data_1XFQ
# 
_entry.id   1XFQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.355 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1XFQ         pdb_00001xfq 10.2210/pdb1xfq/pdb 
RCSB  RCSB030311   ?            ?                   
WWPDB D_1000030311 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1XFN 
_pdbx_database_related.details        'NMR structure of the ground state' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XFQ 
_pdbx_database_status.recvd_initial_deposition_date   2004-09-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bernard, C.'         1 
'Houben, K.'          2 
'Derix, N.M.'         3 
'Marks, D.'           4 
'van der Horst, M.A.' 5 
'Hellingwerf, K.J.'   6 
'Boelens, R.'         7 
'Kaptein, R.'         8 
'van Nuland, N.A.'    9 
# 
_citation.id                        primary 
_citation.title                     
'The solution structure of a transient photoreceptor intermediate: delta25 photoactive yellow protein' 
_citation.journal_abbrev            STRUCTURE 
_citation.journal_volume            13 
_citation.page_first                953 
_citation.page_last                 962 
_citation.year                      2005 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16004868 
_citation.pdbx_database_id_DOI      10.1016/j.str.2005.04.017 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bernard, C.'         1 ? 
primary 'Houben, K.'          2 ? 
primary 'Derix, N.M.'         3 ? 
primary 'Marks, D.'           4 ? 
primary 'van der Horst, M.A.' 5 ? 
primary 'Hellingwerf, K.J.'   6 ? 
primary 'Boelens, R.'         7 ? 
primary 'Kaptein, R.'         8 ? 
primary 'van Nuland, N.A.'    9 ? 
# 
_cell.entry_id           1XFQ 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1XFQ 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Photoactive yellow protein' 12816.266 1 ? ? 'residues 26-125' ? 
2 non-polymer syn 
;4'-HYDROXYCINNAMIC ACID
;
164.158   1 ? ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        PYP 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;HHHHHHESDDDDKLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMF
EYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;HHHHHHESDDDDKLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMF
EYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   GLU n 
1 8   SER n 
1 9   ASP n 
1 10  ASP n 
1 11  ASP n 
1 12  ASP n 
1 13  LYS n 
1 14  LEU n 
1 15  ALA n 
1 16  PHE n 
1 17  GLY n 
1 18  ALA n 
1 19  ILE n 
1 20  GLN n 
1 21  LEU n 
1 22  ASP n 
1 23  GLY n 
1 24  ASP n 
1 25  GLY n 
1 26  ASN n 
1 27  ILE n 
1 28  LEU n 
1 29  GLN n 
1 30  TYR n 
1 31  ASN n 
1 32  ALA n 
1 33  ALA n 
1 34  GLU n 
1 35  GLY n 
1 36  ASP n 
1 37  ILE n 
1 38  THR n 
1 39  GLY n 
1 40  ARG n 
1 41  ASP n 
1 42  PRO n 
1 43  LYS n 
1 44  GLN n 
1 45  VAL n 
1 46  ILE n 
1 47  GLY n 
1 48  LYS n 
1 49  ASN n 
1 50  PHE n 
1 51  PHE n 
1 52  LYS n 
1 53  ASP n 
1 54  VAL n 
1 55  ALA n 
1 56  PRO n 
1 57  CYS n 
1 58  THR n 
1 59  ASP n 
1 60  SER n 
1 61  PRO n 
1 62  GLU n 
1 63  PHE n 
1 64  TYR n 
1 65  GLY n 
1 66  LYS n 
1 67  PHE n 
1 68  LYS n 
1 69  GLU n 
1 70  GLY n 
1 71  VAL n 
1 72  ALA n 
1 73  SER n 
1 74  GLY n 
1 75  ASN n 
1 76  LEU n 
1 77  ASN n 
1 78  THR n 
1 79  MET n 
1 80  PHE n 
1 81  GLU n 
1 82  TYR n 
1 83  THR n 
1 84  PHE n 
1 85  ASP n 
1 86  TYR n 
1 87  GLN n 
1 88  MET n 
1 89  THR n 
1 90  PRO n 
1 91  THR n 
1 92  LYS n 
1 93  VAL n 
1 94  LYS n 
1 95  VAL n 
1 96  HIS n 
1 97  MET n 
1 98  LYS n 
1 99  LYS n 
1 100 ALA n 
1 101 LEU n 
1 102 SER n 
1 103 GLY n 
1 104 ASP n 
1 105 SER n 
1 106 TYR n 
1 107 TRP n 
1 108 VAL n 
1 109 PHE n 
1 110 VAL n 
1 111 LYS n 
1 112 ARG n 
1 113 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Halorhodospira 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Halorhodospira halophila' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1053 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PYP_ECTHA 
_struct_ref.pdbx_db_accession          P16113 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;LAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKV
KVHMKKALSGDSYWVFVKRV
;
_struct_ref.pdbx_align_begin           26 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1XFQ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 14 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 113 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P16113 
_struct_ref_seq.db_align_beg                  26 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  125 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       26 
_struct_ref_seq.pdbx_auth_seq_align_end       125 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1XFQ HIS A 1  ? UNP P16113 ? ? 'expression tag' 13 1  
1 1XFQ HIS A 2  ? UNP P16113 ? ? 'expression tag' 14 2  
1 1XFQ HIS A 3  ? UNP P16113 ? ? 'expression tag' 15 3  
1 1XFQ HIS A 4  ? UNP P16113 ? ? 'expression tag' 16 4  
1 1XFQ HIS A 5  ? UNP P16113 ? ? 'expression tag' 17 5  
1 1XFQ HIS A 6  ? UNP P16113 ? ? 'expression tag' 18 6  
1 1XFQ GLU A 7  ? UNP P16113 ? ? 'expression tag' 19 7  
1 1XFQ SER A 8  ? UNP P16113 ? ? 'expression tag' 20 8  
1 1XFQ ASP A 9  ? UNP P16113 ? ? 'expression tag' 21 9  
1 1XFQ ASP A 10 ? UNP P16113 ? ? 'expression tag' 22 10 
1 1XFQ ASP A 11 ? UNP P16113 ? ? 'expression tag' 23 11 
1 1XFQ ASP A 12 ? UNP P16113 ? ? 'expression tag' 24 12 
1 1XFQ LYS A 13 ? UNP P16113 ? ? 'expression tag' 25 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                   ?                    'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                  ?                    'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                ?                    'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ?                    'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                  ?                    'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                 ?                    'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ?                    'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                   ?                    'C2 H5 N O2'     75.067  
HC4 non-polymer         . 
;4'-HYDROXYCINNAMIC ACID
;
'PARA-COUMARIC ACID' 'C9 H8 O3'       164.158 
HIS 'L-peptide linking' y HISTIDINE                 ?                    'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                ?                    'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                   ?                    'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                    ?                    'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                ?                    'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE             ?                    'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                   ?                    'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                    ?                    'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                 ?                    'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                ?                    'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                  ?                    'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                    ?                    'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 HNCA                    
2 1 1 'CBCA(CO)NH'            
3 2 1 '3D 15N TOCSY-HSQC'     
4 2 1 3D_15N-separated_NOESY  
5 2 1 '2D NOESY'              
6 2 1 '2D TOCSY'              
7 1 1 HNCO                    
8 1 1 HNCACB                  
9 1 1 '13C filtered 2D NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         293 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '50mM phosphate buffer' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1mM Delta25-PYP, 15N-13C, 50mM phosphate buffer' '90% H2O/10% D2O' 
2 '1mM Delta25-PYP 15N, 50mM phosphate buffer'      '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker AVANCE 900 
2 ? Bruker AVANCE 750 
3 ? Bruker AVANCE 500 
# 
_pdbx_nmr_refine.entry_id           1XFQ 
_pdbx_nmr_refine.method             'torsion angle dynamics, simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1XFQ 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1XFQ 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XwinNMR 3.1   collection           bruker   1 
NMRPipe ?     processing           johnson  2 
NMRView 5.0.4 'data analysis'      Delaglio 3 
CNS     1.2   'structure solution' Brunger  4 
CNS     1.2   refinement           Brunger  5 
# 
_exptl.entry_id          1XFQ 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1XFQ 
_struct.title                     
'structure of the blue shifted intermediate state of the photoactive yellow protein lacking the N-terminal part' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XFQ 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'PAS DOMAIN, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       LYS 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        66 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       GLY 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        74 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        LYS 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         78 
_struct_conf.end_auth_comp_id        GLY 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         86 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   9 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        one 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            57 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           HC4 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           C1 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             69 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            HC4 
_struct_conn.ptnr2_auth_seq_id             169 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.819 
_struct_conn.pdbx_value_order              ? 
_struct_conn.pdbx_role                     ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 27  ? ASN A 31  ? ILE A 39  ASN A 43  
A 2 ALA A 18  ? ASP A 22  ? ALA A 30  ASP A 34  
A 3 SER A 105 ? ARG A 112 ? SER A 117 ARG A 124 
A 4 VAL A 93  ? LYS A 99  ? VAL A 105 LYS A 111 
A 5 THR A 78  ? TYR A 82  ? THR A 90  TYR A 94  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ASN A 31  ? O ASN A 43  N ALA A 18  ? N ALA A 30  
A 2 3 N ILE A 19  ? N ILE A 31  O VAL A 108 ? O VAL A 120 
A 3 4 O TRP A 107 ? O TRP A 119 N LYS A 98  ? N LYS A 110 
A 4 5 O VAL A 95  ? O VAL A 107 N PHE A 80  ? N PHE A 92  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    HC4 
_struct_site.pdbx_auth_seq_id     169 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    1 
_struct_site.details              'BINDING SITE FOR RESIDUE HC4 A 169' 
# 
_struct_site_gen.id                   1 
_struct_site_gen.site_id              AC1 
_struct_site_gen.pdbx_num_res         1 
_struct_site_gen.label_comp_id        CYS 
_struct_site_gen.label_asym_id        A 
_struct_site_gen.label_seq_id         57 
_struct_site_gen.pdbx_auth_ins_code   ? 
_struct_site_gen.auth_comp_id         CYS 
_struct_site_gen.auth_asym_id         A 
_struct_site_gen.auth_seq_id          69 
_struct_site_gen.label_atom_id        . 
_struct_site_gen.label_alt_id         ? 
_struct_site_gen.symmetry             1_555 
_struct_site_gen.details              ? 
