data_1WV8
# 
_entry.id   1WV8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1WV8         pdb_00001wv8 10.2210/pdb1wv8/pdb 
RCSB  RCSB024040   ?            ?                   
WWPDB D_1000024040 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-06-12 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2024-11-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Source and taxonomy'       
4 3 'Structure model' 'Version format compliance' 
5 4 'Structure model' 'Data collection'           
6 4 'Structure model' 'Database references'       
7 4 'Structure model' 'Derived calculations'      
8 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' chem_comp_atom            
2 4 'Structure model' chem_comp_bond            
3 4 'Structure model' database_2                
4 4 'Structure model' pdbx_entry_details        
5 4 'Structure model' pdbx_modification_feature 
6 4 'Structure model' struct_conn               
7 4 'Structure model' struct_ref_seq_dif        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
4 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1WV8 
_pdbx_database_status.recvd_initial_deposition_date   2004-12-12 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          ttk003001413.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mizohata, E.'                                           1 
'Hattori, M.'                                            2 
'Kuramitsu, S.'                                          3 
'Shirouzu, M.'                                           4 
'Yokoyama, S.'                                           5 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the hypothetical protein TTHA1013 from Thermus thermophilus HB8' 
_citation.journal_abbrev            Proteins 
_citation.journal_volume            61 
_citation.page_first                1117 
_citation.page_last                 1120 
_citation.year                      2005 
_citation.journal_id_ASTM           PSFGEY 
_citation.country                   US 
_citation.journal_id_ISSN           0887-3585 
_citation.journal_id_CSD            0867 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16250002 
_citation.pdbx_database_id_DOI      10.1002/prot.20692 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hattori, M.'   1 ? 
primary 'Mizohata, E.'  2 ? 
primary 'Manzoku, M.'   3 ? 
primary 'Bessho, Y.'    4 ? 
primary 'Murayama, K.'  5 ? 
primary 'Terada, T.'    6 ? 
primary 'Kuramitsu, S.' 7 ? 
primary 'Shirouzu, M.'  8 ? 
primary 'Yokoyama, S.'  9 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'hypothetical protein TTHA1013' 8013.877 1  ? ? ? ? 
2 water   nat water                           18.015   38 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        TT1413 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)RTLKVQALWDGEAGVWVAESDDVPGLATEAATLEELLAKLAV(MSE)VPELLEENGVALELPVELRLEATRPLVF
S
;
_entity_poly.pdbx_seq_one_letter_code_can   MRTLKVQALWDGEAGVWVAESDDVPGLATEAATLEELLAKLAVMVPELLEENGVALELPVELRLEATRPLVFS 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ttk003001413.1 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MSE n 
1 2  ARG n 
1 3  THR n 
1 4  LEU n 
1 5  LYS n 
1 6  VAL n 
1 7  GLN n 
1 8  ALA n 
1 9  LEU n 
1 10 TRP n 
1 11 ASP n 
1 12 GLY n 
1 13 GLU n 
1 14 ALA n 
1 15 GLY n 
1 16 VAL n 
1 17 TRP n 
1 18 VAL n 
1 19 ALA n 
1 20 GLU n 
1 21 SER n 
1 22 ASP n 
1 23 ASP n 
1 24 VAL n 
1 25 PRO n 
1 26 GLY n 
1 27 LEU n 
1 28 ALA n 
1 29 THR n 
1 30 GLU n 
1 31 ALA n 
