data_1WXV # _entry.id 1WXV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WXV pdb_00001wxv 10.2210/pdb1wxv/pdb RCSB RCSB024131 ? ? WWPDB D_1000024131 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001001250.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WXV _pdbx_database_status.recvd_initial_deposition_date 2005-02-02 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Niraula, T.N.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of the ubiquitin domain of BCL-2 binding athanogene-1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Niraula, T.N.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Yokoyama, S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'BAG-family molecular chaperone regulator-1' _entity.formula_weight 9630.836 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'ubiquitin-like domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BCL-2 binding athanogene- 1, BAG-1, Glucocorticoid receptor-associated protein RAP46' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGLTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQVVEEVIGVPQSFQKLIFKGKSLKEMETPLSALGIQDGCRVM LIGKKNSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGLTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQVVEEVIGVPQSFQKLIFKGKSLKEMETPLSALGIQDGCRVM LIGKKNSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001001250.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LEU n 1 9 THR n 1 10 VAL n 1 11 THR n 1 12 VAL n 1 13 THR n 1 14 HIS n 1 15 SER n 1 16 ASN n 1 17 GLU n 1 18 LYS n 1 19 HIS n 1 20 ASP n 1 21 LEU n 1 22 HIS n 1 23 VAL n 1 24 THR n 1 25 SER n 1 26 GLN n 1 27 GLN n 1 28 GLY n 1 29 SER n 1 30 SER n 1 31 GLU n 1 32 PRO n 1 33 VAL n 1 34 VAL n 1 35 GLN n 1 36 ASP n 1 37 LEU n 1 38 ALA n 1 39 GLN n 1 40 VAL n 1 41 VAL n 1 42 GLU n 1 43 GLU n 1 44 VAL n 1 45 ILE n 1 46 GLY n 1 47 VAL n 1 48 PRO n 1 49 GLN n 1 50 SER n 1 51 PHE n 1 52 GLN n 1 53 LYS n 1 54 LEU n 1 55 ILE n 1 56 PHE n 1 57 LYS n 1 58 GLY n 1 59 LYS n 1 60 SER n 1 61 LEU n 1 62 LYS n 1 63 GLU n 1 64 MET n 1 65 GLU n 1 66 THR n 1 67 PRO n 1 68 LEU n 1 69 SER n 1 70 ALA n 1 71 LEU n 1 72 GLY n 1 73 ILE n 1 74 GLN n 1 75 ASP n 1 76 GLY n 1 77 CYS n 1 78 ARG n 1 79 VAL n 1 80 MET n 1 81 LEU n 1 82 ILE n 1 83 GLY n 1 84 LYS n 1 85 LYS n 1 86 ASN n 1 87 SER n 1 88 GLY n 1 89 PRO n 1 90 SER n 1 91 SER n 1 92 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene BAG1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040223-36 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BAG1_HUMAN _struct_ref.pdbx_db_accession Q99933 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQVVEEVIGVPQSFQKLIFKGKSLKEMETPLSALGIQDGCRVMLIGKKN _struct_ref.pdbx_align_begin 73 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WXV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 86 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99933 _struct_ref_seq.db_align_beg 73 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 151 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 86 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WXV GLY A 1 ? UNP Q99933 ? ? 'cloning artifact' 1 1 1 1WXV SER A 2 ? UNP Q99933 ? ? 'cloning artifact' 2 2 1 1WXV SER A 3 ? UNP Q99933 ? ? 'cloning artifact' 3 3 1 1WXV GLY A 4 ? UNP Q99933 ? ? 'cloning artifact' 4 4 1 1WXV SER A 5 ? UNP Q99933 ? ? 'cloning artifact' 5 5 1 1WXV SER A 6 ? UNP Q99933 ? ? 'cloning artifact' 6 6 1 1WXV GLY A 7 ? UNP Q99933 ? ? 'cloning artifact' 7 7 1 1WXV SER A 87 ? UNP Q99933 ? ? 'cloning artifact' 87 8 1 1WXV GLY A 88 ? UNP Q99933 ? ? 'cloning artifact' 88 9 1 1WXV PRO A 89 ? UNP Q99933 ? ? 'cloning artifact' 89 10 1 1WXV SER A 90 ? UNP Q99933 ? ? 'cloning artifact' 90 11 1 1WXV SER A 91 ? UNP Q99933 ? ? 'cloning artifact' 91 12 1 1WXV GLY A 92 ? UNP Q99933 ? ? 