data_1X48 # _entry.id 1X48 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1X48 pdb_00001x48 10.2210/pdb1x48/pdb RCSB RCSB024358 ? ? WWPDB D_1000024358 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-14 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1X48 _pdbx_database_status.recvd_initial_deposition_date 2005-05-14 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmt008000608.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'He, F.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Tarada, T.' 4 'Shirouzu, M.' 5 'Kigawa, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the second DSRM domain in Interferon-induced, double-stranded RNA-activated protein kinase' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, F.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Tarada, T.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Kigawa, T.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Interferon-induced, double-stranded RNA-activated protein kinase' _entity.formula_weight 9274.507 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.1.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'DSRM domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Interferon-inducible RNA-dependent protein kinase, p68 kinase, P1/eIF-2A protein kinase, Serine/threonine-protein kinase TIK' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGYIGLVNSFAQKKKLSVNYEQCEPNSELPQRFICKCKIGQTMYGTGSGVTKQEAKQLAAKEAYQKLLKSPPKTA GTSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGYIGLVNSFAQKKKLSVNYEQCEPNSELPQRFICKCKIGQTMYGTGSGVTKQEAKQLAAKEAYQKLLKSPPKTA GTSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmt008000608.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 TYR n 1 9 ILE n 1 10 GLY n 1 11 LEU n 1 12 VAL n 1 13 ASN n 1 14 SER n 1 15 PHE n 1 16 ALA n 1 17 GLN n 1 18 LYS n 1 19 LYS n 1 20 LYS n 1 21 LEU n 1 22 SER n 1 23 VAL n 1 24 ASN n 1 25 TYR n 1 26 GLU n 1 27 GLN n 1 28 CYS n 1 29 GLU n 1 30 PRO n 1 31 ASN n 1 32 SER n 1 33 GLU n 1 34 LEU n 1 35 PRO n 1 36 GLN n 1 37 ARG n 1 38 PHE n 1 39 ILE n 1 40 CYS n 1 41 LYS n 1 42 CYS n 1 43 LYS n 1 44 ILE n 1 45 GLY n 1 46 GLN n 1 47 THR n 1 48 MET n 1 49 TYR n 1 50 GLY n 1 51 THR n 1 52 GLY n 1 53 SER n 1 54 GLY n 1 55 VAL n 1 56 THR n 1 57 LYS n 1 58 GLN n 1 59 GLU n 1 60 ALA n 1 61 LYS n 1 62 GLN n 1 63 LEU n 1 64 ALA n 1 65 ALA n 1 66 LYS n 1 67 GLU n 1 68 ALA n 1 69 TYR n 1 70 GLN n 1 71 LYS n 1 72 LEU n 1 73 LEU n 1 74 LYS n 1 75 SER n 1 76 PRO n 1 77 PRO n 1 78 LYS n 1 79 THR n 1 80 ALA n 1 81 GLY n 1 82 THR n 1 83 SER n 1 84 GLY n 1 85 PRO n 1 86 SER n 1 87 SER n 1 88 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene 'Prkr, Eif2ak2, Pkr, Tik' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040712-16 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 GLY 88 88 88 GLY GLY A . n # _exptl.entry_id 1X48 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1X48 