1 32 ALA n 
1 33 THR n 
1 34 LEU n 
1 35 GLU n 
1 36 GLU n 
1 37 LEU n 
1 38 LEU n 
1 39 ALA n 
1 40 LYS n 
1 41 LEU n 
1 42 ALA n 
1 43 VAL n 
1 44 MSE n 
1 45 VAL n 
1 46 PRO n 
1 47 GLU n 
1 48 LEU n 
1 49 LEU n 
1 50 GLU n 
1 51 GLU n 
1 52 ASN n 
1 53 GLY n 
1 54 VAL n 
1 55 ALA n 
1 56 LEU n 
1 57 GLU n 
1 58 LEU n 
1 59 PRO n 
1 60 VAL n 
1 61 GLU n 
1 62 LEU n 
1 63 ARG n 
1 64 LEU n 
1 65 GLU n 
1 66 ALA n 
1 67 THR n 
1 68 ARG n 
1 69 PRO n 
1 70 LEU n 
1 71 VAL n 
1 72 PHE n 
1 73 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Thermus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   'Thermus thermophilus' 
_entity_src_gen.gene_src_strain                    HB8 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     300852 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET11a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MSE 1  1  ?  ?   ?   A . n 
A 1 2  ARG 2  2  2  ARG ARG A . n 
A 1 3  THR 3  3  3  THR THR A . n 
A 1 4  LEU 4  4  4  LEU LEU A . n 
A 1 5  LYS 5  5  5  LYS LYS A . n 
A 1 6  VAL 6  6  6  VAL VAL A . n 
A 1 7  GLN 7  7  7  GLN GLN A . n 
A 1 8  ALA 8  8  8  ALA ALA A . n 
A 1 9  LEU 9  9  9  LEU LEU A . n 
A 1 10 TRP 10 10 10 TRP TRP A . n 
A 1 11 ASP 11 11 11 ASP ASP A . n 
A 1 12 GLY 12 12 12 GLY GLY A . n 
A 1 13 GLU 13 13 13 GLU GLU A . n 
A 1 14 ALA 14 14 14 ALA ALA A . n 
A 1 15 GLY 15 15 15 GLY GLY A . n 
A 1 16 VAL 16 16 16 VAL VAL A . n 
A 1 17 TRP 17 17 17 TRP TRP A . n 
A 1 18 VAL 18 18 18 VAL VAL A . n 
A 1 19 ALA 19 19 19 ALA ALA A . n 
A 1 20 GLU 20 20 20 GLU GLU A . n 
A 1 21 SER 21 21 21 SER SER A . n 
A 1 22 ASP 22 22 22 ASP ASP A . n 
A 1 23 ASP 23 23 23 ASP ASP A . n 
A 1 24 VAL 24 24 24 VAL VAL A . n 
A 1 25 PRO 25 25 25 PRO PRO A . n 
A 1 26 GLY 26 26 26 GLY GLY A . n 
A 1 27 LEU 27 27 27 LEU LEU A . n 
A 1 28 ALA 28 28 28 ALA ALA A . n 
A 1 29 THR 29 29 29 THR THR A . n 
A 1 30 GLU 30 30 30 GLU GLU A . n 
A 1 31 ALA 31 31 31 ALA ALA A . n 
A 1 32 ALA 32 32 32 ALA ALA A . n 
A 1 33 THR 33 33 33 THR THR A . n 
A 1 34 LEU 34 34 34 LEU LEU A . n 
A 1 35 GLU 35 35 35 GLU GLU A . n 
A 1 36 GLU 36 36 36 GLU GLU A . n 
A 1 37 LEU 37 37 37 LEU LEU A . n 
A 1 38 LEU 38 38 38 LEU LEU A . n 
A 1 39 ALA 39 39 39 ALA ALA A . n 
A 1 40 LYS 40 40 40 LYS LYS A . n 
A 1 41 LEU 41 41 41 LEU LEU A . n 
A 1 42 ALA 42 42 42 ALA ALA A . n 
A 1 43 VAL 43 43 43 VAL VAL A . n 
A 1 44 MSE 44 44 44 MSE MSE A . n 
A 1 45 VAL 45 45 45 VAL VAL A . n 
A 1 46 PRO 46 46 46 PRO PRO A . n 
A 1 47 GLU 47 47 47 GLU GLU A . n 
A 1 48 LEU 48 48 48 LEU LEU A . n 
A 1 49 LEU 49 49 49 LEU LEU A . n 
A 1 50 GLU 50 50 50 GLU GLU A . n 
A 1 51 GLU 51 51 51 GLU GLU A . n 
A 1 52 ASN 52 52 52 ASN ASN A . n 
A 1 53 GLY 53 53 53 GLY GLY A . n 
A 1 54 VAL 54 54 54 VAL VAL A . n 
A 1 55 ALA 55 55 55 ALA ALA A . n 
A 1 56 LEU 56 56 56 LEU LEU A . n 
A 1 57 GLU 57 57 57 GLU GLU A . n 
A 1 58 LEU 58 58 58 LEU LEU A . n 
A 1 59 PRO 59 59 59 PRO PRO A . n 
A 1 60 VAL 60 60 60 VAL VAL A . n 
A 1 61 GLU 61 61 61 GLU GLU A . n 
A 1 62 LEU 62 62 62 LEU LEU A . n 
A 1 63 ARG 63 63 63 ARG ARG A . n 
A 1 64 LEU 64 64 64 LEU LEU A . n 
A 1 65 GLU 65 65 65 GLU GLU A . n 
A 1 66 ALA 66 66 66 ALA ALA A . n 
A 1 67 THR 67 67 67 THR THR A . n 
A 1 68 ARG 68 68 68 ARG ARG A . n 
A 1 69 PRO 69 69 69 PRO PRO A . n 
A 1 70 LEU 70 70 70 LEU LEU A . n 
A 1 71 VAL 71 71 71 VAL VAL A . n 
A 1 72 PHE 72 72 72 PHE PHE A . n 
A 1 73 SER 73 73 ?  ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  74  1  HOH WAT A . 