# 
_database_PDB_matrix.entry_id          1XFQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1XFQ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   13  ?   ?   ?   A . n 
A 1 2   HIS 2   14  ?   ?   ?   A . n 
A 1 3   HIS 3   15  ?   ?   ?   A . n 
A 1 4   HIS 4   16  ?   ?   ?   A . n 
A 1 5   HIS 5   17  ?   ?   ?   A . n 
A 1 6   HIS 6   18  ?   ?   ?   A . n 
A 1 7   GLU 7   19  ?   ?   ?   A . n 
A 1 8   SER 8   20  ?   ?   ?   A . n 
A 1 9   ASP 9   21  ?   ?   ?   A . n 
A 1 10  ASP 10  22  ?   ?   ?   A . n 
A 1 11  ASP 11  23  ?   ?   ?   A . n 
A 1 12  ASP 12  24  ?   ?   ?   A . n 
A 1 13  LYS 13  25  ?   ?   ?   A . n 
A 1 14  LEU 14  26  26  LEU LEU A . n 
A 1 15  ALA 15  27  27  ALA ALA A . n 
A 1 16  PHE 16  28  28  PHE PHE A . n 
A 1 17  GLY 17  29  29  GLY GLY A . n 
A 1 18  ALA 18  30  30  ALA ALA A . n 
A 1 19  ILE 19  31  31  ILE ILE A . n 
A 1 20  GLN 20  32  32  GLN GLN A . n 
A 1 21  LEU 21  33  33  LEU LEU A . n 
A 1 22  ASP 22  34  34  ASP ASP A . n 
A 1 23  GLY 23  35  35  GLY GLY A . n 
A 1 24  ASP 24  36  36  ASP ASP A . n 
A 1 25  GLY 25  37  37  GLY GLY A . n 
A 1 26  ASN 26  38  38  ASN ASN A . n 
A 1 27  ILE 27  39  39  ILE ILE A . n 
A 1 28  LEU 28  40  40  LEU LEU A . n 
A 1 29  GLN 29  41  41  GLN GLN A . n 
A 1 30  TYR 30  42  42  TYR TYR A . n 
A 1 31  ASN 31  43  43  ASN ASN A . n 
A 1 32  ALA 32  44  44  ALA ALA A . n 
A 1 33  ALA 33  45  45  ALA ALA A . n 
A 1 34  GLU 34  46  46  GLU GLU A . n 
A 1 35  GLY 35  47  47  GLY GLY A . n 
A 1 36  ASP 36  48  48  ASP ASP A . n 
A 1 37  ILE 37  49  49  ILE ILE A . n 
A 1 38  THR 38  50  50  THR THR A . n 
A 1 39  GLY 39  51  51  GLY GLY A . n 
A 1 40  ARG 40  52  52  ARG ARG A . n 
A 1 41  ASP 41  53  53  ASP ASP A . n 
A 1 42  PRO 42  54  54  PRO PRO A . n 
A 1 43  LYS 43  55  55  LYS LYS A . n 
A 1 44  GLN 44  56  56  GLN GLN A . n 
A 1 45  VAL 45  57  57  VAL VAL A . n 
A 1 46  ILE 46  58  58  ILE ILE A . n 
A 1 47  GLY 47  59  59  GLY GLY A . n 
A 1 48  LYS 48  60  60  LYS LYS A . n 
A 1 49  ASN 49  61  61  ASN ASN A . n 
A 1 50  PHE 50  62  62  PHE PHE A . n 
A 1 51  PHE 51  63  63  PHE PHE A . n 
A 1 52  LYS 52  64  64  LYS LYS A . n 
A 1 53  ASP 53  65  65  ASP ASP A . n 
A 1 54  VAL 54  66  66  VAL VAL A . n 
A 1 55  ALA 55  67  67  ALA ALA A . n 
A 1 56  PRO 56  68  68  PRO PRO A . n 
A 1 57  CYS 57  69  69  CYS CYS A . n 
A 1 58  THR 58  70  70  THR THR A . n 
A 1 59  ASP 59  71  71  ASP ASP A . n 
A 1 60  SER 60  72  72  SER SER A . n 
A 1 61  PRO 61  73  73  PRO PRO A . n 
A 1 62  GLU 62  74  74  GLU GLU A . n 
A 1 63  PHE 63  75  75  PHE PHE A . n 
A 1 64  TYR 64  76  76  TYR TYR A . n 
A 1 65  GLY 65  77  77  GLY GLY A . n 
A 1 66  LYS 66  78  78  LYS LYS A . n 
A 1 67  PHE 67  79  79  PHE PHE A . n 
A 1 68  LYS 68  80  80  LYS LYS A . n 
A 1 69  GLU 69  81  81  GLU GLU A . n 
A 1 70  GLY 70  82  82  GLY GLY A . n 
A 1 71  VAL 71  83  83  VAL VAL A . n 
A 1 72  ALA 72  84  84  ALA ALA A . n 
A 1 73  SER 73  85  85  SER SER A . n 
A 1 74  GLY 74  86  86  GLY GLY A . n 
A 1 75  ASN 75  87  87  ASN ASN A . n 
A 1 76  LEU 76  88  88  LEU LEU A . n 
A 1 77  ASN 77  89  89  ASN ASN A . n 
A 1 78  THR 78  90  90  THR THR A . n 
A 1 79  MET 79  91  91  MET MET A . n 
A 1 80  PHE 80  92  92  PHE PHE A . n 
A 1 81  GLU 81  93  93  GLU GLU A . n 
A 1 82  TYR 82  94  94  TYR TYR A . n 
A 1 83  THR 83  95  95  THR THR A . n 
A 1 84  PHE 84  96  96  PHE PHE A . n 
A 1 85  ASP 85  97  97  ASP ASP A . n 
A 1 86  TYR 86  98  98  TYR TYR A . n 
A 1 87  GLN 87  99  99  GLN GLN A . n 
A 1 88  MET 88  100 100 MET MET A . n 
A 1 89  THR 89  101 101 THR THR A . n 
A 1 90  PRO 90  102 102 PRO PRO A . n 
A 1 91  THR 91  103 103 THR THR A . n 
A 1 92  LYS 92  104 104 LYS LYS A . n 
A 1 93  VAL 93  105 105 VAL VAL A . n 
A 1 94  LYS 94  106 106 LYS LYS A . n 
A 1 95  VAL 95  107 107 VAL VAL A . n 
A 1 96  HIS 96  108 108 HIS HIS A . n 
A 1 97  MET 97  109 109 MET MET A . n 
A 1 98  LYS 98  110 110 LYS LYS A . n 
A 1 99  LYS 99  111 111 LYS LYS A . n 
A 1 100 ALA 100 112 112 ALA ALA A . n 
A 1 101 LEU 101 113 113 LEU LEU A . n 
A 1 102 SER 102 114 114 SER SER A . n 
A 1 103 GLY 103 115 115 GLY GLY A . n 
A 1 104 ASP 104 116 116 ASP ASP A . n 
A 1 105 SER 105 117 117 SER SER A . n 
A 1 106 TYR 106 118 118 TYR TYR A . n 
A 1 107 TRP 107 119 119 TRP TRP A . n 
A 1 108 VAL 108 120 120 VAL VAL A . n 
A 1 109 PHE 109 121 121 PHE PHE A . n 
A 1 110 VAL 110 122 122 VAL VAL A . n 
A 1 111 LYS 111 123 123 LYS LYS A . n 
A 1 112 ARG 112 124 124 ARG ARG A . n 
A 1 113 VAL 113 125 125 VAL VAL A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          HC4 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     169 
_pdbx_nonpoly_scheme.auth_seq_num    169 
_pdbx_nonpoly_scheme.pdb_mon_id      HC4 
_pdbx_nonpoly_scheme.auth_mon_id     HC4 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-08-16 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-03-02 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2            
2 4 'Structure model' pdbx_nmr_software     
3 4 'Structure model' pdbx_nmr_spectrometer 
4 4 'Structure model' pdbx_struct_assembly  
5 4 'Structure model' pdbx_struct_oper_list 
6 4 'Structure model' struct_conn           
7 4 'Structure model' struct_ref_seq_dif    
8 4 'Structure model' struct_site           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_pdbx_nmr_software.name'             
4 4 'Structure model' '_pdbx_nmr_spectrometer.model'        
5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
6 4 'Structure model' '_struct_ref_seq_dif.details'         
7 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
8 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
9 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  4  HA3  A GLY 82  ? ? HG  A LEU 88  ? ? 1.34 
2  5  HZ1  A LYS 60  ? ? OD2 A ASP 65  ? ? 1.55 
3  8  OD2  A ASP 53  ? ? HZ1 A LYS 55  ? ? 1.58 
4  10 HA3  A GLY 82  ? ? HG  A LEU 88  ? ? 1.31 
5  11 HH22 A ARG 52  ? ? HH  A TYR 98  ? ? 0.83 
6  12 OD2  A ASP 53  ? ? HZ3 A LYS 55  ? ? 1.59 
7  13 HA3  A GLY 82  ? ? HG  A LEU 88  ? ? 1.34 
8  14 HG1  A THR 95  ? ? HH  A TYR 98  ? ? 1.23 
9  14 OD2  A ASP 53  ? ? HZ2 A LYS 55  ? ? 1.58 
10 14 OE1  A GLU 93  ? ? HZ1 A LYS 106 ? ? 1.58 
11 16 HA   A VAL 83  ? ? HH  A TYR 118 ? ? 1.08 
12 16 HZ2  A LYS 60  ? ? OE2 A GLU 74  ? ? 1.57 
13 18 H    A GLY 35  ? ? HA  A SER 117 ? ? 1.09 
14 19 HG2  A MET 100 ? ? H   A THR 101 ? ? 1.33 
15 20 O    A ASP 116 ? ? HG  A SER 117 ? ? 1.57 
16 20 OE1  A GLU 93  ? ? HZ1 A LYS 104 ? ? 1.59 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1   1  CA A ILE 31  ? ? CB A ILE 31  ? ? 1.339 1.544 -0.205 0.023 N 
2   1  CA A ILE 39  ? ? CB A ILE 39  ? ? 1.328 1.544 -0.216 0.023 N 
3   1  CA A ILE 49  ? ? CB A ILE 49  ? ? 1.325 1.544 -0.219 0.023 N 
4   1  CA A THR 50  ? ? CB A THR 50  ? ? 1.332 1.529 -0.197 0.026 N 
5   1  CA A VAL 57  ? ? CB A VAL 57  ? ? 1.330 1.543 -0.213 0.021 N 
6   1  CA A ILE 58  ? ? CB A ILE 58  ? ? 1.339 1.544 -0.205 0.023 N 
7   1  CA A VAL 66  ? ? CB A VAL 66  ? ? 1.332 1.543 -0.211 0.021 N 