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1X48 _struct.title 'Solution structure of the second DSRM domain in Interferon-induced, double-stranded RNA-activated protein kinase' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1X48 _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text ;structure genomics, DSRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code E2AK2_MOUSE _struct_ref.pdbx_db_accession Q03963 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code YIGLVNSFAQKKKLSVNYEQCEPNSELPQRFICKCKIGQTMYGTGSGVTKQEAKQLAAKEAYQKLLKSPPKTAGT _struct_ref.pdbx_align_begin 96 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1X48 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q03963 _struct_ref_seq.db_align_beg 96 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 170 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 82 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1X48 GLY A 1 ? UNP Q03963 ? ? 'cloning artifact' 1 1 1 1X48 SER A 2 ? UNP Q03963 ? ? 'cloning artifact' 2 2 1 1X48 SER A 3 ? UNP Q03963 ? ? 'cloning artifact' 3 3 1 1X48 GLY A 4 ? UNP Q03963 ? ? 'cloning artifact' 4 4 1 1X48 SER A 5 ? UNP Q03963 ? ? 'cloning artifact' 5 5 1 1X48 SER A 6 ? UNP Q03963 ? ? 'cloning artifact' 6 6 1 1X48 GLY A 7 ? UNP Q03963 ? ? 'cloning artifact' 7 7 1 1X48 SER A 83 ? UNP Q03963 ? ? 'cloning artifact' 83 8 1 1X48 GLY A 84 ? UNP Q03963 ? ? 'cloning artifact' 84 9 1 1X48 PRO A 85 ? UNP Q03963 ? ? 'cloning artifact' 85 10 1 1X48 SER A 86 ? UNP Q03963 ? ? 'cloning artifact' 86 11 1 1X48 SER A 87 ? UNP Q03963 ? ? 'cloning artifact' 87 12 1 1X48 GLY A 88 ? UNP Q03963 ? ? 'cloning artifact' 88 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 8 ? LYS A 18 ? TYR A 8 LYS A 18 1 ? 11 HELX_P HELX_P2 2 LYS A 57 ? LYS A 74 ? LYS A 57 LYS A 74 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 1 -0.22 2 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 2 -0.10 3 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 3 -0.15 4 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 4 -0.11 5 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 5 -0.17 6 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 6 -0.13 7 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 7 -0.13 8 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 8 -0.12 9 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 9 -0.14 10 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 10 -0.15 11 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 11 -0.14 12 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 12 -0.07 13 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 13 -0.11 14 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 14 -0.15 15 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 15 -0.16 16 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 16 -0.17 17 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 