B 2 HOH 2  75  2  HOH WAT A . 
B 2 HOH 3  76  3  HOH WAT A . 
B 2 HOH 4  77  4  HOH WAT A . 
B 2 HOH 5  78  5  HOH WAT A . 
B 2 HOH 6  79  6  HOH WAT A . 
B 2 HOH 7  80  7  HOH WAT A . 
B 2 HOH 8  81  8  HOH WAT A . 
B 2 HOH 9  82  9  HOH WAT A . 
B 2 HOH 10 83  10 HOH WAT A . 
B 2 HOH 11 84  11 HOH WAT A . 
B 2 HOH 12 85  12 HOH WAT A . 
B 2 HOH 13 86  13 HOH WAT A . 
B 2 HOH 14 87  14 HOH WAT A . 
B 2 HOH 15 88  15 HOH WAT A . 
B 2 HOH 16 89  16 HOH WAT A . 
B 2 HOH 17 90  17 HOH WAT A . 
B 2 HOH 18 91  18 HOH WAT A . 
B 2 HOH 19 92  19 HOH WAT A . 
B 2 HOH 20 93  20 HOH WAT A . 
B 2 HOH 21 94  21 HOH WAT A . 
B 2 HOH 22 95  22 HOH WAT A . 
B 2 HOH 23 96  23 HOH WAT A . 
B 2 HOH 24 97  24 HOH WAT A . 
B 2 HOH 25 98  25 HOH WAT A . 
B 2 HOH 26 99  26 HOH WAT A . 
B 2 HOH 27 100 27 HOH WAT A . 
B 2 HOH 28 101 28 HOH WAT A . 
B 2 HOH 29 102 29 HOH WAT A . 
B 2 HOH 30 103 30 HOH WAT A . 
B 2 HOH 31 104 31 HOH WAT A . 
B 2 HOH 32 105 32 HOH WAT A . 
B 2 HOH 33 106 33 HOH WAT A . 
B 2 HOH 34 107 34 HOH WAT A . 
B 2 HOH 35 108 35 HOH WAT A . 
B 2 HOH 36 109 36 HOH WAT A . 
B 2 HOH 37 110 37 HOH WAT A . 
B 2 HOH 38 111 38 HOH WAT A . 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.1 ? 1 
HKL-2000  'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
SOLVE     phasing          .   ? 4 
# 
_cell.entry_id           1WV8 
_cell.length_a           51.897 
_cell.length_b           51.897 
_cell.length_c           117.727 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1WV8 
_symmetry.space_group_name_H-M             'P 64 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                181 
_symmetry.space_group_name_Hall            ? 
# 
_exptl.entry_id          1WV8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.878 
_exptl_crystal.density_percent_sol   56 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    
'ammonium sulfate, sodium acetate, PEG4000, Tris-HCl, Sodium chloride, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   2004-06-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.96300 1.0 
2 0.97911 1.0 
3 0.97937 1.0 
4 1.00000 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL26B1' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL26B1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.96300, 0.97911, 0.97937, 1.00000' 
# 
_reflns.entry_id                     1WV8 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   5283 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        30.3 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1WV8 
_refine.ls_number_reflns_obs                     5222 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               573827.92 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             44.95 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    99.6 
_refine.ls_R_factor_obs                          0.259 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.259 
_refine.ls_R_factor_R_free                       0.273 
_refine.ls_R_factor_R_free_error                 0.016 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.5 
_refine.ls_number_reflns_R_free                  285 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               53.6 
_refine.aniso_B[1][1]                            3.19 
_refine.aniso_B[2][2]                            3.19 
_refine.aniso_B[3][3]                            -6.39 
_refine.aniso_B[1][2]                            -1.96 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.355245 
_refine.solvent_model_param_bsol                 51.5787 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1WV8 
_refine_analyze.Luzzati_coordinate_error_obs    0.35 
_refine_analyze.Luzzati_sigma_a_obs             0.33 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.34 
_refine_analyze.Luzzati_sigma_a_free            0.38 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        541 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             38 
_refine_hist.number_atoms_total               579 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        44.95 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      24.7  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.88  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.34 
_refine_ls_shell.number_reflns_R_work             797 
_refine_ls_shell.R_factor_R_work                  0.316 
_refine_ls_shell.percent_reflns_obs               99.5 
_refine_ls_shell.R_factor_R_free                  0.331 
_refine_ls_shell.R_factor_R_free_error            0.055 
_refine_ls_shell.percent_reflns_R_free            4.3 
_refine_ls_shell.number_reflns_R_free             36 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_database_PDB_matrix.entry_id          1WV8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1WV8 
_struct.title                     
'Crystal structure of hypothetical protein TTHA1013 from an extremely thermophilic bacterium thermus thermophilus HB8' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1WV8 
_struct_keywords.pdbx_keywords   'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' 
_struct_keywords.text            
'Hypothetical, STRUCTURAL GENOMICS, Unknown function, novel fold, RIKEN Structural Genomics/Proteomics Initiative, RSGI' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q5SJJ5_THET8 
_struct_ref.pdbx_db_accession          Q5SJJ5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   MRTLKVQALWDGEAGVWVAESDDVPGLATEAATLEELLAKLAVMVPELLEENGVALELPVELRLEATRPLVFS 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1WV8 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 73 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q5SJJ5 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  73 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       73 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1WV8 MSE A 1  ? UNP Q5SJJ5 MET 1  'modified residue' 1  1 
1 1WV8 MSE A 44 ? UNP Q5SJJ5 MET 44 'modified residue' 44 2 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2320 ? 
