data_1WZ0 # _entry.id 1WZ0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WZ0 pdb_00001wz0 10.2210/pdb1wz0/pdb RCSB RCSB024171 ? ? WWPDB D_1000024171 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001000424.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WZ0 _pdbx_database_status.recvd_initial_deposition_date 2005-02-21 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhao, C.' 1 'Saito, K.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution Structure of Human SUMO-2 (SMT3B), a Ubiquitin-like Protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhao, C.' 1 ? primary 'Saito, K.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ubiquitin-like protein SMT3B' _entity.formula_weight 11501.726 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'ubiquitin-like molecule' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Sentrin 2, HSMT3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTP AQLEMEDEDTIDVFQQQTSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTP AQLEMEDEDTIDVFQQQTSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001000424.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 MET n 1 9 ALA n 1 10 ASP n 1 11 GLU n 1 12 LYS n 1 13 PRO n 1 14 LYS n 1 15 GLU n 1 16 GLY n 1 17 VAL n 1 18 LYS n 1 19 THR n 1 20 GLU n 1 21 ASN n 1 22 ASN n 1 23 ASP n 1 24 HIS n 1 25 ILE n 1 26 ASN n 1 27 LEU n 1 28 LYS n 1 29 VAL n 1 30 ALA n 1 31 GLY n 1 32 GLN n 1 33 ASP n 1 34 GLY n 1 35 SER n 1 36 VAL n 1 37 VAL n 1 38 GLN n 1 39 PHE n 1 40 LYS n 1 41 ILE n 1 42 LYS n 1 43 ARG n 1 44 HIS n 1 45 THR n 1 46 PRO n 1 47 LEU n 1 48 SER n 1 49 LYS n 1 50 LEU n 1 51 MET n 1 52 LYS n 1 53 ALA n 1 54 TYR n 1 55 CYS n 1 56 GLU n 1 57 ARG n 1 58 GLN n 1 59 GLY n 1 60 LEU n 1 61 SER n 1 62 MET n 1 63 ARG n 1 64 GLN n 1 65 ILE n 1 66 ARG n 1 67 PHE n 1 68 ARG n 1 69 PHE n 1 70 ASP n 1 71 GLY n 1 72 GLN n 1 73 PRO n 1 74 ILE n 1 75 ASN n 1 76 GLU n 1 77 THR n 1 78 ASP n 1 79 THR n 1 80 PRO n 1 81 ALA n 1 82 GLN n 1 83 LEU n 1 84 GLU n 1 85 MET n 1 86 GLU n 1 87 ASP n 1 88 GLU n 1 89 ASP n 1 90 THR n 1 91 ILE n 1 92 ASP n 1 93 VAL n 1 94 PHE n 1 95 GLN n 1 96 GLN n 1 97 GLN n 1 98 THR n 1 99 SER n 1 100 GLY n 1 101 PRO n 1 102 SER n 1 103 SER n 1 104 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene SMT3B _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040510-09 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SUMO2_HUMAN _struct_ref.pdbx_db_accession P61956 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMED EDTIDVFQQQT ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WZ0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 98 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P61956 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 91 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 98 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WZ0 GLY A 1 ? UNP P61956 ? ? 'cloning artifact' 1 1 1 1WZ0 SER A 2 ? UNP P61956 ? ? 'cloning artifact' 2 2 1 1WZ0 SER A 3 ? UNP P61956 ? ? 'cloning artifact' 3 3 1 1WZ0 GLY A 4 ? UNP P61956 ? ? 'cloning artifact' 4 4 1 1WZ0 SER A 5 ? UNP P61956 ? ? 'cloning artifact' 5 5 1 1WZ0 SER A 6 ? UNP P61956 ? ? 