17 -0.04 18 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 18 -0.06 19 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 19 -0.13 20 LEU 34 A . ? LEU 34 A PRO 35 A ? PRO 35 A 20 -0.14 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 23 ? GLN A 27 ? VAL A 23 GLN A 27 A 2 PHE A 38 ? ILE A 44 ? PHE A 38 ILE A 44 A 3 MET A 48 ? GLY A 54 ? MET A 48 GLY A 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASN A 24 ? N ASN A 24 O LYS A 43 ? O LYS A 43 A 2 3 N CYS A 40 ? N CYS A 40 O GLY A 52 ? O GLY A 52 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 20 ? ? 39.56 39.83 2 1 GLU A 33 ? ? -39.05 -70.85 3 1 PRO A 35 ? ? -69.73 -179.60 4 1 ALA A 60 ? ? -69.00 -72.75 5 1 LYS A 78 ? ? -47.34 101.47 6 2 SER A 3 ? ? -46.94 150.36 7 2 SER A 5 ? ? -93.67 45.09 8 2 GLN A 62 ? ? -61.11 -72.84 9 2 LYS A 74 ? ? -81.56 -74.39 10 2 ALA A 80 ? ? -173.34 141.77 11 3 SER A 2 ? ? -133.18 -50.75 12 3 ILE A 9 ? ? -34.04 -39.40 13 3 CYS A 28 ? ? -50.83 -179.36 14 3 GLN A 62 ? ? -50.67 -72.47 15 4 ILE A 9 ? ? -34.33 -39.21 16 4 PRO A 30 ? ? -69.74 -163.98 17 4 ASN A 31 ? ? -55.96 178.14 18 4 TYR A 49 ? ? -121.79 -59.94 19 4 GLN A 62 ? ? -38.87 -70.19 20 4 LYS A 78 ? ? -55.84 88.84 21 4 THR A 82 ? ? -57.63 170.44 22 5 SER A 3 ? ? -88.32 49.15 23 5 SER A 6 ? ? -110.25 57.60 24 5 ASN A 13 ? ? -35.68 -39.46 25 5 GLN A 62 ? ? -82.93 -70.42 26 5 ALA A 64 ? ? -36.12 -30.04 27 5 SER A 86 ? ? -41.09 107.77 28 6 ILE A 9 ? ? -33.96 -35.45 29 6 GLU A 33 ? ? -35.28 121.26 30 6 LYS A 61 ? ? -38.70 -28.77 31 6 GLN A 62 ? ? -70.83 -70.44 32 7 ILE A 9 ? ? -34.47 -39.10 33 7 GLU A 33 ? ? -171.73 125.84 34 7 GLN A 46 ? ? 47.26 25.00 35 7 ALA A 60 ? ? -69.60 -71.27 36 7 GLN A 62 ? ? -57.25 -72.06 37 7 SER A 87 ? ? -97.77 -60.09 38 8 ASN A 13 ? ? -34.61 -72.09 39 8 CYS A 28 ? ? -38.36 157.48 40 8 PRO A 30 ? ? -69.77 -166.47 41 8 SER A 32 ? ? -133.16 -39.55 42 8 PRO A 35 ? ? -69.76 -178.96 43 8 ALA A 60 ? ? -65.17 -72.64 44 8 LYS A 61 ? ? -36.87 -31.54 45 8 ALA A 64 ? ? -39.02 -37.49 46 8 LYS A 78 ? ? 34.40 47.61 47 8 THR A 82 ? ? 39.83 40.32 48 9 SER A 6 ? ? -173.52 130.42 49 9 ASN A 31 ? ? -37.31 -31.42 50 9 SER A 32 ? ? -97.81 -65.92 51 9 GLN A 36 ? ? -38.29 96.94 52 9 PRO A 85 ? ? -69.77 90.57 53 10 TYR A 49 ? ? -121.57 -60.27 54 10 ALA A 60 ? ? -74.92 -71.96 55 10 GLN A 62 ? ? -78.46 -72.62 56 10 SER A 87 ? ? -92.04 41.72 57 11 ILE A 9 ? ? -34.71 -38.99 58 11 ASN A 31 ? ? -103.79 69.32 59 11 TYR A 49 ? ? -106.19 -60.81 60 11 ALA A 64 ? ? -34.65 -36.09 61 11 PRO A 85 ? ? -69.79 97.66 62 11 SER A 86 ? ? 