1 MORE         -15  ? 
1 'SSA (A^2)'  8050 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 11_556 -x+y,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 117.7270000000 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       THR 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        33 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ASN 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        52 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        THR 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         33 
_struct_conf.end_auth_comp_id        ASN 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         52 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A VAL 43 C ? ? ? 1_555 A MSE 44 N ? ? A VAL 43 A MSE 44 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale2 covale both ? A MSE 44 C ? ? ? 1_555 A VAL 45 N ? ? A MSE 44 A VAL 45 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_pdbx_modification_feature.ordinal                            1 
_pdbx_modification_feature.label_comp_id                      MSE 
_pdbx_modification_feature.label_asym_id                      A 
_pdbx_modification_feature.label_seq_id                       44 
_pdbx_modification_feature.label_alt_id                       ? 
_pdbx_modification_feature.modified_residue_label_comp_id     . 
_pdbx_modification_feature.modified_residue_label_asym_id     . 
_pdbx_modification_feature.modified_residue_label_seq_id      . 
_pdbx_modification_feature.modified_residue_label_alt_id      . 
_pdbx_modification_feature.auth_comp_id                       MSE 
_pdbx_modification_feature.auth_asym_id                       A 
_pdbx_modification_feature.auth_seq_id                        44 
_pdbx_modification_feature.PDB_ins_code                       ? 
_pdbx_modification_feature.symmetry                           1_555 
_pdbx_modification_feature.modified_residue_auth_comp_id      . 
_pdbx_modification_feature.modified_residue_auth_asym_id      . 
_pdbx_modification_feature.modified_residue_auth_seq_id       . 
_pdbx_modification_feature.modified_residue_PDB_ins_code      . 
_pdbx_modification_feature.modified_residue_symmetry          . 
_pdbx_modification_feature.comp_id_linking_atom               . 
_pdbx_modification_feature.modified_residue_id_linking_atom   . 
_pdbx_modification_feature.modified_residue_id                MET 
_pdbx_modification_feature.ref_pcm_id                         1 
_pdbx_modification_feature.ref_comp_id                        MSE 
_pdbx_modification_feature.type                               Selenomethionine 
_pdbx_modification_feature.category                           'Named protein modification' 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LEU 
_struct_mon_prot_cis.label_seq_id           58 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LEU 
_struct_mon_prot_cis.auth_seq_id            58 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    59 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     59 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.23 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 30 ? ALA A 31 ? GLU A 30 ALA A 31 
A 2 VAL A 16 ? GLU A 20 ? VAL A 16 GLU A 20 
A 3 THR A 3  ? ASP A 11 ? THR A 3  ASP A 11 
A 4 GLU A 61 ? GLU A 65 ? GLU A 61 GLU A 65 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ALA A 31 ? O ALA A 31 N TRP A 17 ? N TRP A 17 
A 2 3 O GLU A 20 ? O GLU A 20 N GLN A 7  ? N GLN A 7  
A 3 4 N VAL A 6  ? N VAL A 6  O GLU A 65 ? O GLU A 65 
# 
_pdbx_entry_details.entry_id                   1WV8 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     106 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     106 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_665 
_pdbx_validate_symm_contact.dist              1.60 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    VAL 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     54 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -45.39 
_pdbx_validate_torsion.psi             -90.51 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'RIKEN Structural Genomics/Proteomics Initiative' 
_pdbx_SG_project.initial_of_center     RSGI 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    MSE 
_pdbx_struct_mod_residue.label_seq_id     44 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     MSE 
_pdbx_struct_mod_residue.auth_seq_id      44 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   MET 
_pdbx_struct_mod_residue.details          SELENOMETHIONINE 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 85  ? B HOH . 
