing N N 206 
SER CA  HA   sing N N 207 
SER C   O    doub N N 208 
SER C   OXT  sing N N 209 
SER CB  OG   sing N N 210 
SER CB  HB2  sing N N 211 
SER CB  HB3  sing N N 212 
SER OG  HG   sing N N 213 
SER OXT HXT  sing N N 214 
THR N   CA   sing N N 215 
THR N   H    sing N N 216 
THR N   H2   sing N N 217 
THR CA  C    sing N N 218 
THR CA  CB   sing N N 219 
THR CA  HA   sing N N 220 
THR C   O    doub N N 221 
THR C   OXT  sing N N 222 
THR CB  OG1  sing N N 223 
THR CB  CG2  sing N N 224 
THR CB  HB   sing N N 225 
THR OG1 HG1  sing N N 226 
THR CG2 HG21 sing N N 227 
THR CG2 HG22 sing N N 228 
THR CG2 HG23 sing N N 229 
THR OXT HXT  sing N N 230 
TYR N   CA   sing N N 231 
TYR N   H    sing N N 232 
TYR N   H2   sing N N 233 
TYR CA  C    sing N N 234 
TYR CA  CB   sing N N 235 
TYR CA  HA   sing N N 236 
TYR C   O    doub N N 237 
TYR C   OXT  sing N N 238 
TYR CB  CG   sing N N 239 
TYR CB  HB2  sing N N 240 
TYR CB  HB3  sing N N 241 
TYR CG  CD1  doub Y N 242 
TYR CG  CD2  sing Y N 243 
TYR CD1 CE1  sing Y N 244 
TYR CD1 HD1  sing N N 245 
TYR CD2 CE2  doub Y N 246 
TYR CD2 HD2  sing N N 247 
TYR CE1 CZ   doub Y N 248 
TYR CE1 HE1  sing N N 249 
TYR CE2 CZ   sing Y N 250 
TYR CE2 HE2  sing N N 251 
TYR CZ  OH   sing N N 252 
TYR OH  HH   sing N N 253 
TYR OXT HXT  sing N N 254 
VAL N   CA   sing N N 255 
VAL N   H    sing N N 256 
VAL N   H2   sing N N 257 
VAL CA  C    sing N N 258 
VAL CA  CB   sing N N 259 
VAL CA  HA   sing N N 260 
VAL C   O    doub N N 261 
VAL C   OXT  sing N N 262 
VAL CB  CG1  sing N N 263 
VAL CB  CG2  sing N N 264 
VAL CB  HB   sing N N 265 
VAL CG1 HG11 sing N N 266 
VAL CG1 HG12 sing N N 267 
VAL CG1 HG13 sing N N 268 
VAL CG2 HG21 sing N N 269 
VAL CG2 HG22 sing N N 270 
VAL CG2 HG23 sing N N 271 
VAL OXT HXT  sing N N 272 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker DRX    800 
2 ? Bruker DRX    600 
3 ? Bruker DRX    500 
4 ? Bruker AVANCE 400 
# 
_atom_sites.entry_id                    1WU0 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_