34.38 42.53 63 12 ILE A 9 ? ? -37.46 -38.20 64 12 SER A 32 ? ? -92.64 38.66 65 12 TYR A 49 ? ? -104.90 -62.94 66 12 LYS A 61 ? ? -38.63 -29.27 67 12 THR A 79 ? ? -82.92 44.02 68 12 SER A 83 ? ? -171.31 125.11 69 12 PRO A 85 ? ? -69.72 94.93 70 13 SER A 6 ? ? -110.53 -70.34 71 13 TYR A 49 ? ? -121.20 -58.88 72 13 GLN A 62 ? ? -63.46 -71.22 73 13 ALA A 64 ? ? -33.91 -39.73 74 13 PRO A 85 ? ? -69.73 -177.79 75 13 SER A 86 ? ? -131.75 -47.02 76 14 TYR A 8 ? ? -39.64 -28.60 77 14 PRO A 30 ? ? -69.72 92.17 78 14 ASN A 31 ? ? -102.50 46.70 79 14 ALA A 80 ? ? -94.12 55.53 80 15 SER A 32 ? ? -91.87 30.42 81 15 GLN A 62 ? ? -58.41 -70.51 82 15 ALA A 64 ? ? -36.23 -38.93 83 15 PRO A 77 ? ? -69.75 -173.91 84 15 PRO A 85 ? ? -69.78 -175.41 85 15 SER A 87 ? ? -91.91 42.14 86 16 ILE A 9 ? ? -34.26 -38.99 87 16 ASN A 13 ? ? -34.88 -35.71 88 16 CYS A 28 ? ? -43.82 155.89 89 16 PRO A 30 ? ? -69.70 2.91 90 16 ASN A 31 ? ? -34.32 125.80 91 16 SER A 32 ? ? -66.34 97.75 92 16 PRO A 35 ? ? -69.74 -178.81 93 16 LYS A 66 ? ? -35.96 -36.58 94 16 LYS A 71 ? ? -38.91 -39.77 95 17 CYS A 28 ? ? -47.67 153.80 96 18 ILE A 9 ? ? -33.70 -39.84 97 18 TYR A 49 ? ? -108.58 -62.52 98 19 SER A 2 ? ? -56.27 87.17 99 19 SER A 6 ? ? -67.50 94.13 100 20 SER A 2 ? ? -69.29 80.51 101 20 SER A 3 ? ? -59.33 109.84 102 20 PHE A 15 ? ? -47.25 -70.54 103 20 GLN A 62 ? ? -66.84 -72.78 104 20 ALA A 64 ? ? -33.72 -33.86 105 20 LYS A 74 ? ? -71.01 -71.65 106 20 LYS A 78 ? ? -174.84 125.04 107 20 SER A 83 ? ? -81.07 42.03 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; # _pdbx_nmr_ensemble.entry_id 1X48 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1X48 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20mM phosphate buffer NA; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 1X48 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20031121 Delaglio,F. 2 'data analysis' NMRView 5.0.4 Johnson,B.A. 3 'data analysis' KUJIRA 0.863 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntert,P. 5 refinement CYANA 2.0.17 Guntert,P. 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLU N N N N 92 GLU CA C N S 93 GLU C C N N 94 GLU O O N N 95 GLU CB C N N 96 GLU CG C N N 97 GLU CD C N N 98 GLU OE1 O N N 99 GLU OE2 O N N 100 GLU OXT O N N 101 GLU H H N N 102 GLU H2 H N N 103 GLU HA H N N 104 GLU HB2 H N N 105 GLU HB3 H N N 106 GLU HG2 H N N 107 GLU HG3 H N N 108 GLU HE2 H N N 109 GLU HXT H N N 110 GLY N N N N 111 GLY CA C N N 112 GLY C C N N 113 GLY O O N N 114 GLY OXT O N N 115 GLY H H N N 116 GLY H2 H N N 117 GLY HA2 H N N 118 GLY HA3 H N N 119 GLY HXT H N N 120 ILE N N N N 121 ILE CA C N S 122 ILE C C N N 123 ILE O O N N 124 ILE CB C N S 125 ILE CG1 C N N 126 ILE CG2 C N N 127 ILE CD1 C N N 128 ILE OXT O N N 129 ILE H H N N 130 ILE H2 H N N 131 ILE HA H N N 132 ILE HB H N N 133 ILE HG12 H N N 134 ILE HG13 H N N 135 ILE HG21 H N N 136 ILE HG22 H N N 137 ILE HG23 H N N 138 ILE HD11 H N N 139 ILE HD12 H N N 140 ILE HD13 H N N 141 ILE HXT H N N 142 LEU N N N N 143 LEU CA C N S 144 LEU C C N N 145 LEU O O N N 146 LEU CB C N N 147 LEU CG C N N 148 LEU CD1 C N N 149 LEU CD2 C N N 150 LEU OXT O N N 151 LEU H H N N 152 LEU H2 H N N 153 LEU HA H N N 154 LEU HB2 H N N 155 LEU HB3 H N N 156 LEU HG H N N 157 LEU HD11 H N N 158 LEU HD12 