2 1 A HOH 110 ? B HOH . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MSE 1  ? A MSE 1  
2 1 Y 1 A SER 73 ? A SER 73 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
GLN N    N  N N 74  
GLN CA   C  N S 75  
GLN C    C  N N 76  
GLN O    O  N N 77  
GLN CB   C  N N 78  
GLN CG   C  N N 79  
GLN CD   C  N N 80  
GLN OE1  O  N N 81  
GLN NE2  N  N N 82  
GLN OXT  O  N N 83  
GLN H    H  N N 84  
GLN H2   H  N N 85  
GLN HA   H  N N 86  
GLN HB2  H  N N 87  
GLN HB3  H  N N 88  
GLN HG2  H  N N 89  
GLN HG3  H  N N 90  
GLN HE21 H  N N 91  
GLN HE22 H  N N 92  
GLN HXT  H  N N 93  
GLU N    N  N N 94  
GLU CA   C  N S 95  
GLU C    C  N N 96  
GLU O    O  N N 97  
GLU CB   C  N N 98  
GLU CG   C  N N 99  
GLU CD   C  N N 100 
GLU OE1  O  N N 101 
GLU OE2  O  N N 102 
GLU OXT  O  N N 103 
GLU H    H  N N 104 
GLU H2   H  N N 105 
GLU HA   H  N N 106 
GLU HB2  H  N N 107 
GLU HB3  H  N N 108 
GLU HG2  H  N N 109 
GLU HG3  H  N N 110 
GLU HE2  H  N N 111 
GLU HXT  H  N N 112 
GLY N    N  N N 113 
GLY CA   C  N N 114 
GLY C    C  N N 115 
GLY O    O  N N 116 
GLY OXT  O  N N 117 
GLY H    H  N N 118 
GLY H2   H  N N 119 
GLY HA2  H  N N 120 
GLY HA3  H  N N 121 
GLY HXT  H  N N 122 
HOH O    O  N N 123 
HOH H1   H  N N 124 
HOH H2   H  N N 125 
LEU N    N  N N 126 
LEU CA   C  N S 127 
LEU C    C  N N 128 
LEU O    O  N N 129 
LEU CB   C  N N 130 
LEU CG   C  N N 131 
LEU CD1  C  N N 132 
LEU CD2  C  N N 133 
LEU OXT  O  N N 134 
LEU H    H  N N 135 
LEU H2   H  N N 136 
LEU HA   H  N N 137 
LEU HB2  H  N N 138 
LEU HB3  H  N N 139 
LEU HG   H  N N 140 
LEU HD11 H  N N 141 
LEU HD12 H  N N 142 
LEU HD13 H  N N 143 
LEU HD21 H  N N 144 
LEU HD22 H  N N 145 
LEU HD23 H  N N 146 
LEU HXT  H  N N 147 
LYS N    N  N N 148 
LYS CA   C  N S 149 
LYS C    C  N N 150 
LYS O    O  N N 151 
LYS CB   C  N N 152 
LYS CG   C  N N 153 
LYS CD   C  N N 154 
LYS CE   C  N N 155 
LYS NZ   N  N N 156 
LYS OXT  O  N N 157 
LYS H    H  N N 158 
LYS H2   H  N N 159 
LYS HA   H  N N 160 
LYS HB2  H  N N 161 
LYS HB3  H  N N 162 
LYS HG2  H  N N 163 
LYS HG3  H  N N 164 
LYS HD2  H  N N 165 
LYS HD3  H  N N 166 
LYS HE2  H  N N 167 
LYS HE3  H  N N 168 
LYS HZ1  H  N N 169 
LYS HZ2  H  N N 170 
LYS HZ3  H  N N 171 
LYS HXT  H  N N 172 
MET N    N  N N 173 
MET CA   C  N S 174 
MET C    C  N N 175 
MET O    O  N N 176 
MET CB   C  N N 177 
MET CG   C  N N 178 
MET SD   S  N N 179 
MET CE   C  N N 180 
MET OXT  O  N N 181 
MET H    H  N N 182 
MET H2   H  N N 183 
MET HA   H  N N 184 
MET HB2  H  N N 185 
MET HB3  H  N N 186 
MET HG2  H  N N 187 
MET HG3  H  N N 188 
MET HE1  H  N N 189 
MET HE2  H  N N 190 
MET HE3  H  N N 191 
MET HXT  H  N N 192 
MSE N    N  N N 193 
MSE CA   C  N S 194 
MSE C    C  N N 195 
MSE O    O  N N 196 
MSE OXT  O  N N 197 
MSE CB   C  N N 198 
MSE CG   C  N N 199 
MSE SE   SE N N 200 