8   1  CA A THR 70  ? ? CB A THR 70  ? ? 1.322 1.529 -0.207 0.026 N 
9   1  CA A VAL 83  ? ? CB A VAL 83  ? ? 1.326 1.543 -0.217 0.021 N 
10  1  CA A THR 90  ? ? CB A THR 90  ? ? 1.334 1.529 -0.195 0.026 N 
11  1  CA A THR 95  ? ? CB A THR 95  ? ? 1.320 1.529 -0.209 0.026 N 
12  1  CA A THR 101 ? ? CB A THR 101 ? ? 1.319 1.529 -0.210 0.026 N 
13  1  CA A THR 103 ? ? CB A THR 103 ? ? 1.313 1.529 -0.216 0.026 N 
14  1  CA A VAL 105 ? ? CB A VAL 105 ? ? 1.325 1.543 -0.218 0.021 N 
15  1  CA A VAL 107 ? ? CB A VAL 107 ? ? 1.326 1.543 -0.217 0.021 N 
16  1  CA A VAL 120 ? ? CB A VAL 120 ? ? 1.333 1.543 -0.210 0.021 N 
17  1  CA A VAL 122 ? ? CB A VAL 122 ? ? 1.335 1.543 -0.208 0.021 N 
18  1  CA A VAL 125 ? ? CB A VAL 125 ? ? 1.327 1.543 -0.216 0.021 N 
19  2  CA A ILE 31  ? ? CB A ILE 31  ? ? 1.330 1.544 -0.214 0.023 N 
20  2  CA A ILE 39  ? ? CB A ILE 39  ? ? 1.331 1.544 -0.213 0.023 N 
21  2  CA A ILE 49  ? ? CB A ILE 49  ? ? 1.332 1.544 -0.212 0.023 N 
22  2  CA A THR 50  ? ? CB A THR 50  ? ? 1.320 1.529 -0.209 0.026 N 
23  2  CA A VAL 57  ? ? CB A VAL 57  ? ? 1.327 1.543 -0.216 0.021 N 
24  2  CA A ILE 58  ? ? CB A ILE 58  ? ? 1.346 1.544 -0.198 0.023 N 
25  2  CA A VAL 66  ? ? CB A VAL 66  ? ? 1.331 1.543 -0.212 0.021 N 
26  2  CA A THR 70  ? ? CB A THR 70  ? ? 1.333 1.529 -0.196 0.026 N 
27  2  CA A VAL 83  ? ? CB A VAL 83  ? ? 1.327 1.543 -0.216 0.021 N 
28  2  CA A THR 90  ? ? CB A THR 90  ? ? 1.325 1.529 -0.204 0.026 N 
29  2  CA A THR 95  ? ? CB A THR 95  ? ? 1.317 1.529 -0.212 0.026 N 
30  2  CA A THR 101 ? ? CB A THR 101 ? ? 1.325 1.529 -0.204 0.026 N 
31  2  CA A THR 103 ? ? CB A THR 103 ? ? 1.316 1.529 -0.213 0.026 N 
32  2  CA A VAL 105 ? ? CB A VAL 105 ? ? 1.331 1.543 -0.212 0.021 N 
33  2  CA A VAL 107 ? ? CB A VAL 107 ? ? 1.331 1.543 -0.212 0.021 N 
34  2  CA A VAL 120 ? ? CB A VAL 120 ? ? 1.333 1.543 -0.210 0.021 N 
35  2  CA A VAL 122 ? ? CB A VAL 122 ? ? 1.329 1.543 -0.214 0.021 N 
36  2  CA A VAL 125 ? ? CB A VAL 125 ? ? 1.330 1.543 -0.213 0.021 N 
37  3  CA A ILE 31  ? ? CB A ILE 31  ? ? 1.329 1.544 -0.215 0.023 N 
38  3  CA A ILE 39  ? ? CB A ILE 39  ? ? 1.329 1.544 -0.215 0.023 N 
39  3  CA A ILE 49  ? ? CB A ILE 49  ? ? 1.336 1.544 -0.208 0.023 N 
40  3  CA A THR 50  ? ? CB A THR 50  ? ? 1.321 1.529 -0.208 0.026 N 
41  3  CA A VAL 57  ? ? CB A VAL 57  ? ? 1.338 1.543 -0.205 0.021 N 
42  3  CA A ILE 58  ? ? CB A ILE 58  ? ? 1.338 1.544 -0.206 0.023 N 
43  3  CA A VAL 66  ? ? CB A VAL 66  ? ? 1.336 1.543 -0.207 0.021 N 
44  3  CA A THR 70  ? ? CB A THR 70  ? ? 1.318 1.529 -0.211 0.026 N 
45  3  CA A VAL 83  ? ? CB A VAL 83  ? ? 1.323 1.543 -0.220 0.021 N 
46  3  CA A THR 90  ? ? CB A THR 90  ? ? 1.336 1.529 -0.193 0.026 N 
47  3  CA A THR 95  ? ? CB A THR 95  ? ? 1.331 1.529 -0.198 0.026 N 
48  3  CA A THR 101 ? ? CB A THR 101 ? ? 1.316 1.529 -0.213 0.026 N 
49  3  CA A THR 103 ? ? CB A THR 103 ? ? 1.319 1.529 -0.210 0.026 N 
50  3  CA A VAL 105 ? ? CB A VAL 105 ? ? 1.330 1.543 -0.213 0.021 N 
51  3  CA A VAL 107 ? ? CB A VAL 107 ? ? 1.330 1.543 -0.213 0.021 N 
52  3  CA A VAL 120 ? ? CB A VAL 120 ? ? 1.329 1.543 -0.214 0.021 N 
53  3  CA A VAL 122 ? ? CB A VAL 122 ? ? 1.335 1.543 -0.208 0.021 N 
54  3  CA A VAL 125 ? ? CB A VAL 125 ? ? 1.336 1.543 -0.207 0.021 N 
55  4  CA A ILE 31  ? ? CB A ILE 31  ? ? 1.340 1.544 -0.204 0.023 N 
56  4  CA A ILE 39  ? ? CB A ILE 39  ? ? 1.334 1.544 -0.210 0.023 N 
57  4  CA A ILE 49  ? ? CB A ILE 49  ? ? 1.328 1.544 -0.216 0.023 N 
58  4  CA A THR 50  ? ? CB A THR 50  ? ? 1.321 1.529 -0.208 0.026 N 
59  4  CA A VAL 57  ? ? CB A VAL 57  ? ? 1.341 1.543 -0.202 0.021 N 
60  4  CA A ILE 58  ? ? CB A ILE 58  ? ? 1.326 1.544 -0.218 0.023 N 
61  4  CA A VAL 66  ? ? CB A VAL 66  ? ? 1.338 1.543 -0.205 0.021 N 
62  4  CA A THR 70  ? ? CB A THR 70  ? ? 1.317 1.529 -0.212 0.026 N 
63  4  CA A VAL 83  ? ? CB A VAL 83  ? ? 1.322 1.543 -0.221 0.021 N 
64  4  CA A THR 90  ? ? CB A THR 90  ? ? 1.335 1.529 -0.194 0.026 N 
65  4  CA A THR 95  ? ? CB A THR 95  ? ? 1.322 1.529 -0.207 0.026 N 
66  4  CA A THR 101 ? ? CB A THR 101 ? ? 1.318 1.529 -0.211 0.026 N 
67  4  CA A THR 103 ? ? CB A THR 103 ? ? 1.326 1.529 -0.203 0.026 N 
68  4  CA A VAL 105 ? ? CB A VAL 105 ? ? 1.327 1.543 -0.216 0.021 N 
69  4  CA A VAL 107 ? ? CB A VAL 107 ? ? 1.334 1.543 -0.209 0.021 N 
70  4  CA A VAL 120 ? ? CB A VAL 120 ? ? 1.331 1.543 -0.212 0.021 N 
71  4  CA A VAL 122 ? ? CB A VAL 122 ? ? 1.327 1.543 -0.216 0.021 N 
72  4  CA A VAL 125 ? ? CB A VAL 125 ? ? 1.338 1.543 -0.205 0.021 N 
73  5  CA A ILE 31  ? ? CB A ILE 31  ? ? 1.330 1.544 -0.214 0.023 N 
74  5  CA A ILE 39  ? ? CB A ILE 39  ? ? 1.333 1.544 -0.211 0.023 N 
75  5  CA A ILE 49  ? ? CB A ILE 49  ? ? 1.329 1.544 -0.215 0.023 N 
76  5  CA A THR 50  ? ? CB A THR 50  ? ? 1.340 1.529 -0.189 0.026 N 
77  5  CA A VAL 57  ? ? CB A VAL 57  ? ? 1.336 1.543 -0.207 0.021 N 
78  5  CA A ILE 58  ? ? CB A ILE 58  ? ? 1.348 1.544 -0.196 0.023 N 
79  5  CA A VAL 66  ? ? CB A VAL 66  ? ? 1.332 1.543 -0.211 0.021 N 
80  5  CA A THR 70  ? ? CB A THR 70  ? ? 1.317 1.529 -0.212 0.026 N 
81  5  CA A VAL 83  ? ? CB A VAL 83  ? ? 1.323 1.543 -0.220 0.021 N 
82  5  CA A THR 90  ? ? CB A THR 90  ? ? 1.323 1.529 -0.206 0.026 N 
83  5  CA A THR 95  ? ? CB A THR 95  ? ? 1.319 1.529 -0.210 0.026 N 
84  5  CA A THR 101 ? ? CB A THR 101 ? ? 1.329 1.529 -0.200 0.026 N 
85  5  CA A THR 103 ? ? CB A THR 103 ? ? 1.318 1.529 -0.211 0.026 N 
86  5  CA A VAL 105 ? ? CB A VAL 105 ? ? 1.330 1.543 -0.213 0.021 N 
87  5  CA A VAL 107 ? ? CB A VAL 107 ? ? 1.331 1.543 -0.212 0.021 N 
88  5  CA A VAL 120 ? ? CB A VAL 120 ? ? 1.333 1.543 -0.210 0.021 N 
89  5  CA A VAL 122 ? ? CB A VAL 122 ? ? 1.331 1.543 -0.212 0.021 N 
90  5  CA A VAL 125 ? ? CB A VAL 125 ? ? 1.337 1.543 -0.206 0.021 N 
91  6  CA A ILE 31  ? ? CB A ILE 31  ? ? 1.334 1.544 -0.210 0.023 N 
92  6  CA A ILE 39  ? ? CB A ILE 39  ? ? 1.323 1.544 -0.221 0.023 N 
93  6  CA A ILE 49  ? ? CB A ILE 49  ? ? 1.336 1.544 -0.208 0.023 N 
94  6  CA A THR 50  ? ? CB A THR 50  ? ? 1.322 1.529 -0.207 0.026 N 
95  6  CA A VAL 57  ? ? CB A VAL 57  ? ? 1.327 1.543 -0.216 0.021 N 
96  6  CA A ILE 58  ? ? CB A ILE 58  ? ? 1.336 1.544 -0.208 0.023 N 
97  6  CA A VAL 66  ? ? CB A VAL 66  ? ? 1.343 1.543 -0.200 0.021 N 
98  6  CA A THR 70  ? ? CB A THR 70  ? ? 1.320 1.529 -0.209 0.026 N 
99  6  CA A VAL 83  ? ? CB A VAL 83  ? ? 1.328 1.543 -0.215 0.021 N 
100 6  CA A THR 90  ? ? CB A THR 90  ? ? 1.330 1.529 -0.199 0.026 N 
101 6  CA A THR 95  ? ? CB A THR 95  ? ? 1.318 1.529 -0.211 0.026 N 
102 6  CA A THR 101 ? ? CB A THR 101 ? ? 1.325 1.529 -0.204 0.026 N 
103 6  CA A THR 103 ? ? CB A THR 103 ? ? 1.320 1.529 -0.209 0.026 N 
104 6  CA A VAL 105 ? ? CB A VAL 105 ? ? 1.329 1.543 -0.214 0.021 N 
105 6  CA A VAL 107 ? ? CB A VAL 107 ? ? 1.331 1.543 -0.212 0.021 N 
106 6  CA A VAL 120 ? ? CB A VAL 120 ? ? 1.333 1.543 -0.210 0.021 N 
107 6  CA A VAL 122 ? ? CB A VAL 122 ? ? 1.329 1.543 -0.214 0.021 N 
108 6  CA A VAL 125 ? ? CB A VAL 125 ? ? 1.343 1.543 -0.200 0.021 N 
109 7  CA A ILE 31  ? ? CB A ILE 31  ? ? 1.339 1.544 -0.205 0.023 N 