H N N 159 LEU HD13 H N N 160 LEU HD21 H N N 161 LEU HD22 H N N 162 LEU HD23 H N N 163 LEU HXT H N N 164 LYS N N N N 165 LYS CA C N S 166 LYS C C N N 167 LYS O O N N 168 LYS CB C N N 169 LYS CG C N N 170 LYS CD C N N 171 LYS CE C N N 172 LYS NZ N N N 173 LYS OXT O N N 174 LYS H H N N 175 LYS H2 H N N 176 LYS HA H N N 177 LYS HB2 H N N 178 LYS HB3 H N N 179 LYS HG2 H N N 180 LYS HG3 H N N 181 LYS HD2 H N N 182 LYS HD3 H N N 183 LYS HE2 H N N 184 LYS HE3 H N N 185 LYS HZ1 H N N 186 LYS HZ2 H N N 187 LYS HZ3 H N N 188 LYS HXT H N N 189 MET N N N N 190 MET CA C N S 191 MET C C N N 192 MET O O N N 193 MET CB C N N 194 MET CG C N N 195 MET SD S N N 196 MET CE C N N 197 MET OXT O N N 198 MET H H N N 199 MET H2 H N N 200 MET HA H N N 201 MET HB2 H N N 202 MET HB3 H N N 203 MET HG2 H N N 204 MET HG3 H N N 205 MET HE1 H N N 206 MET HE2 H N N 207 MET HE3 H N N 208 MET HXT H N N 209 PHE N N N N 210 PHE CA C N S 211 PHE C C N N 212 PHE O O N N 213 PHE CB C N N 214 PHE CG C Y N 215 PHE CD1 C Y N 216 PHE CD2 C Y N 217 PHE CE1 C Y N 218 PHE CE2 C Y N 219 PHE CZ C Y N 220 PHE OXT O N N 221 PHE H H N N 222 PHE H2 H N N 223 PHE HA H N N 224 PHE HB2 H N N 225 PHE HB3 H N N 226 PHE HD1 H N N 227 PHE HD2 H N N 228 PHE HE1 H N N 229 PHE HE2 H N N 230 PHE HZ H N N 231 PHE HXT H N N 232 PRO N N N N 233 PRO CA C N S 234 PRO C C N N 235 PRO O O N N 236 PRO CB C N N 237 PRO CG C N N 238 PRO CD C N N 239 PRO OXT O N N 240 PRO H H N N 241 PRO HA H N N 242 PRO HB2 H N N 243 PRO HB3 H N N 244 PRO HG2 H N N 245 PRO HG3 H N N 246 PRO HD2 H N N 247 PRO HD3 H N N 248 PRO HXT H N N 249 SER N N N N 250 SER CA C N S 251 SER C C N N 252 SER O O N N 253 SER CB C N N 254 SER OG O N N 255 SER OXT O N N 256 SER H H N N 257 SER H2 H N N 258 SER HA H N N 259 SER HB2 H N N 260 SER HB3 H N N 261 SER HG H N N 262 SER HXT H N N 263 THR N N N N 264 THR CA C N S 265 THR C C N N 266 THR O O N N 267 THR CB C N R 268 THR OG1 O N N 269 THR CG2 C N N 270 THR OXT O N N 271 THR H H N N 272 THR H2 H N N 273 THR HA H N N 274 THR HB H N N 275 THR HG1 H N N 276 THR HG21 H N N 277 THR HG22 H N N 278 THR HG23 H N N 279 THR HXT H N N 280 TYR N N N N 281 TYR CA C N S 282 TYR C C N N 283 TYR O O N N 284 TYR CB C N N 285 TYR CG C Y N 286 TYR CD1 C Y N 287 TYR CD2 C Y N 288 TYR CE1 C Y N 289 TYR CE2 C Y N 290 TYR CZ C Y N 291 TYR OH O N N 292 TYR OXT O N N 293 TYR H H N N 294 TYR H2 H N N 295 TYR HA H N N 296 TYR HB2 H N N 297 TYR HB3 H N N 298 TYR HD1 H N N 299 TYR HD2 H N N 300 TYR HE1 H N N 301 TYR HE2 H N N 302 TYR HH H N N 303 TYR HXT H N N 304 VAL N N N N 305 VAL CA C N S 306 VAL C C N N 307 VAL O O N N 308 VAL CB C N N 309 VAL CG1 C N N 310 VAL CG2 C N N 311 VAL OXT O N N 312 VAL H H N N 313 VAL H2 H N N 314 VAL HA H N N 315 VAL HB H N N 316 VAL HG11 H N N 317 VAL HG12 H N N 318 VAL HG13 H N N 319 VAL HG21 H N N 320 VAL HG22 H N N 321 VAL HG23 H N N 322 VAL HXT H N N 323 