MSE CE   C  N N 201 
MSE H    H  N N 202 
MSE H2   H  N N 203 
MSE HA   H  N N 204 
MSE HXT  H  N N 205 
MSE HB2  H  N N 206 
MSE HB3  H  N N 207 
MSE HG2  H  N N 208 
MSE HG3  H  N N 209 
MSE HE1  H  N N 210 
MSE HE2  H  N N 211 
MSE HE3  H  N N 212 
PHE N    N  N N 213 
PHE CA   C  N S 214 
PHE C    C  N N 215 
PHE O    O  N N 216 
PHE CB   C  N N 217 
PHE CG   C  Y N 218 
PHE CD1  C  Y N 219 
PHE CD2  C  Y N 220 
PHE CE1  C  Y N 221 
PHE CE2  C  Y N 222 
PHE CZ   C  Y N 223 
PHE OXT  O  N N 224 
PHE H    H  N N 225 
PHE H2   H  N N 226 
PHE HA   H  N N 227 
PHE HB2  H  N N 228 
PHE HB3  H  N N 229 
PHE HD1  H  N N 230 
PHE HD2  H  N N 231 
PHE HE1  H  N N 232 
PHE HE2  H  N N 233 
PHE HZ   H  N N 234 
PHE HXT  H  N N 235 
PRO N    N  N N 236 
PRO CA   C  N S 237 
PRO C    C  N N 238 
PRO O    O  N N 239 
PRO CB   C  N N 240 
PRO CG   C  N N 241 
PRO CD   C  N N 242 
PRO OXT  O  N N 243 
PRO H    H  N N 244 
PRO HA   H  N N 245 
PRO HB2  H  N N 246 
PRO HB3  H  N N 247 
PRO HG2  H  N N 248 
PRO HG3  H  N N 249 
PRO HD2  H  N N 250 
PRO HD3  H  N N 251 
PRO HXT  H  N N 252 
SER N    N  N N 253 
SER CA   C  N S 254 
SER C    C  N N 255 
SER O    O  N N 256 
SER CB   C  N N 257 
SER OG   O  N N 258 
SER OXT  O  N N 259 
SER H    H  N N 260 
SER H2   H  N N 261 
SER HA   H  N N 262 
SER HB2  H  N N 263 
SER HB3  H  N N 264 
SER HG   H  N N 265 
SER HXT  H  N N 266 
THR N    N  N N 267 
THR CA   C  N S 268 
THR C    C  N N 269 
THR O    O  N N 270 
THR CB   C  N R 271 
THR OG1  O  N N 272 
THR CG2  C  N N 273 
THR OXT  O  N N 274 
THR H    H  N N 275 
THR H2   H  N N 276 
THR HA   H  N N 277 
THR HB   H  N N 278 
THR HG1  H  N N 279 
THR HG21 H  N N 280 
THR HG22 H  N N 281 
THR HG23 H  N N 282 
THR HXT  H  N N 283 
TRP N    N  N N 284 
TRP CA   C  N S 285 
TRP C    C  N N 286 
TRP O    O  N N 287 
TRP CB   C  N N 288 
TRP CG   C  Y N 289 
TRP CD1  C  Y N 290 
TRP CD2  C  Y N 291 
TRP NE1  N  Y N 292 
TRP CE2  C  Y N 293 
TRP CE3  C  Y N 294 
TRP CZ2  C  Y N 295 
TRP CZ3  C  Y N 296 
TRP CH2  C  Y N 297 
TRP OXT  O  N N 298 
TRP H    H  N N 299 
TRP H2   H  N N 300 
TRP HA   H  N N 301 
TRP HB2  H  N N 302 
TRP HB3  H  N N 303 
TRP HD1  H  N N 304 
TRP HE1  H  N N 305 
TRP HE3  H  N N 306 
TRP HZ2  H  N N 307 
TRP HZ3  H  N N 308 
TRP HH2  H  N N 309 
TRP HXT  H  N N 310 
VAL N    N  N N 311 
VAL CA   C  N S 312 
VAL C    C  N N 313 
VAL O    O  N N 314 
VAL CB   C  N N 315 
VAL CG1  C  N N 316 
VAL CG2  C  N N 317 
VAL OXT  O  N N 318 
VAL H    H  N N 319 
VAL H2   H  N N 320 
VAL HA   H  N N 321 
VAL HB   H  N N 322 
VAL HG11 H  N N 323 
VAL HG12 H  N N 324 
VAL HG13 H  N N 325 
VAL HG21 H  N N 326 
VAL HG22 H  N N 327 
VAL HG23 H  N N 328 
VAL HXT  H  N N 329 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HOH O   H1   sing N N 116 
HOH O   H2   sing N N 117 
LEU N   CA   sing N N 118 
LEU N   H    sing N N 119 
LEU N   H2   sing N N 120 
LEU CA  C    sing N N 121 
LEU CA  CB   sing N N 122 
LEU CA  HA   sing N N 123 
LEU C   O    doub N N 124 
LEU C   OXT  sing N N 125 
LEU CB  CG   sing N N 126 
LEU CB  HB2  sing N N 127 
LEU CB  HB3  sing N N 128 
LEU CG  CD1  sing N N 129 
LEU CG  CD2  sing N N 130 
LEU CG  HG   sing N N 131 
LEU CD1 HD11 sing N N 132 
LEU CD1 HD12 sing N N 133 
LEU CD1 HD13 sing N N 134 
LEU CD2 HD21 sing N N 135 
LEU CD2 HD22 sing N N 136 
LEU CD2 HD23 sing N N 137 
LEU OXT HXT  sing N N 138 
LYS N   CA   sing N N 139 
LYS N   H    sing N N 140 
LYS N   H2   sing N N 141 
LYS CA  C    sing N N 142 
LYS CA  CB   sing N N 143 
LYS CA  HA   sing N N 144 
LYS C   O    doub N N 145 
LYS C   OXT  sing N N 146 
LYS CB  CG   sing N N 147 
LYS CB  HB2  sing N N 148 
LYS CB  HB3  sing N N 149 
LYS CG  CD   sing N N 150 
LYS CG  HG2  sing N N 151 
LYS CG  HG3  sing N N 152 
LYS CD  CE   sing N N 153 
LYS CD  HD2  sing N N 154 
LYS CD  HD3  sing N N 155 
LYS CE  NZ   sing N N 156 
LYS CE  HE2  sing N N 157 
LYS CE  HE3  sing N N 158 
LYS NZ  HZ1  sing N N 159 
LYS NZ  HZ2  sing N N 160 
LYS NZ  HZ3  sing N N 161 
LYS OXT HXT  sing N N 162 
MET N   CA   sing N N 163 
MET N   H    sing N N 164 
MET N   H2   sing N N 165 
MET CA  C    sing N N 166 
MET CA  CB   sing N N 167 
MET CA  HA   sing N N 168 
MET C   O    doub N N 169 
MET C   OXT  sing N N 170 
MET CB  CG   sing N N 171 
MET CB  HB2  sing N N 172 
MET CB  HB3  sing N N 173 
MET CG  SD   sing N N 174 
MET CG  HG2  sing N N 175 
MET CG  HG3  sing N N 176 
MET SD  CE   sing N N 177 
MET CE  HE1  sing N N 178 
MET CE  HE2  sing N N 179 
MET CE  HE3  sing N N 180 
MET OXT HXT  sing N N 181 
MSE N   CA   sing N N 182 
MSE N   H    sing N N 183 
MSE N   H2   sing N N 184 
MSE CA  C    sing N N 185 
MSE CA  CB   sing N N 186 
MSE CA  HA   sing N N 187 
MSE C   O    doub N N 188 
MSE C   OXT  sing N N 189 
MSE OXT HXT  sing N N 190 
MSE CB  CG   sing N N 191 
MSE CB  HB2  sing N N 192 
MSE CB  HB3  sing N N 193 
MSE CG  SE   sing N N 194 
MSE CG  HG2  sing N N 195 
MSE CG  HG3  sing N N 196 
MSE SE  CE   sing N N 197 
MSE CE  HE1  sing N N 198 
MSE CE  HE2  sing N N 199 
MSE CE  HE3  sing N N 200 
PHE N   CA   sing N N 201 
PHE N   H    sing N N 202 
PHE N   H2   sing N N 203 
PHE CA  C    sing N N 204 
PHE CA  CB   sing N N 205 
PHE CA  HA   sing N N 206 
PHE C   O    doub N N 207 
PHE C   OXT  sing N N 208 
PHE CB  CG   sing N N 209 
PHE CB  HB2  sing N N 210 
PHE CB  HB3  sing N N 211 
PHE CG  CD1  doub Y N 212 
PHE CG  CD2  sing Y N 213 
PHE CD1 CE1  sing Y N 214 
PHE CD1 HD1  sing N N 215 
PHE CD2 CE2  doub Y N 216 
PHE CD2 HD2  sing N N 217 
PHE CE1 CZ   doub Y N 218 
PHE CE1 HE1  sing N N 219 
PHE CE2 CZ   sing Y N 220 
PHE CE2 HE2  sing N N 221 
PHE CZ  HZ   sing N N 222 