110 7  CA A ILE 39  ? ? CB A ILE 39  ? ? 1.327 1.544 -0.217 0.023 N 
111 7  CA A ILE 49  ? ? CB A ILE 49  ? ? 1.327 1.544 -0.217 0.023 N 
112 7  CA A THR 50  ? ? CB A THR 50  ? ? 1.322 1.529 -0.207 0.026 N 
113 7  CA A VAL 57  ? ? CB A VAL 57  ? ? 1.339 1.543 -0.204 0.021 N 
114 7  CA A ILE 58  ? ? CB A ILE 58  ? ? 1.326 1.544 -0.218 0.023 N 
115 7  CA A VAL 66  ? ? CB A VAL 66  ? ? 1.337 1.543 -0.206 0.021 N 
116 7  CA A THR 70  ? ? CB A THR 70  ? ? 1.332 1.529 -0.197 0.026 N 
117 7  CA A VAL 83  ? ? CB A VAL 83  ? ? 1.323 1.543 -0.220 0.021 N 
118 7  CA A THR 90  ? ? CB A THR 90  ? ? 1.331 1.529 -0.198 0.026 N 
119 7  CA A THR 95  ? ? CB A THR 95  ? ? 1.318 1.529 -0.211 0.026 N 
120 7  CA A THR 101 ? ? CB A THR 101 ? ? 1.318 1.529 -0.211 0.026 N 
121 7  CA A THR 103 ? ? CB A THR 103 ? ? 1.320 1.529 -0.209 0.026 N 
122 7  CA A VAL 105 ? ? CB A VAL 105 ? ? 1.327 1.543 -0.216 0.021 N 
123 7  CA A VAL 107 ? ? CB A VAL 107 ? ? 1.332 1.543 -0.211 0.021 N 
124 7  CA A VAL 120 ? ? CB A VAL 120 ? ? 1.330 1.543 -0.213 0.021 N 
125 7  CA A VAL 122 ? ? CB A VAL 122 ? ? 1.329 1.543 -0.214 0.021 N 
126 7  CA A VAL 125 ? ? CB A VAL 125 ? ? 1.335 1.543 -0.208 0.021 N 
127 8  CA A ILE 31  ? ? CB A ILE 31  ? ? 1.328 1.544 -0.216 0.023 N 
128 8  CA A ILE 39  ? ? CB A ILE 39  ? ? 1.331 1.544 -0.213 0.023 N 
129 8  CA A ILE 49  ? ? CB A ILE 49  ? ? 1.330 1.544 -0.214 0.023 N 
130 8  CA A THR 50  ? ? CB A THR 50  ? ? 1.331 1.529 -0.198 0.026 N 
131 8  CA A VAL 57  ? ? CB A VAL 57  ? ? 1.339 1.543 -0.204 0.021 N 
132 8  CA A ILE 58  ? ? CB A ILE 58  ? ? 1.337 1.544 -0.207 0.023 N 
133 8  CA A VAL 66  ? ? CB A VAL 66  ? ? 1.337 1.543 -0.206 0.021 N 
134 8  CA A THR 70  ? ? CB A THR 70  ? ? 1.324 1.529 -0.205 0.026 N 
135 8  CA A VAL 83  ? ? CB A VAL 83  ? ? 1.323 1.543 -0.220 0.021 N 
136 8  CA A THR 90  ? ? CB A THR 90  ? ? 1.337 1.529 -0.192 0.026 N 
137 8  CA A THR 95  ? ? CB A THR 95  ? ? 1.321 1.529 -0.208 0.026 N 
138 8  CA A THR 101 ? ? CB A THR 101 ? ? 1.321 1.529 -0.208 0.026 N 
139 8  CA A THR 103 ? ? CB A THR 103 ? ? 1.317 1.529 -0.212 0.026 N 
140 8  CA A VAL 105 ? ? CB A VAL 105 ? ? 1.324 1.543 -0.219 0.021 N 
141 8  CA A VAL 107 ? ? CB A VAL 107 ? ? 1.328 1.543 -0.215 0.021 N 
142 8  CA A VAL 120 ? ? CB A VAL 120 ? ? 1.332 1.543 -0.211 0.021 N 
143 8  CA A VAL 122 ? ? CB A VAL 122 ? ? 1.336 1.543 -0.207 0.021 N 
144 8  CA A VAL 125 ? ? CB A VAL 125 ? ? 1.331 1.543 -0.212 0.021 N 
145 9  CA A ILE 31  ? ? CB A ILE 31  ? ? 1.331 1.544 -0.213 0.023 N 
146 9  CA A ILE 39  ? ? CB A ILE 39  ? ? 1.321 1.544 -0.223 0.023 N 
147 9  CA A ILE 49  ? ? CB A ILE 49  ? ? 1.330 1.544 -0.214 0.023 N 
148 9  CA A THR 50  ? ? CB A THR 50  ? ? 1.321 1.529 -0.208 0.026 N 
149 9  CA A VAL 57  ? ? CB A VAL 57  ? ? 1.332 1.543 -0.211 0.021 N 
150 9  CA A ILE 58  ? ? CB A ILE 58  ? ? 1.329 1.544 -0.215 0.023 N 
151 9  CA A VAL 66  ? ? CB A VAL 66  ? ? 1.334 1.543 -0.209 0.021 N 
152 9  CA A THR 70  ? ? CB A THR 70  ? ? 1.322 1.529 -0.207 0.026 N 
153 9  CA A VAL 83  ? ? CB A VAL 83  ? ? 1.326 1.543 -0.217 0.021 N 
154 9  CA A THR 90  ? ? CB A THR 90  ? ? 1.335 1.529 -0.194 0.026 N 
155 9  CA A THR 95  ? ? CB A THR 95  ? ? 1.327 1.529 -0.202 0.026 N 
156 9  CA A THR 101 ? ? CB A THR 101 ? ? 1.321 1.529 -0.208 0.026 N 
157 9  CA A THR 103 ? ? CB A THR 103 ? ? 1.315 1.529 -0.214 0.026 N 
158 9  CA A VAL 105 ? ? CB A VAL 105 ? ? 1.326 1.543 -0.217 0.021 N 
159 9  CA A VAL 107 ? ? CB A VAL 107 ? ? 1.323 1.543 -0.220 0.021 N 
160 9  CA A VAL 120 ? ? CB A VAL 120 ? ? 1.332 1.543 -0.211 0.021 N 
161 9  CA A VAL 122 ? ? CB A VAL 122 ? ? 1.328 1.543 -0.215 0.021 N 
162 9  CA A VAL 125 ? ? CB A VAL 125 ? ? 1.328 1.543 -0.215 0.021 N 
163 10 CA A ILE 31  ? ? CB A ILE 31  ? ? 1.341 1.544 -0.203 0.023 N 
164 10 CA A ILE 39  ? ? CB A ILE 39  ? ? 1.328 1.544 -0.216 0.023 N 
165 10 CA A ILE 49  ? ? CB A ILE 49  ? ? 1.328 1.544 -0.216 0.023 N 
166 10 CA A THR 50  ? ? CB A THR 50  ? ? 1.347 1.529 -0.182 0.026 N 
167 10 CA A VAL 57  ? ? CB A VAL 57  ? ? 1.337 1.543 -0.206 0.021 N 
168 10 CA A ILE 58  ? ? CB A ILE 58  ? ? 1.339 1.544 -0.205 0.023 N 
169 10 CA A VAL 66  ? ? CB A VAL 66  ? ? 1.337 1.543 -0.206 0.021 N 
170 10 CA A THR 70  ? ? CB A THR 70  ? ? 1.320 1.529 -0.209 0.026 N 
171 10 CA A VAL 83  ? ? CB A VAL 83  ? ? 1.322 1.543 -0.221 0.021 N 
172 10 CA A THR 90  ? ? CB A THR 90  ? ? 1.332 1.529 -0.197 0.026 N 
173 10 CA A THR 95  ? ? CB A THR 95  ? ? 1.330 1.529 -0.199 0.026 N 
174 10 CA A THR 101 ? ? CB A THR 101 ? ? 1.338 1.529 -0.191 0.026 N 
175 10 CA A THR 103 ? ? CB A THR 103 ? ? 1.317 1.529 -0.212 0.026 N 
176 10 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.326 1.543 -0.217 0.021 N 
177 10 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.326 1.543 -0.217 0.021 N 
178 10 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.331 1.543 -0.212 0.021 N 
179 10 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.335 1.543 -0.208 0.021 N 
180 10 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.338 1.543 -0.205 0.021 N 
181 11 CA A ILE 31  ? ? CB A ILE 31  ? ? 1.328 1.544 -0.216 0.023 N 
182 11 CA A ILE 39  ? ? CB A ILE 39  ? ? 1.335 1.544 -0.209 0.023 N 
183 11 CA A ILE 49  ? ? CB A ILE 49  ? ? 1.331 1.544 -0.213 0.023 N 
184 11 CA A THR 50  ? ? CB A THR 50  ? ? 1.314 1.529 -0.215 0.026 N 
185 11 CA A VAL 57  ? ? CB A VAL 57  ? ? 1.331 1.543 -0.212 0.021 N 
186 11 CA A ILE 58  ? ? CB A ILE 58  ? ? 1.341 1.544 -0.203 0.023 N 
187 11 CA A VAL 66  ? ? CB A VAL 66  ? ? 1.336 1.543 -0.207 0.021 N 
188 11 CA A THR 70  ? ? CB A THR 70  ? ? 1.323 1.529 -0.206 0.026 N 
189 11 CA A VAL 83  ? ? CB A VAL 83  ? ? 1.326 1.543 -0.217 0.021 N 
190 11 CA A THR 90  ? ? CB A THR 90  ? ? 1.321 1.529 -0.208 0.026 N 
191 11 CA A THR 95  ? ? CB A THR 95  ? ? 1.328 1.529 -0.201 0.026 N 
192 11 CA A THR 101 ? ? CB A THR 101 ? ? 1.338 1.529 -0.191 0.026 N 
193 11 CA A THR 103 ? ? CB A THR 103 ? ? 1.321 1.529 -0.208 0.026 N 
194 11 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.324 1.543 -0.219 0.021 N 
195 11 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.330 1.543 -0.213 0.021 N 
196 11 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.334 1.543 -0.209 0.021 N 
197 11 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.338 1.543 -0.205 0.021 N 
198 11 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.326 1.543 -0.217 0.021 N 
199 12 CA A ILE 31  ? ? CB A ILE 31  ? ? 1.329 1.544 -0.215 0.023 N 
200 12 CA A ILE 39  ? ? CB A ILE 39  ? ? 1.318 1.544 -0.226 0.023 N 
201 12 CA A ILE 49  ? ? CB A ILE 49  ? ? 1.333 1.544 -0.211 0.023 N 
202 12 CA A THR 50  ? ? CB A THR 50  ? ? 1.327 1.529 -0.202 0.026 N 
203 12 CA A VAL 57  ? ? CB A VAL 57  ? ? 1.329 1.543 -0.214 0.021 N 
204 12 CA A ILE 58  ? ? CB A ILE 58  ? ? 1.325 1.544 -0.219 0.023 N 
205 12 CA A VAL 66  ? ? CB A VAL 66  ? ? 1.338 1.543 -0.205 0.021 N 
206 12 CA A THR 70  ? ? CB A THR 70  ? ? 1.316 1.529 -0.213 0.026 N 
207 12 CA A VAL 83  ? ? CB A VAL 83  ? ? 1.323 1.543 -0.220 0.021 N 
208 12 CA A THR 90  ? ? CB A THR 90  ? ? 1.333 1.529 -0.196 0.026 N 
209 12 CA A THR 95  ? ? CB A THR 95  ? ? 1.332 1.529 -0.197 0.026 N 