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLN N CA sing N N 68 GLN N H sing N N 69 GLN N H2 sing N N 70 GLN CA C sing N N 71 GLN CA CB sing N N 72 GLN CA HA sing N N 73 GLN C O doub N N 74 GLN C OXT sing N N 75 GLN CB CG sing N N 76 GLN CB HB2 sing N N 77 GLN CB HB3 sing N N 78 GLN CG CD sing N N 79 GLN CG HG2 sing N N 80 GLN CG HG3 sing N N 81 GLN CD OE1 doub N N 82 GLN CD NE2 sing N N 83 GLN NE2 HE21 sing N N 84 GLN NE2 HE22 sing N N 85 GLN OXT HXT sing N N 86 GLU N CA sing N N 87 GLU N H sing N N 88 GLU N H2 sing N N 89 GLU CA C sing N N 90 GLU CA CB sing N N 91 GLU CA HA sing N N 92 GLU C O doub N N 93 GLU C OXT sing N N 94 GLU CB CG sing N N 95 GLU CB HB2 sing N N 96 GLU CB HB3 sing N N 97 GLU CG CD sing N N 98 GLU CG HG2 sing N N 99 GLU CG HG3 sing N N 100 GLU CD OE1 doub N N 101 GLU CD OE2 sing N N 102 GLU OE2 HE2 sing N N 103 GLU OXT HXT sing N N 104 GLY N CA sing N N 105 GLY N H sing N N 106 GLY N H2 sing N N 107 GLY CA C sing N N 108 GLY CA HA2 sing N N 109 GLY CA HA3 sing N N 110 GLY C O doub N N 111 GLY C OXT sing N N 112 GLY OXT HXT sing N N 113 ILE N CA sing N N 114 ILE N H sing N N 115 ILE N H2 sing N N 116 ILE CA C sing N N 117 ILE CA CB sing N N 118 ILE CA HA sing N N 119 ILE C O doub N N 120 ILE C OXT sing N N 121 ILE CB CG1 sing N N 122 ILE CB CG2 sing N N 123 ILE CB HB sing N N 124 ILE CG1 CD1 sing N N 125 ILE CG1 HG12 sing N N 126 ILE CG1 HG13 sing N N 127 ILE CG2 HG21 sing N N 128 ILE CG2 HG22 sing N N 129 ILE CG2 HG23 sing N N 130 ILE CD1 HD11 sing N N 131 ILE CD1 HD12 sing N N 132 ILE CD1 HD13 sing N N 133 ILE OXT HXT sing N N 134 LEU N CA sing N N 135 LEU N H sing N N 136 LEU N H2 sing N N 137 LEU CA C sing N N 138 LEU CA CB sing N N 139 LEU CA HA sing N N 140 LEU C O doub N N 141 LEU C OXT sing N N 142 LEU CB CG sing N N 143 LEU CB HB2 sing N N 144 LEU CB HB3 sing N N 145 LEU CG CD1 sing N N 146 LEU CG CD2 sing N N 147 LEU CG HG sing N N 148 LEU CD1 HD11 sing N N 149 LEU CD1 HD12 sing N N 150 LEU CD1 HD13 sing N N 151 LEU CD2 HD21 sing N N 152 LEU CD2 HD22 sing N N 153 LEU CD2 HD23 sing N N 154 LEU OXT HXT sing N N 155 LYS N CA sing N N 156 LYS N H sing N N 157 LYS N H2 sing N N 158 LYS CA C sing N N 159 LYS CA CB sing N N 160 LYS CA HA sing N N 161 LYS C O doub N N 162 LYS C OXT sing N N 163 LYS CB CG sing N N 164 LYS CB HB2 sing N N 165 LYS CB HB3 sing N N 166 LYS CG CD sing N N 167 LYS CG HG2 sing N N 168 LYS CG HG3 sing N N 169 LYS CD CE sing N N 170 LYS CD HD2 sing N N 171 LYS CD HD3 sing N N 172 LYS CE NZ sing N N 173 LYS CE HE2 sing N N 174 LYS CE HE3 sing N N 175 LYS NZ HZ1 sing N N 176 LYS NZ HZ2 sing N N 177 LYS NZ HZ3 sing N N 178 LYS OXT HXT sing N N 179 MET N CA sing N N 180 MET N H sing N N 181 MET N H2 sing N N 182 MET CA C sing N N 183 MET CA CB sing N N 184 MET CA HA sing N N 185 MET C O doub N N 186 MET C OXT sing N N 187 MET CB CG sing N N 188 MET CB HB2 sing N N 189 MET CB HB3 sing N N 190 MET CG SD sing N