'cloning artifact' 6 6 1 1WZ0 GLY A 7 ? UNP P61956 ? ? 'cloning artifact' 7 7 1 1WZ0 SER A 99 ? UNP P61956 ? ? 'cloning artifact' 99 8 1 1WZ0 GLY A 100 ? UNP P61956 ? ? 'cloning artifact' 100 9 1 1WZ0 PRO A 101 ? UNP P61956 ? ? 'cloning artifact' 101 10 1 1WZ0 SER A 102 ? UNP P61956 ? ? 'cloning artifact' 102 11 1 1WZ0 SER A 103 ? UNP P61956 ? ? 'cloning artifact' 103 12 1 1WZ0 GLY A 104 ? UNP P61956 ? ? 'cloning artifact' 104 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.21mM protein U-15N, 13C; 20mM d-Tris-HCl (pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1WZ0 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1WZ0 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WZ0 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20020425 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.921 'Kobayashi, N.' 4 'structure solution' CYANA 1.0.8 'Guentert, P.' 5 refinement CYANA 1.0.8 'Guentert, P.' 6 # _exptl.entry_id 1WZ0 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1WZ0 _struct.title 'Solution Structure of Human SUMO-2 (SMT3B), a Ubiquitin-like Protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WZ0 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;SUMO-2, ubiquitin-like molecule, Structural genomics, Sentrin2, NPPFSA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id LEU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 47 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 58 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LEU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 47 _struct_conf.end_auth_comp_id GLN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 58 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 36 ? ILE A 41 ? VAL A 36 ILE A 41 A 2 ILE A 25 ? ALA A 30 ? ILE A 25 ALA A 30 A 3 ASP A 89 ? VAL A 93 ? ASP A 89 VAL A 93 A 4 PHE A 67 ? PHE A 69 ? PHE A 67 PHE A 69 A 5 GLN A 72 ? PRO A 73 ? GLN A 72 PRO A 73 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 37 ? O VAL A 37 N VAL A 29 ? N VAL A 29 A 2 3 N LYS A 28 ? N LYS A 28 O ASP A 89 ? O ASP A 89 A 3 4 O ASP A 92 ? O ASP A 92 N ARG A 68 ? N ARG A 68 # _database_PDB_matrix.entry_id 1WZ0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WZ0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 GLY 104 104 104 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-08-21 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; 700 ;SHEET DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 13 ? ? -69.75 90.57 2 1 ASN A 22 ? ? -83.63 42.88 3 1 LEU A 47 ? ? -48.29 -19.44 4 2 PRO A 13 ? ? -69.81 0.06 5 2 LYS A 18 ? ? -113.39 60.25 6 2 THR A 19 ? ? 34.54 46.56 7 2 ASP A 33 ? ? -86.71 49.01 8 2 HIS A 44 ? ? -98.29 37.98 9 2 MET A 85 ? ? -61.57 99.60 10 3 ALA A 9 ? ? -171.21 123.14 11 3 GLU A 11 ? ? -102.87 49.29 12 3 LYS A 12 ? ? 34.33 54.03 13 3 PRO A 13 ? ? -69.79 0.40 14 3 ASP A 33 ? ? -83.69 31.51 15 3 HIS A 44 ? ? -95.43 41.23 16 3 MET A 85 ? ? -57.42 99.94 17 3 THR A 98 ? ? -38.02 117.12 18 4 GLU A 11 ? ? -93.76 59.00 19 4 PRO A 13 ? ? -69.75 80.52 20 4 ASN A 22 ? ? -91.10 51.51 21 4 GLN A 32 ? ? -49.11 176.26 22 5 PRO A 13 ? ? -69.78 1.89 23 5 ASP A 33 ? ? 