210 12 CA A THR 101 ? ? CB A THR 101 ? ? 1.317 1.529 -0.212 0.026 N 
211 12 CA A THR 103 ? ? CB A THR 103 ? ? 1.321 1.529 -0.208 0.026 N 
212 12 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.324 1.543 -0.219 0.021 N 
213 12 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.332 1.543 -0.211 0.021 N 
214 12 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.332 1.543 -0.211 0.021 N 
215 12 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.335 1.543 -0.208 0.021 N 
216 12 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.338 1.543 -0.205 0.021 N 
217 13 CA A ILE 31  ? ? CB A ILE 31  ? ? 1.344 1.544 -0.200 0.023 N 
218 13 CA A ILE 39  ? ? CB A ILE 39  ? ? 1.328 1.544 -0.216 0.023 N 
219 13 CA A ILE 49  ? ? CB A ILE 49  ? ? 1.327 1.544 -0.217 0.023 N 
220 13 CA A THR 50  ? ? CB A THR 50  ? ? 1.333 1.529 -0.196 0.026 N 
221 13 CA A VAL 57  ? ? CB A VAL 57  ? ? 1.337 1.543 -0.206 0.021 N 
222 13 CA A ILE 58  ? ? CB A ILE 58  ? ? 1.338 1.544 -0.206 0.023 N 
223 13 CA A VAL 66  ? ? CB A VAL 66  ? ? 1.336 1.543 -0.207 0.021 N 
224 13 CA A THR 70  ? ? CB A THR 70  ? ? 1.316 1.529 -0.213 0.026 N 
225 13 CA A VAL 83  ? ? CB A VAL 83  ? ? 1.322 1.543 -0.221 0.021 N 
226 13 CA A THR 90  ? ? CB A THR 90  ? ? 1.324 1.529 -0.205 0.026 N 
227 13 CA A THR 95  ? ? CB A THR 95  ? ? 1.320 1.529 -0.209 0.026 N 
228 13 CA A THR 101 ? ? CB A THR 101 ? ? 1.333 1.529 -0.196 0.026 N 
229 13 CA A THR 103 ? ? CB A THR 103 ? ? 1.318 1.529 -0.211 0.026 N 
230 13 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.325 1.543 -0.218 0.021 N 
231 13 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.333 1.543 -0.210 0.021 N 
232 13 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.333 1.543 -0.210 0.021 N 
233 13 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.329 1.543 -0.214 0.021 N 
234 13 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.342 1.543 -0.201 0.021 N 
235 14 CA A ILE 31  ? ? CB A ILE 31  ? ? 1.331 1.544 -0.213 0.023 N 
236 14 CA A ILE 39  ? ? CB A ILE 39  ? ? 1.334 1.544 -0.210 0.023 N 
237 14 CA A ILE 49  ? ? CB A ILE 49  ? ? 1.329 1.544 -0.215 0.023 N 
238 14 CA A THR 50  ? ? CB A THR 50  ? ? 1.333 1.529 -0.196 0.026 N 
239 14 CA A VAL 57  ? ? CB A VAL 57  ? ? 1.333 1.543 -0.210 0.021 N 
240 14 CA A ILE 58  ? ? CB A ILE 58  ? ? 1.333 1.544 -0.211 0.023 N 
241 14 CA A VAL 66  ? ? CB A VAL 66  ? ? 1.328 1.543 -0.215 0.021 N 
242 14 CA A THR 70  ? ? CB A THR 70  ? ? 1.332 1.529 -0.197 0.026 N 
243 14 CA A VAL 83  ? ? CB A VAL 83  ? ? 1.323 1.543 -0.220 0.021 N 
244 14 CA A THR 90  ? ? CB A THR 90  ? ? 1.330 1.529 -0.199 0.026 N 
245 14 CA A THR 95  ? ? CB A THR 95  ? ? 1.317 1.529 -0.212 0.026 N 
246 14 CA A THR 101 ? ? CB A THR 101 ? ? 1.321 1.529 -0.208 0.026 N 
247 14 CA A THR 103 ? ? CB A THR 103 ? ? 1.318 1.529 -0.211 0.026 N 
248 14 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.321 1.543 -0.222 0.021 N 
249 14 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.328 1.543 -0.215 0.021 N 
250 14 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.330 1.543 -0.213 0.021 N 
251 14 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.334 1.543 -0.209 0.021 N 
252 14 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.329 1.543 -0.214 0.021 N 
253 15 CA A ILE 31  ? ? CB A ILE 31  ? ? 1.329 1.544 -0.215 0.023 N 
254 15 CA A ILE 39  ? ? CB A ILE 39  ? ? 1.325 1.544 -0.219 0.023 N 
255 15 CA A ILE 49  ? ? CB A ILE 49  ? ? 1.339 1.544 -0.205 0.023 N 
256 15 CA A THR 50  ? ? CB A THR 50  ? ? 1.323 1.529 -0.206 0.026 N 
257 15 CA A VAL 57  ? ? CB A VAL 57  ? ? 1.333 1.543 -0.210 0.021 N 
258 15 CA A ILE 58  ? ? CB A ILE 58  ? ? 1.339 1.544 -0.205 0.023 N 
259 15 CA A VAL 66  ? ? CB A VAL 66  ? ? 1.343 1.543 -0.200 0.021 N 
260 15 CA A THR 70  ? ? CB A THR 70  ? ? 1.333 1.529 -0.196 0.026 N 
261 15 CA A VAL 83  ? ? CB A VAL 83  ? ? 1.323 1.543 -0.220 0.021 N 
262 15 CA A THR 90  ? ? CB A THR 90  ? ? 1.335 1.529 -0.194 0.026 N 
263 15 CA A THR 95  ? ? CB A THR 95  ? ? 1.325 1.529 -0.204 0.026 N 
264 15 CA A THR 101 ? ? CB A THR 101 ? ? 1.322 1.529 -0.207 0.026 N 
265 15 CA A THR 103 ? ? CB A THR 103 ? ? 1.324 1.529 -0.205 0.026 N 
266 15 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.324 1.543 -0.219 0.021 N 
267 15 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.326 1.543 -0.217 0.021 N 
268 15 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.332 1.543 -0.211 0.021 N 
269 15 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.328 1.543 -0.215 0.021 N 
270 15 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.326 1.543 -0.217 0.021 N 
271 16 CA A ILE 31  ? ? CB A ILE 31  ? ? 1.330 1.544 -0.214 0.023 N 
272 16 CA A ILE 39  ? ? CB A ILE 39  ? ? 1.337 1.544 -0.207 0.023 N 
273 16 CA A ILE 49  ? ? CB A ILE 49  ? ? 1.323 1.544 -0.221 0.023 N 
274 16 CA A THR 50  ? ? CB A THR 50  ? ? 1.333 1.529 -0.196 0.026 N 
275 16 CA A VAL 57  ? ? CB A VAL 57  ? ? 1.336 1.543 -0.207 0.021 N 
276 16 CA A ILE 58  ? ? CB A ILE 58  ? ? 1.339 1.544 -0.205 0.023 N 
277 16 CA A VAL 66  ? ? CB A VAL 66  ? ? 1.329 1.543 -0.214 0.021 N 
278 16 CA A THR 70  ? ? CB A THR 70  ? ? 1.319 1.529 -0.210 0.026 N 
279 16 CA A VAL 83  ? ? CB A VAL 83  ? ? 1.324 1.543 -0.219 0.021 N 
280 16 CA A THR 90  ? ? CB A THR 90  ? ? 1.336 1.529 -0.193 0.026 N 
281 16 CA A THR 95  ? ? CB A THR 95  ? ? 1.324 1.529 -0.205 0.026 N 
282 16 CA A THR 101 ? ? CB A THR 101 ? ? 1.322 1.529 -0.207 0.026 N 
283 16 CA A THR 103 ? ? CB A THR 103 ? ? 1.325 1.529 -0.204 0.026 N 
284 16 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.321 1.543 -0.222 0.021 N 
285 16 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.329 1.543 -0.214 0.021 N 
286 16 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.335 1.543 -0.208 0.021 N 
287 16 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.339 1.543 -0.204 0.021 N 
288 16 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.328 1.543 -0.215 0.021 N 
289 17 CA A ILE 31  ? ? CB A ILE 31  ? ? 1.340 1.544 -0.204 0.023 N 
290 17 CA A ILE 39  ? ? CB A ILE 39  ? ? 1.329 1.544 -0.215 0.023 N 
291 17 CA A ILE 49  ? ? CB A ILE 49  ? ? 1.327 1.544 -0.217 0.023 N 
292 17 CA A THR 50  ? ? CB A THR 50  ? ? 1.316 1.529 -0.213 0.026 N 
293 17 CA A VAL 57  ? ? CB A VAL 57  ? ? 1.328 1.543 -0.215 0.021 N 
294 17 CA A ILE 58  ? ? CB A ILE 58  ? ? 1.338 1.544 -0.206 0.023 N 
295 17 CA A VAL 66  ? ? CB A VAL 66  ? ? 1.336 1.543 -0.207 0.021 N 
296 17 CA A THR 70  ? ? CB A THR 70  ? ? 1.322 1.529 -0.207 0.026 N 
297 17 CA A VAL 83  ? ? CB A VAL 83  ? ? 1.326 1.543 -0.217 0.021 N 
298 17 CA A THR 90  ? ? CB A THR 90  ? ? 1.336 1.529 -0.193 0.026 N 
299 17 CA A THR 95  ? ? CB A THR 95  ? ? 1.329 1.529 -0.200 0.026 N 
300 17 CA A THR 101 ? ? CB A THR 101 ? ? 1.320 1.529 -0.209 0.026 N 
301 17 CA A THR 103 ? ? CB A THR 103 ? ? 1.315 1.529 -0.214 0.026 N 
302 17 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.330 1.543 -0.213 0.021 N 
303 17 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.331 1.543 -0.212 0.021 N 
304 17 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.326 1.543 -0.217 0.021 N 