'cloning artifact' 92 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.04mM ubiquitin domain U-13C, 15N; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02 % NaN3' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1WXV _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1WXV _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WXV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 200311221 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.913 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guentert, P.' 5 refinement CYANA 2.0.17 'Guentert, P.' 6 # _exptl.entry_id 1WXV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1WXV _struct.title 'Solution structure of the ubiquitin domain of BCL-2 binding athanogene-1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WXV _struct_keywords.pdbx_keywords APOPTOSIS _struct_keywords.text ;structural genomics, apoptosis, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 33 ? ILE A 45 ? VAL A 33 ILE A 45 1 ? 13 HELX_P HELX_P2 2 PRO A 67 ? GLY A 72 ? PRO A 67 GLY A 72 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 18 ? VAL A 23 ? LYS A 18 VAL A 23 A 2 LEU A 8 ? THR A 13 ? LEU A 8 THR A 13 A 3 CYS A 77 ? ILE A 82 ? CYS A 77 ILE A 82 A 4 LYS A 53 ? PHE A 56 ? LYS A 53 PHE A 56 A 5 LYS A 59 ? LEU A 61 ? LYS A 59 LEU A 61 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 23 ? O VAL A 23 N LEU A 8 ? N LEU A 8 A 2 3 N THR A 11 ? N THR A 11 O VAL A 79 ? O VAL A 79 A 3 4 O ILE A 82 ? O ILE A 82 N LYS A 53 ? N LYS A 53 A 4 5 N PHE A 56 ? N PHE A 56 O LYS A 59 ? O LYS A 59 # _database_PDB_matrix.entry_id 1WXV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WXV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 GLY 92 92 92 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-08-02 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 6 ? ? -104.98 -61.66 2 1 HIS A 14 ? ? -130.66 -72.99 3 1 ASN A 16 ? ? 39.51 25.61 4 1 GLN A 26 ? ? -93.58 45.90 5 1 GLN A 27 ? ? 37.24 49.09 6 1 ASP A 75 ? ? -39.35 111.47 7 1 ASN A 86 ? ? -59.05 91.41 8 2 GLN A 26 ? ? -89.26 38.11 9 3 SER A 5 ? ? -43.43 105.35 10 3 SER A 15 ? ? 36.75 49.90 11 3 SER A 25 ? ? -53.34 174.14 12 3 GLN A 26 ? ? -99.57 40.64 13 3 VAL A 44 ? ? -93.89 -60.08 14 3 ASP A 75 ? ? -48.42 107.16 15 4 SER A 2 ? ? -37.44 141.04 16 4 GLN A 26 ? ? -89.68 36.45 17 4 VAL A 44 ? ? -94.26 -63.40 18 4 PRO A 89 ? ? -69.76 2.76 19 5 SER A 6 ? ? -106.41 77.63 20 5 GLN A 26 ? ? -93.15 42.96 21 5 GLN A 27 ? ? 38.63 26.30 22 5 GLN A 35 ? ? -36.96 -38.43 23 5 VAL A 44 ? ? -91.09 -62.06 24 6 SER A 3 ? ? -47.59 153.92 25 6 SER A 25 ? ? -58.88 172.80 26 6 GLN A 26 ? ? -98.13 47.95 27 6 GLN A 27 ? ? 36.65 39.22 28 6 VAL A 44 ? ? -94.24 -60.56 29 7 SER A 5 ? ? -123.60 -51.87 30 7 ASN A 16 ? ? 49.89 28.13 31 7 GLN A 26 ? ? -92.29 38.93 32 7 VAL A 44 ? ? -99.93 -60.81 33 7 LYS A 57 ? ? 70.04 45.45 34 7 ASP A 75 ? ? -51.38 97.82 35 8 SER A 3 ? ? -58.65 172.47 36 8 SER A 5 ? ? -56.95 108.81 37 8 GLN A 26 ? ? -104.96 46.15 38 8 PRO A 89 ? ? -69.74 -167.53 39 8 SER A 90 ? ? -69.34 99.21 40 9 SER A 25 ? ? -57.32 -177.69 41 9 GLN A 26 ? ? -94.71 38.95 42 9 ASP A 75 ? ? -54.69 101.01 43 9 SER A 90 ? ? -163.80 107.00 44 10 SER A 3 ? ? -174.90 135.13 45 10 GLN A 26 ? ? -85.18 36.85 46 10 VAL A 44 ? ? -94.95 -60.44 47 11 GLN A 26 ? ? -88.00 30.01 48 11 GLN A 27 ? ? 48.99 26.80 49 11 VAL A 44 ? ? -93.60 -63.92 50 11 LYS A 84 ? ? -118.90 76.63 51 11 LYS A 85 ? ? -34.24 150.21 52 12 GLN A 26 ? ? -92.87 38.82 53 12 VAL A 44 ? ? -95.77 -61.02 54 12 SER A 91 ? ? 72.79 41.58 55 13 SER A 25 ? ? -68.73 -175.82 56 13 GLN A 26 ? ? -99.74 42.18 57 13 ASP A 75 ? ? -37.06 117.39 58 13 SER A 91 ? ? -37.62 148.10 59 14 GLN A 26 ? ? -99.25 41.86 60 14 PRO A 89 ? ? -69.79 97.81 61 15 SER A 6 ? ? -95.53 38.46 62 15 GLN A 26 ? ? -94.80 41.30 63 15 GLN A 27 ? ? 37.69 37.57 64 15 ASP A 75 ? ? -50.01 102.30 65 15 PRO A 89 ? ? -69.70 2.46 66 15 SER A 90 ? ? 73.64 50.58 67 16 GLN A 26 ? ? -98.86 43.69 68 16 VAL A 44 ? ? -90.95 -60.33 69 16 LEU A 61 ? ? -55.99 100.33 70 16 LYS A 62 ? ? -99.24 -64.75 71 16 ASN A 86 ? ? 33.67 42.13 72 16 SER A 91 ? ? -46.98 104.16 73 17 GLN A 26 ? ? -89.60 34.16 74 17 VAL A 44 ? ? -95.09 -61.45 75 17 ASP A 75 ? ? -45.39 104.85 76 17 PRO A 89 ? ? -69.69 90.84 77 18 SER A 25 ? ? -51.19 179.50 78 18 GLN A 26 ? ? -98.09 37.06 79 18 GLU A 63 ? ? -54.66 109.60 80 18 ASP A 75 ? ? -47.47 103.48 81 18 SER A 87 ? ? -64.62 83.74 82 19 GLN A 26 ? ? -93.74 36.76 83 19 LEU A 61 ? ? -57.65 92.95 84 19 LYS A 62 ? ? -93.73 -62.87 85 19 ASP A 75 ? ? -55.38 105.53 86 20 SER A 25 ? ? -59.65 177.60 87 20 GLN A 26 ? ? -95.20 43.48 88 20 VAL A 44 ? ? -91.34 -62.04 89 20 ASP A 75 ? ? -56.41 108.54 90 20 LYS A 85 ? ? -57.85 105.01 #