PHE OXT HXT  sing N N 223 
PRO N   CA   sing N N 224 
PRO N   CD   sing N N 225 
PRO N   H    sing N N 226 
PRO CA  C    sing N N 227 
PRO CA  CB   sing N N 228 
PRO CA  HA   sing N N 229 
PRO C   O    doub N N 230 
PRO C   OXT  sing N N 231 
PRO CB  CG   sing N N 232 
PRO CB  HB2  sing N N 233 
PRO CB  HB3  sing N N 234 
PRO CG  CD   sing N N 235 
PRO CG  HG2  sing N N 236 
PRO CG  HG3  sing N N 237 
PRO CD  HD2  sing N N 238 
PRO CD  HD3  sing N N 239 
PRO OXT HXT  sing N N 240 
SER N   CA   sing N N 241 
SER N   H    sing N N 242 
SER N   H2   sing N N 243 
SER CA  C    sing N N 244 
SER CA  CB   sing N N 245 
SER CA  HA   sing N N 246 
SER C   O    doub N N 247 
SER C   OXT  sing N N 248 
SER CB  OG   sing N N 249 
SER CB  HB2  sing N N 250 
SER CB  HB3  sing N N 251 
SER OG  HG   sing N N 252 
SER OXT HXT  sing N N 253 
THR N   CA   sing N N 254 
THR N   H    sing N N 255 
THR N   H2   sing N N 256 
THR CA  C    sing N N 257 
THR CA  CB   sing N N 258 
THR CA  HA   sing N N 259 
THR C   O    doub N N 260 
THR C   OXT  sing N N 261 
THR CB  OG1  sing N N 262 
THR CB  CG2  sing N N 263 
THR CB  HB   sing N N 264 
THR OG1 HG1  sing N N 265 
THR CG2 HG21 sing N N 266 
THR CG2 HG22 sing N N 267 
THR CG2 HG23 sing N N 268 
THR OXT HXT  sing N N 269 
TRP N   CA   sing N N 270 
TRP N   H    sing N N 271 
TRP N   H2   sing N N 272 
TRP CA  C    sing N N 273 
TRP CA  CB   sing N N 274 
TRP CA  HA   sing N N 275 
TRP C   O    doub N N 276 
TRP C   OXT  sing N N 277 
TRP CB  CG   sing N N 278 
TRP CB  HB2  sing N N 279 
TRP CB  HB3  sing N N 280 
TRP CG  CD1  doub Y N 281 
TRP CG  CD2  sing Y N 282 
TRP CD1 NE1  sing Y N 283 
TRP CD1 HD1  sing N N 284 
TRP CD2 CE2  doub Y N 285 
TRP CD2 CE3  sing Y N 286 
TRP NE1 CE2  sing Y N 287 
TRP NE1 HE1  sing N N 288 
TRP CE2 CZ2  sing Y N 289 
TRP CE3 CZ3  doub Y N 290 
TRP CE3 HE3  sing N N 291 
TRP CZ2 CH2  doub Y N 292 
TRP CZ2 HZ2  sing N N 293 
TRP CZ3 CH2  sing Y N 294 
TRP CZ3 HZ3  sing N N 295 
TRP CH2 HH2  sing N N 296 
TRP OXT HXT  sing N N 297 
VAL N   CA   sing N N 298 
VAL N   H    sing N N 299 
VAL N   H2   sing N N 300 
VAL CA  C    sing N N 301 
VAL CA  CB   sing N N 302 
VAL CA  HA   sing N N 303 
VAL C   O    doub N N 304 
VAL C   OXT  sing N N 305 
VAL CB  CG1  sing N N 306 
VAL CB  CG2  sing N N 307 
VAL CB  HB   sing N N 308 
VAL CG1 HG11 sing N N 309 
VAL CG1 HG12 sing N N 310 
VAL CG1 HG13 sing N N 311 
VAL CG2 HG21 sing N N 312 
VAL CG2 HG22 sing N N 313 
VAL CG2 HG23 sing N N 314 
VAL OXT HXT  sing N N 315 
# 
_atom_sites.entry_id                    1WV8 
_atom_sites.fract_transf_matrix[1][1]   0.019269 
_atom_sites.fract_transf_matrix[1][2]   0.011125 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022250 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008494 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
SE 
# 
loop_