305 17 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.326 1.543 -0.217 0.021 N 
306 17 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.327 1.543 -0.216 0.021 N 
307 18 CA A ILE 31  ? ? CB A ILE 31  ? ? 1.329 1.544 -0.215 0.023 N 
308 18 CA A ILE 39  ? ? CB A ILE 39  ? ? 1.332 1.544 -0.212 0.023 N 
309 18 CA A ILE 49  ? ? CB A ILE 49  ? ? 1.335 1.544 -0.209 0.023 N 
310 18 CA A THR 50  ? ? CB A THR 50  ? ? 1.326 1.529 -0.203 0.026 N 
311 18 CA A VAL 57  ? ? CB A VAL 57  ? ? 1.333 1.543 -0.210 0.021 N 
312 18 CA A ILE 58  ? ? CB A ILE 58  ? ? 1.329 1.544 -0.215 0.023 N 
313 18 CA A VAL 66  ? ? CB A VAL 66  ? ? 1.328 1.543 -0.215 0.021 N 
314 18 CA A THR 70  ? ? CB A THR 70  ? ? 1.323 1.529 -0.206 0.026 N 
315 18 CA A VAL 83  ? ? CB A VAL 83  ? ? 1.327 1.543 -0.216 0.021 N 
316 18 CA A THR 90  ? ? CB A THR 90  ? ? 1.333 1.529 -0.196 0.026 N 
317 18 CA A THR 95  ? ? CB A THR 95  ? ? 1.319 1.529 -0.210 0.026 N 
318 18 CA A THR 101 ? ? CB A THR 101 ? ? 1.338 1.529 -0.191 0.026 N 
319 18 CA A THR 103 ? ? CB A THR 103 ? ? 1.320 1.529 -0.209 0.026 N 
320 18 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.324 1.543 -0.219 0.021 N 
321 18 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.327 1.543 -0.216 0.021 N 
322 18 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.332 1.543 -0.211 0.021 N 
323 18 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.336 1.543 -0.207 0.021 N 
324 18 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.333 1.543 -0.210 0.021 N 
325 19 CA A ILE 31  ? ? CB A ILE 31  ? ? 1.340 1.544 -0.204 0.023 N 
326 19 CA A ILE 39  ? ? CB A ILE 39  ? ? 1.334 1.544 -0.210 0.023 N 
327 19 CA A ILE 49  ? ? CB A ILE 49  ? ? 1.336 1.544 -0.208 0.023 N 
328 19 CA A THR 50  ? ? CB A THR 50  ? ? 1.319 1.529 -0.210 0.026 N 
329 19 CA A VAL 57  ? ? CB A VAL 57  ? ? 1.343 1.543 -0.200 0.021 N 
330 19 CA A ILE 58  ? ? CB A ILE 58  ? ? 1.330 1.544 -0.214 0.023 N 
331 19 CA A VAL 66  ? ? CB A VAL 66  ? ? 1.341 1.543 -0.202 0.021 N 
332 19 CA A THR 70  ? ? CB A THR 70  ? ? 1.326 1.529 -0.203 0.026 N 
333 19 CA A VAL 83  ? ? CB A VAL 83  ? ? 1.324 1.543 -0.219 0.021 N 
334 19 CA A THR 90  ? ? CB A THR 90  ? ? 1.339 1.529 -0.190 0.026 N 
335 19 CA A THR 95  ? ? CB A THR 95  ? ? 1.319 1.529 -0.210 0.026 N 
336 19 CA A THR 101 ? ? CB A THR 101 ? ? 1.317 1.529 -0.212 0.026 N 
337 19 CA A THR 103 ? ? CB A THR 103 ? ? 1.318 1.529 -0.211 0.026 N 
338 19 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.324 1.543 -0.219 0.021 N 
339 19 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.331 1.543 -0.212 0.021 N 
340 19 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.330 1.543 -0.213 0.021 N 
341 19 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.335 1.543 -0.208 0.021 N 
342 19 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.332 1.543 -0.211 0.021 N 
343 20 CA A ILE 31  ? ? CB A ILE 31  ? ? 1.328 1.544 -0.216 0.023 N 
344 20 CA A ILE 39  ? ? CB A ILE 39  ? ? 1.320 1.544 -0.224 0.023 N 
345 20 CA A ILE 49  ? ? CB A ILE 49  ? ? 1.330 1.544 -0.214 0.023 N 
346 20 CA A THR 50  ? ? CB A THR 50  ? ? 1.332 1.529 -0.197 0.026 N 
347 20 CA A VAL 57  ? ? CB A VAL 57  ? ? 1.337 1.543 -0.206 0.021 N 
348 20 CA A ILE 58  ? ? CB A ILE 58  ? ? 1.339 1.544 -0.205 0.023 N 
349 20 CA A VAL 66  ? ? CB A VAL 66  ? ? 1.343 1.543 -0.200 0.021 N 
350 20 CA A THR 70  ? ? CB A THR 70  ? ? 1.329 1.529 -0.200 0.026 N 
351 20 CA A VAL 83  ? ? CB A VAL 83  ? ? 1.322 1.543 -0.221 0.021 N 
352 20 CA A THR 90  ? ? CB A THR 90  ? ? 1.334 1.529 -0.195 0.026 N 
353 20 CA A THR 95  ? ? CB A THR 95  ? ? 1.318 1.529 -0.211 0.026 N 
354 20 CA A THR 101 ? ? CB A THR 101 ? ? 1.321 1.529 -0.208 0.026 N 
355 20 CA A THR 103 ? ? CB A THR 103 ? ? 1.320 1.529 -0.209 0.026 N 
356 20 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.326 1.543 -0.217 0.021 N 
357 20 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.329 1.543 -0.214 0.021 N 
358 20 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.331 1.543 -0.212 0.021 N 
359 20 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.337 1.543 -0.206 0.021 N 
360 20 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.338 1.543 -0.205 0.021 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  ALA A 44  ? ? 176.18  -32.53  
2   1  GLU A 46  ? ? -147.45 40.46   
3   1  LYS A 55  ? ? -99.05  32.20   
4   1  ILE A 58  ? ? 50.73   166.66  
5   1  TYR A 76  ? ? 50.40   -113.60 
6   1  ASN A 87  ? ? -157.18 48.65   
7   1  TYR A 98  ? ? -100.31 -166.51 
8   1  MET A 100 ? ? -95.74  33.40   
9   2  ALA A 44  ? ? -170.20 13.04   
10  2  PRO A 54  ? ? -83.40  36.94   
11  2  ILE A 58  ? ? 37.85   73.53   
12  2  PHE A 62  ? ? 34.82   79.09   
13  2  VAL A 66  ? ? 54.79   78.72   
14  2  ALA A 67  ? ? -39.56  105.95  
15  2  GLU A 74  ? ? -80.10  43.65   
16  2  TYR A 76  ? ? 52.22   -96.98  
17  2  ASN A 87  ? ? -164.00 54.63   
18  2  LEU A 88  ? ? -65.37  96.11   
19  2  ASP A 97  ? ? 63.94   -168.14 
20  2  TYR A 98  ? ? -155.74 2.84    
21  2  LEU A 113 ? ? -67.07  1.27    
22  2  SER A 117 ? ? 179.25  151.32  
23  3  GLU A 46  ? ? 67.57   103.18  
24  3  ILE A 49  ? ? 33.97   47.75   
25  3  GLN A 56  ? ? -107.16 44.32   
26  3  LYS A 60  ? ? -69.25  90.45   
27  3  ALA A 67  ? ? -38.22  110.27  
28  3  CYS A 69  ? ? 61.94   179.43  
29  3  TYR A 76  ? ? 54.15   -106.30 
30  3  ASN A 87  ? ? -162.85 55.75   
31  3  LEU A 88  ? ? -69.07  83.61   
32  3  ASP A 97  ? ? -84.44  -123.18 
33  3  MET A 100 ? ? 48.25   21.72   
34  3  PRO A 102 ? ? -80.07  -73.84  
35  4  GLN A 56  ? ? -161.81 -46.94  
36  4  ASP A 65  ? ? -172.07 120.21  
37  4  VAL A 66  ? ? -150.35 37.33   
38  4  ALA A 67  ? ? 61.86   106.45  
39  4  SER A 72  ? ? 57.02   79.29   
40  4  GLU A 74  ? ? -167.63 -49.92  
41  4  ASN A 87  ? ? -158.89 50.19   
42  4  TYR A 98  ? ? 177.50  -149.37 
43  4  PRO A 102 ? ? -56.41  86.82   
44  5  ALA A 27  ? ? 69.35   145.39  
45  5  GLU A 46  ? ? 68.14   -178.82 
46  5  THR A 50  ? ? -95.00  49.22   
47  5  ILE A 58  ? ? 38.70   73.44   
48  5  LYS A 64  ? ? -170.15 141.64  
49  5  ASN A 87  ? ? -169.96 62.61   
50  5  LEU A 88  ? ? -38.45  102.35  
51  5  ASP A 97  ? ? -69.46  -79.52  
52  5  MET A 100 ? ? 177.84  -53.19  
53  6  THR A 50  ? ? 57.29   75.44   
54  6  ILE A 58  ? ? 69.49   148.34  
55  6  VAL A 66  ? ? -122.84 -51.27  
56  6  ALA A 67  ? ? 169.15  136.64  
57  6  PRO A 68  ? ? -69.08  92.87   
58  6  CYS A 69  ? ? -154.92 27.94   
59  6  ASP A 71  ? ? -58.48  -94.09  
60  6  SER A 72  ? ? 172.37  135.87  
61  6  ASN A 87  ? ? -156.04 52.59   
62  6  PRO A 102 ? ? -69.39  86.12   
63  6  LYS A 111 ? ? -57.72  106.79  
64  7  ALA A 27  ? ? 68.86   143.81  
65  7  PHE A 28  ? ? -170.24 -68.62  
66  7  LYS A 55  ? ? 32.32   77.82   
67  7  GLN A 56  ? ? -157.09 -71.10  
68  7  PHE A 62  ? ? -160.18 109.46  
69  7  ALA A 67  ? ? -152.64 -50.36  
70  7  ASP A 71  ? ? 61.04   -92.12  
71  7  TYR A 76  ? ? 69.79   -80.54  
72  7  ASN A 87  ? ? -166.02 62.14   
73  7  LEU A 88  ? ? -68.86  98.24   
74  7  PHE A 96  ? ? -69.29  92.66   