N 191 MET CG HG2 sing N N 192 MET CG HG3 sing N N 193 MET SD CE sing N N 194 MET CE HE1 sing N N 195 MET CE HE2 sing N N 196 MET CE HE3 sing N N 197 MET OXT HXT sing N N 198 PHE N CA sing N N 199 PHE N H sing N N 200 PHE N H2 sing N N 201 PHE CA C sing N N 202 PHE CA CB sing N N 203 PHE CA HA sing N N 204 PHE C O doub N N 205 PHE C OXT sing N N 206 PHE CB CG sing N N 207 PHE CB HB2 sing N N 208 PHE CB HB3 sing N N 209 PHE CG CD1 doub Y N 210 PHE CG CD2 sing Y N 211 PHE CD1 CE1 sing Y N 212 PHE CD1 HD1 sing N N 213 PHE CD2 CE2 doub Y N 214 PHE CD2 HD2 sing N N 215 PHE CE1 CZ doub Y N 216 PHE CE1 HE1 sing N N 217 PHE CE2 CZ sing Y N 218 PHE CE2 HE2 sing N N 219 PHE CZ HZ sing N N 220 PHE OXT HXT sing N N 221 PRO N CA sing N N 222 PRO N CD sing N N 223 PRO N H sing N N 224 PRO CA C sing N N 225 PRO CA CB sing N N 226 PRO CA HA sing N N 227 PRO C O doub N N 228 PRO C OXT sing N N 229 PRO CB CG sing N N 230 PRO CB HB2 sing N N 231 PRO CB HB3 sing N N 232 PRO CG CD sing N N 233 PRO CG HG2 sing N N 234 PRO CG HG3 sing N N 235 PRO CD HD2 sing N N 236 PRO CD HD3 sing N N 237 PRO OXT HXT sing N N 238 SER N CA sing N N 239 SER N H sing N N 240 SER N H2 sing N N 241 SER CA C sing N N 242 SER CA CB sing N N 243 SER CA HA sing N N 244 SER C O doub N N 245 SER C OXT sing N N 246 SER CB OG sing N N 247 SER CB HB2 sing N N 248 SER CB HB3 sing N N 249 SER OG HG sing N N 250 SER OXT HXT sing N N 251 THR N CA sing N N 252 THR N H sing N N 253 THR N H2 sing N N 254 THR CA C sing N N 255 THR CA CB sing N N 256 THR CA HA sing N N 257 THR C O doub N N 258 THR C OXT sing N N 259 THR CB OG1 sing N N 260 THR CB CG2 sing N N 261 THR CB HB sing N N 262 THR OG1 HG1 sing N N 263 THR CG2 HG21 sing N N 264 THR CG2 HG22 sing N N 265 THR CG2 HG23 sing N N 266 THR OXT HXT sing N N 267 TYR N CA sing N N 268 TYR N H sing N N 269 TYR N H2 sing N N 270 TYR CA C sing N N 271 TYR CA CB sing N N 272 TYR CA HA sing N N 273 TYR C O doub N N 274 TYR C OXT sing N N 275 TYR CB CG sing N N 276 TYR CB HB2 sing N N 277 TYR CB HB3 sing N N 278 TYR CG CD1 doub Y N 279 TYR CG CD2 sing Y N 280 TYR CD1 CE1 sing Y N 281 TYR CD1 HD1 sing N N 282 TYR CD2 CE2 doub Y N 283 TYR CD2 HD2 sing N N 284 TYR CE1 CZ doub Y N 285 TYR CE1 HE1 sing N N 286 TYR CE2 CZ sing Y N 287 TYR CE2 HE2 sing N N 288 TYR CZ OH sing N N 289 TYR OH HH sing N N 290 TYR OXT HXT sing N N 291 VAL N CA sing N N 292 VAL N H sing N N 293 VAL N H2 sing N N 294 VAL CA C sing N N 295 VAL CA CB sing N N 296 VAL CA HA sing N N 297 VAL C O doub N N 298 VAL C OXT sing N N 299 VAL CB CG1 sing N N 300 VAL CB CG2 sing N N 301 VAL CB HB sing N N 302 VAL CG1 HG11 sing N N 303 VAL CG1 HG12 sing N N 304 VAL CG1 HG13 sing N N 305 VAL CG2 HG21 sing N N 306 VAL CG2 HG22 sing N N 307 VAL CG2 HG23 sing N N 308 VAL OXT HXT sing N N 309 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 1X48 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_