data_1WYH # _entry.id 1WYH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WYH pdb_00001wyh 10.2210/pdb1wyh/pdb RCSB RCSB024153 ? ? WWPDB D_1000024153 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002003711.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WYH _pdbx_database_status.recvd_initial_deposition_date 2005-02-14 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Niraula, T.N.' 1 'Tochio, N.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the LIM domain from human Skeletal muscle LIM-protein 2' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Niraula, T.N.' 1 ? primary 'Tochio, N.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Skeletal muscle LIM-protein 2' 7503.283 1 ? ? 'LIM domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SLIM 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFASGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFASGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002003711.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 CYS n 1 9 SER n 1 10 ALA n 1 11 CYS n 1 12 GLY n 1 13 GLU n 1 14 THR n 1 15 VAL n 1 16 MET n 1 17 PRO n 1 18 GLY n 1 19 SER n 1 20 ARG n 1 21 LYS n 1 22 LEU n 1 23 GLU n 1 24 TYR n 1 25 GLY n 1 26 GLY n 1 27 GLN n 1 28 THR n 1 29 TRP n 1 30 HIS n 1 31 GLU n 1 32 HIS n 1 33 CYS n 1 34 PHE n 1 35 LEU n 1 36 CYS n 1 37 SER n 1 38 GLY n 1 39 CYS n 1 40 GLU n 1 41 GLN n 1 42 PRO n 1 43 LEU n 1 44 GLY n 1 45 SER n 1 46 ARG n 1 47 SER n 1 48 PHE n 1 49 VAL n 1 50 PRO n 1 51 ASP n 1 52 LYS n 1 53 GLY n 1 54 ALA n 1 55 HIS n 1 56 TYR n 1 57 CYS n 1 58 VAL n 1 59 PRO n 1 60 CYS n 1 61 TYR n 1 62 GLU n 1 63 ASN n 1 64 LYS n 1 65 PHE n 1 66 ALA n 1 67 SER n 1 68 GLY n 1 69 PRO n 1 70 SER n 1 71 SER n 1 72 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene SLIM2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040830-07 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FHL3_HUMAN _struct_ref.pdbx_db_accession Q13643 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code CSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFA _struct_ref.pdbx_align_begin 101 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WYH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 66 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13643 _struct_ref_seq.db_align_beg 101 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 159 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 66 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WYH GLY A 1 ? UNP Q13643 ? ? 'cloning artifact' 1 1 1 1WYH SER A 2 ? UNP Q13643 ? ? 'cloning artifact' 2 2 1 1WYH SER A 3 ? UNP Q13643 ? ? 'cloning artifact' 3 3 1 1WYH GLY A 4 ? UNP Q13643 ? ? 'cloning artifact' 4 4 1 1WYH SER A 5 ? UNP Q13643 ? ? 'cloning artifact' 5 5 1 1WYH SER A 6 ? UNP Q13643 ? ? 'cloning artifact' 6 6 1 1WYH GLY A 7 ? UNP Q13643 ? ? 'cloning artifact' 7 7 1 1WYH SER A 67 ? UNP Q13643 ? ? 'cloning artifact' 67 8 1 1WYH GLY A 68 ? UNP Q13643 ? ? 'cloning artifact' 68 9 1 1WYH PRO A 69 ? UNP Q13643 ? ? 'cloning artifact' 69 10 1 1WYH SER A 70 ? UNP Q13643 ? ? 'cloning artifact' 70 11 1 1WYH SER A 71 ? UNP Q13643 ? ? 'cloning artifact' 71 12 1 1WYH GLY A 72 ? UNP Q13643 ? ? 'cloning artifact' 72 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 200 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2.09mM LIM domain U-13C, 15N; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.001mM ZnCl2; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1WYH _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1WYH _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WYH _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 200311221 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.913 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guentert, P.' 5 refinement CYANA 2.0.17 'Guentert, P.' 6 # _exptl.entry_id 1WYH _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1WYH _struct.title 'Solution structure of the LIM domain from human Skeletal muscle LIM-protein 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WYH _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;LIM, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id VAL _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 58 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id PHE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 65 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id VAL _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 58 _struct_conf.end_auth_comp_id PHE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 65 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 8 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 8 A ZN 201 1_555 ? ? ? ? ? ? ? 2.377 ? ? metalc2 metalc ? ? A CYS 11 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 11 A ZN 201 1_555 ? ? ? ? ? ? ? 2.299 ? ? metalc3 metalc ? ? A HIS 30 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 30 A ZN 201 1_555 ? ? ? ? ? ? ? 2.321 ? ? metalc4 metalc ? ? A CYS 33 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 33 A ZN 201 1_555 ? ? ? ? ? ? ? 2.298 ? ? metalc5 metalc ? ? A CYS 36 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 36 A ZN 401 1_555 ? ? ? ? ? ? ? 2.378 ? ? metalc6 metalc ? ? A CYS 39 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 39 A ZN 401 1_555 ? ? ? ? ? ? ? 2.313 ? ? metalc7 metalc ? ? A CYS 57 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 57 A ZN 401 1_555 ? ? ? ? ? ? ? 2.276 ? ? metalc8 metalc ? ? A CYS 60 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 60 A ZN 401 1_555 ? ? ? ? ? ? ? 2.319 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 21 ? LEU A 22 ? LYS A 21 LEU A 22 A 2 TRP A 29 ? HIS A 30 ? TRP A 29 HIS A 30 B 1 PHE A 48 ? ASP A 51 ? PHE A 48 ASP A 51 B 2 ALA A 54 ? CYS A 57 ? ALA A 54 CYS A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 22 ? N LEU A 22 O TRP A 29 ? O TRP A 29 B 1 2 N VAL A 49 ? N VAL A 49 O TYR A 56 ? O TYR A 56 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 8 ? CYS A 8 . ? 1_555 ? 2 AC1 4 CYS A 11 ? CYS A 11 . ? 1_555 ? 3 AC1 4 HIS A 30 ? HIS A 30 . ? 1_555 ? 4 AC1 4 CYS A 33 ? CYS A 33 . ? 1_555 ? 5 AC2 4 CYS A 36 ? CYS A 36 . ? 1_555 ? 6 AC2 4 CYS A 39 ? CYS A 39 . ? 1_555 ? 7 AC2 4 CYS A 57 ? CYS A 57 . ? 1_555 ? 8 AC2 4 CYS A 60 ? CYS A 60 . ? 1_555 ? # _database_PDB_matrix.entry_id 1WYH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WYH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLY 72 72 72 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 11 ? A CYS 11 ? 1_555 101.7 ? 2 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 30 ? A HIS 30 ? 1_555 89.9 ? 3 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 30 ? A HIS 30 ? 1_555 111.2 ? 4 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 33 ? A CYS 33 ? 1_555 102.6 ? 5 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 33 ? A CYS 33 ? 1_555 122.1 ? 6 ND1 ? A HIS 30 ? A HIS 30 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 33 ? A CYS 33 ? 1_555 120.5 ? 7 SG ? A CYS 36 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 112.1 ? 8 SG ? A CYS 36 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 57 ? A CYS 57 ? 1_555 118.3 ? 9 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 57 ? A CYS 57 ? 1_555 119.0 ? 10 SG ? A CYS 36 ? A CYS 36 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 95.1 ? 11 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 120.3 ? 12 SG ? A CYS 57 ? A CYS 57 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 60 ? A CYS 60 ? 1_555 87.