75  7  GLN A 99  ? ? 61.19   -145.08 
76  7  SER A 117 ? ? 179.98  156.50  
77  8  LEU A 40  ? ? -102.17 -65.24  
78  8  GLU A 46  ? ? -63.59  88.72   
79  8  ILE A 58  ? ? 38.13   64.28   
80  8  PHE A 63  ? ? -121.50 -58.20  
81  8  ALA A 67  ? ? 69.48   95.84   
82  8  ASN A 87  ? ? -153.78 52.30   
83  8  LEU A 88  ? ? -67.24  86.45   
84  8  GLN A 99  ? ? -95.13  -66.58  
85  9  ALA A 27  ? ? 68.95   -76.79  
86  9  ASP A 36  ? ? -135.44 -33.51  
87  9  ALA A 44  ? ? -174.63 98.94   
88  9  LYS A 64  ? ? -173.10 120.94  
89  9  THR A 70  ? ? -135.23 -62.47  
90  9  ASN A 87  ? ? -148.56 49.30   
91  9  GLN A 99  ? ? 68.81   -59.84  
92  9  PRO A 102 ? ? -91.55  45.03   
93  9  ASP A 116 ? ? -87.45  41.42   
94  10 GLU A 46  ? ? -68.54  99.40   
95  10 PRO A 54  ? ? -75.18  39.29   
96  10 VAL A 57  ? ? -86.14  36.16   
97  10 PHE A 63  ? ? -81.79  37.02   
98  10 ASP A 65  ? ? 62.00   71.67   
99  10 CYS A 69  ? ? -151.00 -159.90 
100 10 ASP A 71  ? ? 66.59   107.24  
101 10 LYS A 78  ? ? 53.65   70.22   
102 10 ASN A 87  ? ? -175.23 69.98   
103 10 LEU A 88  ? ? -58.75  88.09   
104 10 TYR A 98  ? ? 65.13   -89.02  
105 10 GLN A 99  ? ? -161.76 -55.37  
106 10 MET A 100 ? ? -105.57 -70.80  
107 10 ASP A 116 ? ? -86.58  34.09   
108 11 VAL A 57  ? ? -111.48 74.65   
109 11 PHE A 62  ? ? -151.01 5.29    
110 11 PHE A 63  ? ? 63.31   -95.20  
111 11 ASN A 87  ? ? -148.42 50.28   
112 11 PRO A 102 ? ? -58.65  88.62   
113 12 ILE A 49  ? ? -92.67  44.04   
114 12 LYS A 55  ? ? 64.06   94.31   
115 12 VAL A 57  ? ? 62.61   -70.15  
116 12 PHE A 62  ? ? -61.59  99.31   
117 12 VAL A 66  ? ? 37.77   43.13   
118 12 ASP A 71  ? ? -167.76 -69.99  
119 12 PRO A 73  ? ? -73.92  40.51   
120 12 GLU A 74  ? ? 65.72   -179.20 
121 12 ASN A 87  ? ? -163.40 55.57   
122 12 LEU A 88  ? ? -68.65  88.95   
123 12 ASP A 97  ? ? -88.10  -151.61 
124 13 GLN A 56  ? ? -127.10 -87.01  
125 13 VAL A 57  ? ? -136.46 -44.56  
126 13 ASP A 65  ? ? 74.84   -54.24  
127 13 ASN A 87  ? ? -140.31 42.46   
128 13 LEU A 88  ? ? -69.21  89.13   
129 13 ASP A 97  ? ? 69.33   171.71  
130 13 TYR A 98  ? ? 67.46   -171.80 
131 13 GLN A 99  ? ? 71.17   -178.16 
132 13 THR A 103 ? ? -56.57  98.29   
133 14 ASP A 36  ? ? -140.47 -33.67  
134 14 LEU A 40  ? ? -106.08 -62.69  
135 14 PRO A 54  ? ? -36.75  97.31   
136 14 LYS A 64  ? ? -149.95 29.86   
137 14 THR A 70  ? ? 66.76   158.01  
138 14 PRO A 73  ? ? -81.30  37.92   
139 14 TYR A 76  ? ? 50.43   122.87  
140 14 ASN A 87  ? ? -162.28 59.13   
141 14 LEU A 88  ? ? -60.60  93.01   
142 14 GLN A 99  ? ? -112.32 -148.80 
143 14 THR A 103 ? ? -67.18  97.35   
144 15 PHE A 28  ? ? -124.26 -57.60  
145 15 GLU A 46  ? ? 64.35   70.71   
146 15 LYS A 64  ? ? 177.58  82.12   
147 15 ASP A 65  ? ? -98.88  -69.24  
148 15 VAL A 66  ? ? 35.84   64.33   
149 15 PRO A 73  ? ? -81.34  41.47   
150 15 PHE A 75  ? ? -158.61 42.45   
151 15 TYR A 76  ? ? -119.33 -97.83  
152 15 LYS A 78  ? ? 63.26   86.06   
153 15 ASN A 87  ? ? -165.54 48.66   
154 15 LEU A 88  ? ? -58.28  93.81   
155 15 TYR A 98  ? ? -155.32 -60.39  
156 15 GLN A 99  ? ? -158.13 -78.00  
157 15 MET A 100 ? ? -118.58 -87.76  
158 16 THR A 50  ? ? 67.22   150.42  
159 16 ILE A 58  ? ? 37.31   65.58   
160 16 PHE A 62  ? ? 174.26  132.94  
161 16 PRO A 68  ? ? -65.86  80.76   
162 16 SER A 72  ? ? -168.65 -45.90  
163 16 PHE A 75  ? ? 73.90   -28.17  
164 16 TYR A 76  ? ? 47.76   -97.89  
165 16 ASN A 87  ? ? -171.42 66.61   
166 16 LEU A 88  ? ? -56.44  88.11   
167 16 TYR A 98  ? ? -130.19 -82.61  
168 16 GLN A 99  ? ? 67.18   -67.32  
169 16 MET A 100 ? ? -171.24 -59.51  
170 16 PRO A 102 ? ? -45.29  101.09  
171 16 LYS A 111 ? ? -56.82  108.38  
172 16 ASP A 116 ? ? 26.96   72.48   
173 17 PHE A 28  ? ? 71.71   152.21  
174 17 THR A 50  ? ? -60.34  95.13   
175 17 VAL A 57  ? ? -100.56 47.69   
176 17 VAL A 66  ? ? -148.90 37.96   
177 17 CYS A 69  ? ? -151.92 78.94   
178 17 THR A 70  ? ? -123.57 -50.12  
179 17 PRO A 73  ? ? -41.24  103.95  
180 17 TYR A 76  ? ? -68.49  -72.47  
181 17 ASN A 87  ? ? -158.37 44.80   
182 17 LEU A 88  ? ? -66.06  86.40   
183 17 GLN A 99  ? ? -179.36 86.27   
184 17 MET A 100 ? ? 77.70   -14.71  
185 18 ASP A 36  ? ? 174.75  -57.17  
186 18 PHE A 62  ? ? -164.95 88.34   
187 18 PHE A 63  ? ? -72.52  -73.53  
188 18 LYS A 64  ? ? -150.70 71.91   
189 18 THR A 70  ? ? 71.07   -54.40  
190 18 SER A 72  ? ? -159.79 -43.25  
191 18 TYR A 76  ? ? -114.97 -76.15  
192 18 ASN A 87  ? ? -162.37 52.74   
193 18 TYR A 98  ? ? 73.27   -14.46  
194 19 ALA A 44  ? ? 72.30   166.66  
195 19 LYS A 55  ? ? 59.67   71.19   
196 19 VAL A 57  ? ? -69.24  87.54   
197 19 ILE A 58  ? ? 60.40   73.65   
198 19 PHE A 62  ? ? 48.57   83.02   
199 19 LYS A 64  ? ? -149.94 -73.94  
200 19 ASP A 65  ? ? 68.26   -14.68  
201 19 GLU A 74  ? ? 66.83   -77.30  
202 19 ASN A 87  ? ? -162.34 57.27   
203 19 LEU A 88  ? ? -65.08  81.41   
204 19 TYR A 98  ? ? -155.82 -69.02  
205 19 GLN A 99  ? ? -159.82 32.24   
206 19 PRO A 102 ? ? -62.38  94.78   
207 19 ASP A 116 ? ? -88.68  49.02   
208 20 ILE A 49  ? ? -102.76 53.67   
209 20 THR A 50  ? ? 69.83   159.98  
210 20 LYS A 55  ? ? -84.00  38.24   
211 20 VAL A 57  ? ? -96.67  51.63   
212 20 VAL A 66  ? ? -153.94 -60.70  
213 20 ALA A 67  ? ? 39.91   70.14   
214 20 PRO A 73  ? ? -67.70  -73.99  
215 20 PHE A 75  ? ? 68.16   97.40   
216 20 ASN A 87  ? ? -162.55 59.21   
217 20 LEU A 88  ? ? -64.76  84.79   
218 20 TYR A 98  ? ? 73.37   -40.40  
219 20 PRO A 102 ? ? -78.05  42.21   
220 20 THR A 103 ? ? -64.89  98.87   
221 20 SER A 117 ? ? 60.40   155.67  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1  Y 1 A HIS 13 ? A HIS 1  
2   1  Y 1 A HIS 14 ? A HIS 2  
3   1  Y 1 A HIS 15 ? A HIS 3  
4   1  Y 1 A HIS 16 ? A HIS 4  
5   1  Y 1 A HIS 17 ? A HIS 5  
6   1  Y 1 A HIS 18 ? A HIS 6  
7   1  Y 1 A GLU 19 ? A GLU 7  
8   1  Y 1 A SER 20 ? A SER 8  
9   1  Y 1 A ASP 21 ? A ASP 9  
10  1  Y 1 A ASP 22 ? A ASP 10 
11  1  Y 1 A ASP 23 ? A ASP 11 
12  1  Y 1 A ASP 24 ? A ASP 12 
13  1  Y 1 A LYS 25 ? A LYS 13 
14  2  Y 1 A HIS 13 ? A HIS 1  
15  2  Y 1 A HIS 14 ? A HIS 2  
16  2  Y 1 A HIS 15 ? A HIS 3  
17  2  Y 1 A HIS 16 ? A HIS 4  
18  2  Y 1 A HIS 17 ? A HIS 5  
19  2  Y 1 A HIS 18 ? A HIS 6  
20  2  Y 1 A GLU 19 ? A GLU 7  
21  2  Y 1 A SER 20 ? A SER 8  
22  2  Y 1 A ASP 21 ? A ASP 9  
23  2  Y 1 A ASP 22 ? A ASP 10 
24  2  Y 1 A ASP 23 ? A ASP 11 
25  2  Y 1 A ASP 24 ? A ASP 12 
26  2  Y 1 A LYS 25 ? A LYS 13 
27  3  Y 1 A HIS 13 ? A HIS 1  
28  3  Y 1 A HIS 14 ? A HIS 2  
29  3  Y 1 A HIS 15 ? A HIS 3  
30  3  Y 1 A HIS 16 ? A HIS 4  
31  3  Y 1 A HIS 17 ? A HIS 5  
32  3  Y 1 A HIS 18 ? A HIS 6  
33  3  Y 1 A GLU 19 ? A GLU 7  
34  3  Y 1 A SER 20 ? A SER 8  
35  3  Y 1 A ASP 21 ? A ASP 9  
36  3  Y 1 A ASP 22 ? A ASP 10 
37  3  Y 1 A ASP 23 ? A ASP 11 
38  3  Y 1 A ASP 24 ? A ASP 12 
39  3  Y 1 A LYS 25 ? A LYS 13 
40  4  Y 1 A HIS 13 ? A HIS 1  
41  4  Y 1 A HIS 14 ? A HIS 2  
42  4  Y 1 A HIS 15 ? A HIS 3  
43  4  Y 1 A HIS 16 ? A HIS 4  
44  4  Y 1 A HIS 17 ? A HIS 5  
45  4  Y 1 A HIS 18 ? A HIS 6  
46  4  Y 1 A GLU 19 ? A GLU 7  
47  4  Y 1 A SER 20 ? A SER 8  
48  4  Y 1 A ASP 21 ? A ASP 9  
49  4  Y 1 A ASP 22 ? A ASP 10 
50  4  Y 1 A ASP 23 ? A ASP 11 
51  4  Y 1 A ASP 24 ? A ASP 12 
52  4  Y 1 A LYS 25 ? A LYS 13 
53  5  Y 1 A HIS 13 ? A HIS 1  
54  5  Y 1 A HIS 14 ? A HIS 2  
55  5  Y 1 A HIS 15 ? A HIS 3  
56  5  Y 1 A HIS 16 ? A HIS 4  
57  5  Y 1 A HIS 17 ? A HIS 5  
58  5  Y 1 A HIS 18 ? A HIS 6  
59  5  Y 1 A GLU 19 ? A GLU 7  
60  5  Y 1 A SER 20 ? A SER 8  
61  5  Y 1 A ASP 21 ? A ASP 9  
62  5  Y 1 A ASP 22 ? A ASP 10 
63  5  Y 1 A ASP 23 ? A ASP 11 
64  5  Y 1 A ASP 24 ? A ASP 12 
65  5  Y 1 A LYS 25 ? A LYS 13 
66  6  Y 1 A HIS 13 ? A HIS 1  
67  6  Y 1 A HIS 14 ? A HIS 2  
68  6  Y 1 A HIS 15 ? A HIS 3  
69  6  Y 1 A HIS 16 ? A HIS 4  
70  6  Y 1 A HIS 17 ? A HIS 5  
71  6  Y 1 A HIS 18 ? A HIS 6  
72  6  Y 1 A GLU 19 ? A GLU 7  
73  6  Y 1 A SER 20 ? A SER 8  
74  6  Y 1 A ASP 21 ? A ASP 9  
75  6  Y 1 A ASP 22 ? A ASP 10 
76  6  Y 1 A ASP 23 ? A ASP 11 
77  6  Y 1 A ASP 24 ? A ASP 12 
78  6  Y 1 A LYS 25 ? A LYS 13 
79  7  Y 1 A HIS 13 ? A HIS 1  
80  7  Y 1 A HIS 14 ? A HIS 2  
81  7  Y 1 A HIS 15 ? A HIS 3  
82  7  Y 1 A HIS 16 ? A HIS 4  
83  7  Y 1 A HIS 17 ? A HIS 5  
84  7  Y 1 A HIS 18 ? A HIS 6  
85  7  Y 1 A GLU 19 ? A GLU 7  
86  7  Y 1 A SER 20 ? A SER 8  
87  7  Y 1 A ASP 21 ? A ASP 9  
88  7  Y 1 A ASP 22 ? A ASP 10 
89  7  Y 1 A ASP 23 ? A ASP 11 
90  7  Y 1 A ASP 24 ? A ASP 12 
91  7  Y 1 A LYS 25 ? A LYS 13 
92  8  Y 1 A HIS 13 ? A HIS 1  
93  8  Y 1 A HIS 14 ? A HIS 2  
94  8  Y 1 A HIS 15 ? A HIS 3  
95  8  Y 1 A HIS 16 ? A HIS 4  
96  8  Y 1 A HIS 17 ? A HIS 5  
97  8  Y 1 A HIS 18 ? A HIS 6  
98  8  Y 1 A GLU 19 ? A GLU 7  
99  8  Y 1 A SER 20 ? A SER 8  
100 8  Y 1 A ASP 21 ? A ASP 9  
101 8  Y 1 A ASP 22 ? A ASP 10 
102 8  Y 1 A ASP 23 ? A ASP 11 
103 8  Y 1 A ASP 24 ? A ASP 12 
104 8  Y 1 A LYS 25 ? A LYS 13 
105 9  Y 1 A HIS 13 ? A HIS 1  
106 9  Y 1 A HIS 14 ? A HIS 2  
107 9  Y 1 A HIS 15 ? A HIS 3  
108 9  Y 1 A HIS 16 ? A HIS 4  
109 9  Y 1 A HIS 17 ? A HIS 5  
110 9  Y 1 A HIS 18 ? A HIS 6  
111 9  Y 1 A GLU 19 ? A GLU 7  
112 9  Y 1 A SER 20 ? A SER 8  
113 9  Y 1 A ASP 21 ? A ASP 9  
114 9  Y 1 A ASP 22 ? A ASP 10 
115 9  Y 1 A ASP 23 ? A ASP 11 
116 9  Y 1 A ASP 24 ? A ASP 12 
117 9  Y 1 A LYS 25 ? A LYS 13 
118 10 Y 1 A HIS 13 ? A HIS 1  
119 10 Y 1 A HIS 14 ? A HIS 2  
120 10 Y 1 A HIS 15 ? A HIS 3  
121 10 Y 1 A HIS 16 ? A HIS 4  
122 10 Y 1 A HIS 17 ? A HIS 5  
123 10 Y 1 A HIS 18 ? A HIS 6  
124 10 Y 1 A GLU 19 ? A GLU 7  
125 10 Y 1 A SER 20 ? A SER 8  
126 10 Y 1 A ASP 21 ? A ASP 9  
127 10 Y 1 A ASP 22 ? A ASP 10 
128 10 Y 1 A ASP 23 ? A ASP 11 
129 10 Y 1 A ASP 24 ? A ASP 12 
130 10 Y 1 A LYS 25 ? A LYS 13 
131 11 Y 1 A HIS 13 ? A HIS 1  
132 11 Y 1 A HIS 14 ? A HIS 2  
133 11 Y 1 A HIS 15 ? A HIS 3  
134 11 Y 1 A HIS 16 ? A HIS 4  
135 11 Y 1 A HIS 17 ? A HIS 5  
136 11 Y 1 A HIS 18 ? A HIS 6  
137 11 Y 1 A GLU 19 ? A GLU 7  
138 11 Y 1 A SER 20 ? A SER 8  
139 11 Y 1 A ASP 21 ? A ASP 9  
140 11 Y 1 A ASP 22 ? A ASP 10 
141 11 Y 1 A ASP 23 ? A ASP 11 
142 11 Y 1 A ASP 24 ? A ASP 12 
143 11 Y 1 A LYS 25 ? A LYS 13 
144 12 Y 1 A HIS 13 ? A HIS 1  
145 12 Y 1 A HIS 14 ? A HIS 2  
146 12 Y 1 A HIS 15 ? A HIS 3  
147 12 Y 1 A HIS 16 ? A HIS 4  
148 12 Y 1 A HIS 17 ? A HIS 5  
149 12 Y 1 A HIS 18 ? A HIS 6  
150 12 Y 1 A GLU 19 ? A GLU 7  
151 12 Y 1 A SER 20 ? A SER 8  
152 12 Y 1 A ASP 21 ? A ASP 9  
153 12 Y 1 A ASP 22 ? A ASP 10 
154 12 Y 1 A ASP 23 ? A ASP 11 
155 12 Y 1 A ASP 24 ? A ASP 12 
156 12 Y 1 A LYS 25 ? A LYS 13 
157 13 Y 1 A HIS 13 ? A HIS 1  
158 13 Y 1 A HIS 14 ? A HIS 2  
159 13 Y 1 A HIS 15 ? A HIS 3  
160 13 Y 1 A HIS 16 ? A HIS 4  
161 13 Y 1 A HIS 17 ? A HIS 5  
162 13 Y 1 A HIS 18 ? A HIS 6  
163 13 Y 1 A GLU 19 ? A GLU 7  
164 13 Y 1 A SER 20 ? A SER 8  
165 13 Y 1 A ASP 21 ? A ASP 9  
166 13 Y 1 A ASP 22 ? A ASP 10 
167 13 Y 1 A ASP 23 ? A ASP 11 
168 13 Y 1 A ASP 24 ? A ASP 12 
169 13 Y 1 A LYS 25 ? A LYS 13 
170 14 Y 1 A HIS 13 ? A HIS 1  
171 14 Y 1 A HIS 14 ? A HIS 2  
172 14 Y 1 A HIS 15 ? A HIS 3  
173 14 Y 1 A HIS 16 ? A HIS 4  
174 14 Y 1 A HIS 17 ? A HIS 5  
175 14 Y 1 A HIS 18 ? A HIS 6  
176 14 Y 1 A GLU 19 ? A GLU 7  
177 14 Y 1 A SER 20 ? A SER 8  
178 14 Y 1 A ASP 21 ? A ASP 9  
179 14 Y 1 A ASP 22 ? A ASP 10 
180 14 Y 1 A ASP 23 ? A ASP 11 
181 14 Y 1 A ASP 24 ? A ASP 12 
182 14 Y 1 A LYS 25 ? A LYS 13 
183 15 Y 1 A HIS 13 ? A HIS 1  
184 15 Y 1 A HIS 14 ? A HIS 2  
185 15 Y 1 A HIS 15 ? A HIS 3  
186 15 Y 1 A HIS 16 ? A HIS 4  
187 15 Y 1 A HIS 17 ? A HIS 5  
188 15 Y 1 A HIS 18 ? A HIS 6  
189 15 Y 1 A GLU 19 ? A GLU 7  
190 15 Y 1 A SER 20 ? A SER 8  
191 15 Y 1 A ASP 21 ? A ASP 9  
192 15 Y 1 A ASP 22 ? A ASP 10 
193 15 Y 1 A ASP 23 ? A ASP 11 
194 15 Y 1 A ASP 24 ? A ASP 12 
195 15 Y 1 A LYS 25 ? A LYS 13 
196 16 Y 1 A HIS 13 ? A HIS 1  
197 16 Y 1 A HIS 14 ? A HIS 2  
198 16 Y 1 A HIS 15 ? A HIS 3  
199 16 Y 1 A HIS 16 ? A HIS 4  
200 16 Y 1 A HIS 17 ? A HIS 5  
201 16 Y 1 A HIS 18 ? A HIS 6  
202 16 Y 1 A GLU 19 ? A GLU 7  
203 16 Y 1 A SER 20 ? A SER 8  
204 16 Y 1 A ASP 21 ? A ASP 9  
205 16 Y 1 A ASP 22 ? A ASP 10 
206 16 Y 1 A ASP 23 ? A ASP 11 
207 16 Y 1 A ASP 24 ? A ASP 12 
208 16 Y 1 A LYS 25 ? A LYS 13 
209 17 Y 1 A HIS 13 ? A HIS 1  
210 17 Y 1 A HIS 14 ? A HIS 2  
211 17 Y 1 A HIS 15 ? A HIS 3  
212 17 Y 1 A HIS 16 ? A HIS 4  
213 17 Y 1 A HIS 17 ? A HIS 5  
214 17 Y 1 A HIS 18 ? A HIS 6  
215 17 Y 1 A GLU 19 ? A GLU 7  
216 17 Y 1 A SER 20 ? A SER 8  
217 17 Y 1 A ASP 21 ? A ASP 9  
218 17 Y 1 A ASP 22 ? A ASP 10 
219 17 Y 1 A ASP 23 ? A ASP 11 
220 17 Y 1 A ASP 24 ? A ASP 12 
221 17 Y 1 A LYS 25 ? A LYS 13 
222 18 Y 1 A HIS 13 ? A HIS 1  
223 18 Y 1 A HIS 14 ? A HIS 2  
224 18 Y 1 A HIS 15 ? A HIS 3  
225 18 Y 1 A HIS 16 ? A HIS 4  
226 18 Y 1 A HIS 17 ? A HIS 5  
227 18 Y 1 A HIS 18 ? A HIS 6  
228 18 Y 1 A GLU 19 ? A GLU 7  
229 18 Y 1 A SER 20 ? A SER 8  
230 18 Y 1 A ASP 21 ? A ASP 9  
231 18 Y 1 A ASP 22 ? A ASP 10 
232 18 Y 1 A ASP 23 ? A ASP 11 
233 18 Y 1 A ASP 24 ? A ASP 12 
234 18 Y 1 A LYS 25 ? A LYS 13 
235 19 Y 1 A HIS 13 ? A HIS 1  
236 19 Y 1 A HIS 14 ? A HIS 2  
237 19 Y 1 A HIS 15 ? A HIS 3  
238 19 Y 1 A HIS 16 ? A HIS 4  
239 19 Y 1 A HIS 17 ? A HIS 5  
240 19 Y 1 A HIS 18 ? A HIS 6  
241 19 Y 1 A GLU 19 ? A GLU 7  
242 19 Y 1 A SER 20 ? A SER 8  
243 19 Y 1 A ASP 21 ? A ASP 9  
244 19 Y 1 A ASP 22 ? A ASP 10 
245 19 Y 1 A ASP 23 ? A ASP 11 
246 19 Y 1 A ASP 24 ? A ASP 12 
247 19 Y 1 A LYS 25 ? A LYS 13 
248 20 Y 1 A HIS 13 ? A HIS 1  
249 20 Y 1 A HIS 14 ? A HIS 2  
250 20 Y 1 A HIS 15 ? A HIS 3  
251 20 Y 1 A HIS 16 ? A HIS 4  
252 20 Y 1 A HIS 17 ? A HIS 5  
253 20 Y 1 A HIS 18 ? A HIS 6  
254 20 Y 1 A GLU 19 ? A GLU 7  
255 20 Y 1 A SER 20 ? A SER 8  
256 20 Y 1 A ASP 21 ? A ASP 9  
257 20 Y 1 A ASP 22 ? A ASP 10 
258 20 Y 1 A ASP 23 ? A ASP 11 
259 20 Y 1 A ASP 24 ? A ASP 12 
260 20 Y 1 A LYS 25 ? A LYS 13 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        
;4'-HYDROXYCINNAMIC ACID
;
_pdbx_entity_nonpoly.comp_id     HC4 
#