72.54 44.10 24 5 LEU A 47 ? ? -49.41 -19.28 25 5 MET A 85 ? ? -37.05 119.21 26 5 ASP A 89 ? ? -68.24 -174.99 27 5 GLN A 97 ? ? -39.13 125.57 28 5 SER A 102 ? ? -36.07 118.60 29 6 GLU A 11 ? ? -91.38 42.29 30 6 LYS A 12 ? ? 36.98 53.70 31 6 ASP A 23 ? ? 73.83 31.54 32 6 SER A 35 ? ? -58.68 177.48 33 6 MET A 85 ? ? -51.18 106.74 34 6 ASP A 89 ? ? -66.15 -175.25 35 7 ASP A 10 ? ? -83.09 46.54 36 7 GLU A 86 ? ? -94.80 -71.20 37 7 GLU A 88 ? ? 43.26 29.51 38 8 ALA A 9 ? ? -105.35 -60.88 39 8 GLU A 11 ? ? -86.51 39.66 40 8 GLU A 86 ? ? -107.17 -74.47 41 8 GLU A 88 ? ? 39.70 27.05 42 8 ASP A 89 ? ? -62.95 -175.03 43 9 PRO A 13 ? ? -69.77 0.61 44 9 LYS A 14 ? ? -91.58 46.52 45 9 THR A 19 ? ? -132.59 -43.65 46 9 ASN A 21 ? ? -34.52 142.22 47 9 HIS A 44 ? ? -87.05 37.12 48 9 SER A 99 ? ? -170.38 134.05 49 9 PRO A 101 ? ? -69.81 3.80 50 9 SER A 102 ? ? -33.56 122.38 51 10 ASP A 10 ? ? -90.90 45.51 52 10 THR A 19 ? ? 38.95 50.96 53 10 ASN A 21 ? ? -43.25 161.90 54 10 GLN A 32 ? ? 38.56 34.49 55 10 ASP A 89 ? ? -66.91 -177.26 56 10 SER A 99 ? ? -104.92 47.80 57 10 SER A 102 ? ? 37.63 46.73 58 11 GLU A 11 ? ? -104.53 40.48 59 11 GLN A 32 ? ? -84.31 48.22 60 11 SER A 35 ? ? -170.39 123.98 61 12 PRO A 13 ? ? -69.79 0.50 62 12 ASN A 22 ? ? -85.12 49.48 63 12 ASP A 33 ? ? -83.89 31.39 64 12 ASP A 78 ? ? -48.17 155.95 65 12 MET A 85 ? ? -58.28 98.44 66 12 GLU A 86 ? ? -62.69 -178.24 67 12 GLU A 88 ? ? 36.29 38.22 68 12 GLN A 97 ? ? -35.53 109.56 69 13 ALA A 9 ? ? -99.66 40.03 70 13 LYS A 14 ? ? -40.18 159.00 71 13 VAL A 17 ? ? -173.59 137.16 72 13 THR A 19 ? ? -174.15 110.66 73 13 GLU A 86 ? ? -87.34 -74.23 74 13 GLU A 88 ? ? 42.83 29.63 75 13 SER A 102 ? ? -99.11 41.41 76 13 SER A 103 ? ? 71.93 42.18 77 14 PRO A 13 ? ? -69.78 1.18 78 14 ASN A 21 ? ? -63.14 88.57 79 14 HIS A 24 ? ? -54.92 178.66 80 14 HIS A 44 ? ? -94.06 36.14 81 14 LEU A 47 ? ? -48.86 -18.87 82 14 ASP A 70 ? ? 42.87 28.57 83 14 GLU A 86 ? ? -109.07 -75.33 84 14 GLU A 88 ? ? 39.61 25.26 85 14 ASP A 89 ? ? -63.70 -174.76 86 15 SER A 5 ? ? -161.68 111.06 87 15 GLU A 11 ? ? -84.14 46.14 88 15 ASP A 33 ? ? -83.63 43.07 89 15 HIS A 44 ? ? -105.62 40.71 90 15 GLU A 88 ? ? 43.45 25.01 91 15 SER A 103 ? ? -121.12 -59.00 92 16 ASP A 33 ? ? -90.78 47.75 93 16 ASP A 89 ? ? -58.97 -175.78 94 16 GLN A 97 ? ? -111.19 52.18 95 16 SER A 99 ? ? -175.02 144.95 96 17 LYS A 14 ? ? -45.33 156.73 97 17 ASN A 22 ? ? -38.00 145.71 98 17 ASP A 33 ? ? -78.58 40.11 99 17 MET A 85 ? ? -66.61 98.56 100 17 ASP A 89 ? ? -66.94 -174.91 101 17 PRO A 101 ? ? -69.79 97.86 102 17 SER A 102 ? ? -88.32 41.24 103 18 GLU A 11 ? ? -101.22 41.99 104 18 LYS A 12 ? ? 35.34 53.31 105 18 PRO A 13 ? ? -69.73 84.12 106 18 GLU A 88 ? ? 39.32 25.41 107 18 ASP A 89 ? ? -62.06 -175.46 108 18 SER A 99 ? ? 36.97 38.11 109 19 SER A 6 ? ? -48.97 173.40 110 19 LYS A 14 ? ? -174.79 141.26 111 19 GLN A 32 ? ? -45.08 170.43 112 20 SER A 2 ? ? -170.55 138.12 113 20 SER A 6 ? ? -120.77 -54.27 114 20 LYS A 14 ? ? -172.00 138.62 115 20 ASP A 33 ? ? -79.10 39.15 116 20 ASP A 89 ? ? -66.16 -175.97 117 20 PRO A 101 ? ? -69.79 0.92 #