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-08-14 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 4 'Structure model' '_struct_ref_seq_dif.details' 18 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 6 ? ? -108.08 47.29 2 1 GLU A 13 ? ? -54.29 178.21 3 1 PHE A 34 ? ? -65.73 96.84 4 1 PRO A 42 ? ? -69.80 93.14 5 1 SER A 45 ? ? -131.56 -34.69 6 1 LYS A 52 ? ? -43.35 95.89 7 1 SER A 70 ? ? -39.40 122.49 8 2 GLU A 13 ? ? -51.50 -175.40 9 2 PHE A 34 ? ? -68.75 99.00 10 2 PRO A 42 ? ? -69.79 94.67 11 2 LYS A 52 ? ? -40.34 99.12 12 3 ARG A 20 ? ? -51.76 107.61 13 3 PHE A 34 ? ? -66.36 97.58 14 3 PRO A 42 ? ? -69.73 91.49 15 3 LYS A 52 ? ? -45.74 98.79 16 3 PRO A 69 ? ? -69.77 88.96 17 4 GLU A 13 ? ? -52.25 -176.86 18 4 PHE A 34 ? ? -68.01 99.12 19 4 PRO A 42 ? ? -69.79 93.85 20 4 LYS A 52 ? ? -44.68 97.78 21 4 SER A 67 ? ? 35.85 43.60 22 4 SER A 70 ? ? -41.87 96.40 23 5 SER A 6 ? ? -50.31 108.65 24 5 GLU A 13 ? ? -54.22 177.65 25 5 ARG A 20 ? ? -34.53 117.85 26 5 PHE A 34 ? ? -66.25 98.43 27 5 PRO A 42 ? ? -69.72 95.49 28 5 PRO A 69 ? ? -69.78 -173.95 29 6 GLU A 13 ? ? -53.09 -178.69 30 6 VAL A 15 ? ? -61.35 99.70 31 6 PRO A 17 ? ? -69.79 -168.64 32 6 ARG A 20 ? ? -41.94 107.33 33 6 PHE A 34 ? ? -66.84 98.72 34 6 PRO A 42 ? ? -69.72 96.30 35 6 ASP A 51 ? ? -161.09 118.89 36 6 SER A 70 ? ? -36.47 127.82 37 7 SER A 2 ? ? -34.50 141.78 38 7 SER A 3 ? ? -101.73 42.30 39 7 GLU A 13 ? ? -52.75 176.70 40 7 PHE A 34 ? ? -66.18 93.54 41 7 PRO A 42 ? ? -69.85 95.14 42 7 SER A 45 ? ? -130.74 -38.25 43 7 PRO A 69 ? ? -69.76 0.20 44 8 SER A 6 ? ? -34.84 138.49 45 8 GLU A 13 ? ? -55.72 175.59 46 8 PHE A 34 ? ? -65.57 97.59 47 8 PRO A 42 ? ? -69.82 96.15 48 9 SER A 3 ? ? -64.60 81.71 49 9 GLU A 13 ? ? -57.63 -179.60 50 9 SER A 19 ? ? -170.58 140.09 51 9 PHE A 34 ? ? -67.04 97.61 52 9 PRO A 42 ? ? -69.76 97.01 53 9 ALA A 66 ? ? -86.08 48.17 54 9 SER A 67 ? ? -170.48 142.47 55 9 PRO A 69 ? ? -69.81 79.98 56 10 SER A 2 ? ? -167.35 108.52 57 10 GLU A 13 ? ? -51.81 -178.55 58 10 ARG A 20 ? ? -37.63 107.67 59 10 PHE A 34 ? ? -64.46 95.68 60 10 PRO A 42 ? ? -69.77 92.96 61 10 LYS A 52 ? ? -43.90 100.25 62 10 SER A 67 ? ? -100.27 40.73 63 10 PRO A 69 ? ? -69.76 -177.88 64 11 GLU A 13 ? ? -53.96 176.74 65 11 PHE A 34 ? ? -65.14 96.65 66 11 PRO A 42 ? ? -69.72 90.63 67 11 LYS A 52 ? ? -44.99 99.32 68 11 PRO A 69 ? ? -69.80 86.07 69 12 SER A 5 ? ? -125.64 -59.66 70 12 PHE A 34 ? ? -65.37 95.76 71 12 PRO A 42 ? ? -69.78 93.81 72 12 SER A 67 ? ? -94.46 53.56 73 13 GLU A 13 ? ? -53.11 177.69 74 13 PHE A 34 ? ? -63.08 97.55 75 13 PRO A 42 ? ? -69.78 97.42 76 13 SER A 45 ? ? -130.49 -34.90 77 13 PRO A 69 ? ? -69.81 5.81 78 13 SER A 70 ? ? 74.00 52.10 79 14 GLU A 13 ? ? -53.31 179.44 80 14 PHE A 34 ? ? -63.56 98.01 81 14 PRO A 42 ? ? -69.77 92.58 82 15 PHE A 34 ? ? -64.62 98.29 83 15 PRO A 42 ? ? -69.77 96.09 84 15 ALA A 66 ? ? -95.04 36.64 85 15 PRO A 69 ? ? -69.77 94.03 86 16 SER A 6 ? ? -104.22 -76.23 87 16 GLU A 13 ? ? -57.67 -174.77 88 16 PHE A 34 ? ? -67.59 98.28 89 16 PRO A 42 ? ? -69.84 91.92 90 16 LYS A 52 ? ? -43.30 98.98 91 17 GLU A 13 ? ? -52.62 -179.90 92 17 PHE A 34 ? ? -67.44 97.05 93 17 PRO A 42 ? ? -69.72 94.90 94 17 LYS A 52 ? ? -45.17 99.71 95 17 ALA A 66 ? ? -170.62 124.85 96 18 GLU A 13 ? ? -52.59 179.87 97 18 ARG A 20 ? ? -39.79 119.47 98 18 PHE A 34 ? ? -66.28 95.17 99 18 PRO A 42 ? ? -69.79 91.94 100 19 SER A 6 ? ? -38.76 -76.20 101 19 GLU A 13 ? ? -54.90 -179.63 102 19 ARG A 20 ? ? -35.76 113.11 103 19 PHE A 34 ? ? -66.58 99.41 104 19 PRO A 42 ? ? -69.79 90.30 105 19 LYS A 52 ? ? -42.25 96.07 106 20 SER A 5 ? ? -82.73 42.36 107 20 SER A 6 ? ? -175.13 131.11 108 20 GLU A 13 ? ? -54.47 -178.90 109 20 VAL A 15 ? ? -68.60 98.42 110 20 ARG A 20 ? ? -38.45 121.93 111 20 PHE A 34 ? ? -65.53 98.24 112 20 PRO A 42 ? ? -69.81 96.43 113 20 ASP A 51 ? ? -162.04 114.79 114 20 SER A 67 ? ? 39.53 42.09 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #