data_1XN7 # _entry.id 1XN7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1XN7 pdb_00001xn7 10.2210/pdb1xn7/pdb RCSB RCSB030541 ? ? WWPDB D_1000030541 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-12-14 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1XN7 _pdbx_database_status.recvd_initial_deposition_date 2004-10-04 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_mr REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id ET95 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Shen, Y.' 1 'Acton, T.' 2 'Atreya, H.S.' 3 'Ma, L.' 4 'Liu, G.' 5 'Xiao, R.' 6 'Montelione, G.T.' 7 'Szyperski, T.' 8 'Northeast Structural Genomics Consortium (NESG)' 9 # _citation.id primary _citation.title 'Solution Structure of E.Coli Protein yhgG: The Northeast Structural Genomics Consortium Target ET95' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shen, Y.' 1 ? primary 'Acton, T.' 2 ? primary 'Atreya, H.S.' 3 ? primary 'Ma, L.' 4 ? primary 'Liu, G.' 5 ? primary 'Xiao, R.' 6 ? primary 'Montelione, G.T.' 7 ? primary 'Szyperski, T.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hypothetical protein yhgG' _entity.formula_weight 8669.136 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MASLIQVRDLLALRGRMEAAQISQTLNTPQPMINAMLQQLESMGKAVRIQEEPDGCLSGSCKSCPEGKACLREWWALR _entity_poly.pdbx_seq_one_letter_code_can MASLIQVRDLLALRGRMEAAQISQTLNTPQPMINAMLQQLESMGKAVRIQEEPDGCLSGSCKSCPEGKACLREWWALR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ET95 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 LEU n 1 5 ILE n 1 6 GLN n 1 7 VAL n 1 8 ARG n 1 9 ASP n 1 10 LEU n 1 11 LEU n 1 12 ALA n 1 13 LEU n 1 14 ARG n 1 15 GLY n 1 16 ARG n 1 17 MET n 1 18 GLU n 1 19 ALA n 1 20 ALA n 1 21 GLN n 1 22 ILE n 1 23 SER n 1 24 GLN n 1 25 THR n 1 26 LEU n 1 27 ASN n 1 28 THR n 1 29 PRO n 1 30 GLN n 1 31 PRO n 1 32 MET n 1 33 ILE n 1 34 ASN n 1 35 ALA n 1 36 MET n 1 37 LEU n 1 38 GLN n 1 39 GLN n 1 40 LEU n 1 41 GLU n 1 42 SER n 1 43 MET n 1 44 GLY n 1 45 LYS n 1 46 ALA n 1 47 VAL n 1 48 ARG n 1 49 ILE n 1 50 GLN n 1 51 GLU n 1 52 GLU n 1 53 PRO n 1 54 ASP n 1 55 GLY n 1 56 CYS n 1 57 LEU n 1 58 SER n 1 59 GLY n 1 60 SER n 1 61 CYS n 1 62 LYS n 1 63 SER n 1 64 CYS n 1 65 PRO n 1 66 GLU n 1 67 GLY n 1 68 LYS n 1 69 ALA n 1 70 CYS n 1 71 LEU n 1 72 ARG n 1 73 GLU n 1 74 TRP n 1 75 TRP n 1 76 ALA n 1 77 LEU n 1 78 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene yhgG _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 TRP 74 74 74 TRP TRP A . n A 1 75 TRP 75 75 75 TRP TRP A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ARG 78 78 78 ARG ARG A . n # _exptl.entry_id 1XN7 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1XN7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1XN7 _struct.title 'Solution Structure of E.Coli Protein yhgG: The Northeast Structural Genomics Consortium Target ET95' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1XN7 _struct_keywords.pdbx_keywords 'Structural Genomics, Unknown function' _struct_keywords.text ;ALPHA+BETA, GFT NMR, Structural Genomics, Protein Structure Initiative, PSI, NESG, ET95, Northeast Structural Genomics Consortium, Unknown function ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YHGG_ECOLI _struct_ref.pdbx_db_accession P64638 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MASLIQVRDLLALRGRMEAAQISQTLNTPQPMINAMLQQLESMGKAVRIQEEPDGCLSGSCKSCPEGKACLREWWALR _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1XN7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 78 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P64638 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 78 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 78 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 3 ? ARG A 14 ? SER A 3 ARG A 14 1 ? 12 HELX_P HELX_P2 2 GLU A 18 ? LEU A 26 ? GLU A 18 LEU A 26 1 ? 9 HELX_P HELX_P3 3 PRO A 29 ? GLY A 44 ? PRO A 29 GLY A 44 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 46 ? ILE A 49 ? ALA A 46 ILE A 49 A 2 TRP A 74 ? LEU A 77 ? TRP A 74 LEU A 77 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 49 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 49 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TRP _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 74 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TRP _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 74 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ASP 9 ? ? H A LEU 13 ? ? 1.49 2 1 O A ALA 19 ? ? H A SER 23 ? ? 1.51 3 1 O A ILE 5 ? ? H A ASP 9 ? ? 1.54 4 1 H A ILE 49 ? ? O A TRP 74 ? ? 1.55 5 2 O A ALA 19 ? ? H A SER 23 ? ? 1.50 6 2 O A ASP 9 ? ? H A LEU 13 ? ? 1.51 7 2 O A VAL 7 ? ? H A LEU 11 ? ? 1.56 8 2 O A LEU 4 ? ? H A ARG 8 ? ? 1.59 9 3 O A LEU 4 ? ? H A ARG 8 ? ? 1.48 10 3 O A VAL 7 ? ? H A LEU 11 ? ? 1.49 11 3 O A ASP 9 ? ? H A LEU 13 ? ? 1.51 12 3 O A LEU 40 ? ? H A GLY 44 ? ? 1.53 13 3 H A ILE 49 ? ? O A TRP 74 ? ? 1.53 14 3 O A ALA 19 ? ? H A SER 23 ? ? 1.54 15 4 O A ALA 19 ? ? H A SER 23 ? ? 1.51 16 4 O A ASP 9 ? ? H A LEU 13 ? ? 1.52 17 4 O A LEU 40 ? ? H A GLY 44 ? ? 1.53 18 4 H A ILE 49 ? ? O A TRP 74 ? ? 1.55 19 4 O A GLN 24 ? ? H A ASN 27 ? ? 1.56 20 4 O A GLN 6 ? ? H A LEU 10 ? ? 1.58 21 5 O A ASP 9 ? ? H A LEU 13 ? ? 1.49 22 5 O A ALA 19 ? ? H A SER 23 ? ? 1.50 23 5 O A GLN 24 ? ? H A ASN 27 ? ? 1.55 24 6 HE2 A GLU 18 ? ? O A GLU 73 ? ? 1.44 25 6 O A SER 23 ? ? H A THR 28 ? ? 1.48 26 6 O A ASP 9 ? ? H A LEU 13 ? ? 1.49 27 6 O A LEU 40 ? ? H A GLY 44 ? ? 1.52 28 6 O A ALA 19 ? ? H A SER 23 ? ? 1.55 29 6 O A ILE 49 ? ? H A TRP 74 ? ? 1.59 30 7 O A VAL 7 ? ? H A LEU 11 ? ? 1.48 31 7 O A LEU 4 ? ? H A ARG 8 ? ? 1.50 32 7 H A ILE 49 ? ? O A TRP 74 ? ? 1.51 33 7 O A ASP 9 ? ? H A LEU 13 ? ? 1.52 34 7 O A LEU 40 ? ? H A GLY 44 ? ? 1.59 35 8 O A ALA 19 ? ? H A SER 23 ? ? 1.48 36 8 O A ASP 9 ? ? H A LEU 13 ? ? 1.50 37 8 H A ILE 49 ? ? O A TRP 74 ? ? 1.53 38 8 O A GLN 24 ? ? H A ASN 27 ? ? 1.56 39 8 O A LEU 40 ? ? H A GLY 44 ? ? 1.58 40 9 O A ASP 9 ? ? H A LEU 13 ? ? 1.50 41 9 O A ILE 5 ? ? H A ASP 9 ? ? 1.51 42 9 O A ALA 19 ? ? H A SER 23 ? ? 1.51 43 9 H A ILE 49 ? ? O A TRP 74 ? ? 1.55 44 9 O A LEU 40 ? ? H A GLY 44 ? ? 1.59 45 10 O A ASP 9 ? ? H A LEU 13 ? ? 1.50 46 10 O A LEU 4 ? ? H A ARG 8 ? ? 1.51 47 10 O A ILE 5 ? ? H A ASP 9 ? ? 1.52 48 10 O A SER 23 ? ? H A THR 28 ? ? 1.52 49 10 O A ALA 19 ? ? H A SER 23 ? ? 1.52 50 10 O A VAL 7 ? ? H A LEU 11 ? ? 1.52 51 10 H A ILE 49 ? ? O A TRP 74 ? ? 1.55 52 10 O A LEU 40 ? ? H A GLY 44 ? ? 1.57 53 11 O A LEU 4 ? ? H A ARG 8 ? ? 1.49 54 11 O A ASP 9 ? ? H A LEU 13 ? ? 1.51 55 11 O A GLN 24 ? ? H A ASN 27 ? ? 1.54 56 11 O A VAL 7 ? ? H A LEU 11 ? ? 1.54 57 11 H A ILE 49 ? ? O A TRP 74 ? ? 1.55 58 11 O A SER 23 ? ? H A THR 28 ? ? 1.56 59 12 O A LEU 4 ? ? H A ARG 8 ? ? 1.48 60 12 O A VAL 7 ? ? H A LEU 11 ? ? 1.50 61 12 O A SER 23 ? ? H A THR 28 ? ? 1.51 62 12 O A ALA 19 ? ? H A SER 23 ? ? 1.57 63 12 O A ILE 5 ? ? H A ASP 9 ? ? 1.57 64 13 O A ASP 9 ? ? H A LEU 13 ? ? 1.49 65 13 O A VAL 7 ? ? H A LEU 11 ? ? 1.49 66 13 O A LEU 4 ? ? H A ARG 8 ? ? 1.50 67 13 O A SER 23 ? ? H A THR 28 ? ? 1.51 68 13 O A LEU 40 ? ? H A GLY 44 ? ? 1.54 69 13 H A ILE 49 ? ? O A TRP 74 ? ? 1.56 70 13 O A ILE 5 ? ? H A ASP 9 ? ? 1.57 71 14 O A VAL 7 ? ? H A LEU 11 ? ? 1.49 72 14 O A ASP 9 ? ? H A LEU 13 ? ? 1.51 73 14 O A ALA 19 ? ? H A SER 23 ? ? 1.52 74 14 O A LEU 40 ? ? H A GLY 44 ? ? 1.52 75 14 O A LEU 4 ? ? H A ARG 8 ? ? 1.55 76 14 H A ILE 49 ? ? O A TRP 74 ? ? 1.55 77 14 O A GLN 24 ? ? H A ASN 27 ? ? 1.56 78 15 O A VAL 7 ? ? H A LEU 11 ? ? 1.50 79 15 O A ASP 9 ? ? H A LEU 13 ? ? 1.51 80 15 H A ILE 49 ? ? O A TRP 74 ? ? 1.54 81 15 O A LEU 40 ? ? H A GLY 44 ? ? 1.60 82 16 O A ASP 9 ? ? H A LEU 13 ? ? 1.49 83 16 O A ILE 5 ? ? H A ASP 9 ? ? 1.51 84 16 O A ALA 19 ? ? H A SER 23 ? ? 1.51 85 16 O A SER 23 ? ? H A THR 28 ? ? 1.56 86 16 O A ILE 49 ? ? H A TRP 74 ? ? 1.58 87 17 O A LEU 4 ? ? H A ARG 8 ? ? 1.48 88 17 O A VAL 7 ? ? H A LEU 11 ? ? 1.49 89 17 O A ASP 9 ? ? H A LEU 13 ? ? 1.56 90 18 O A ALA 19 ? ? H A SER 23 ? ? 1.49 91 18 O A ASP 9 ? ? H A LEU 13 ? ? 1.51 92 18 O A ILE 5 ? ? H A ASP 9 ? ? 1.52 93 18 H A ILE 49 ? ? O A TRP 74 ? ? 1.55 94 18 H A VAL 47 ? ? O A ALA 76 ? ? 1.57 95 18 O A LEU 40 ? ? H A GLY 44 ? ? 1.59 96 19 O A LEU 4 ? ? H A ARG 8 ? ? 1.48 97 19 O A ASP 9 ? ? H A LEU 13 ? ? 1.48 98 19 O A VAL 7 ? ? H A LEU 11 ? ? 1.49 99 19 H A ILE 49 ? ? O A TRP 74 ? ? 1.53 100 19 O A LEU 40 ? ? H A GLY 44 ? ? 1.54 101 19 O A ILE 5 ? ? H A ASP 9 ? ? 1.56 102 19 O A GLN 24 ? ? H A ASN 27 ? ? 1.58 103 19 O A SER 23 ? ? H A THR 28 ? ? 1.59 104 20 O A ASP 9 ? ? H A LEU 13 ? ? 1.50 105 20 H A ILE 49 ? ? O A TRP 74 ? ? 1.57 106 20 O A ALA 19 ? ? H A SER 23 ? ? 1.59 107 20 O A SER 23 ? ? H A THR 28 ? ? 1.60 108 20 O A ILE 49 ? ? H A TRP 74 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 27 ? ? 39.12 30.60 2 1 MET A 32 ? ? -143.59 -48.14 3 1 PRO A 53 ? ? -75.01 -162.39 4 1 SER A 58 ? ? -177.98 128.71 5 1 SER A 63 ? ? -173.16 120.23 6 1 PRO A 65 ? ? -75.01 -162.18 7 1 LYS A 68 ? ? 60.67 166.46 8 1 ARG A 72 ? ? -64.72 87.73 9 2 ALA A 2 ? ? -111.31 -169.33 10 2 ASN A 27 ? ? 37.85 32.22 11 2 MET A 32 ? ? -142.65 -45.20 12 2 PRO A 53 ? ? -74.91 -162.36 13 2 CYS A 56 ? ? -147.80 -58.22 14 2 LEU A 57 ? ? 62.16 122.60 15 2 LYS A 62 ? ? 64.64 117.55 16 2 CYS A 64 ? ? -163.74 72.67 17 2 PRO A 65 ? ? -75.02 -162.41 18 2 GLU A 66 ? ? -124.82 -150.83 19 2 ALA A 69 ? ? -42.62 158.42 20 2 LEU A 71 ? ? -49.48 160.54 21 2 ARG A 72 ? ? -65.18 90.92 22 3 SER A 3 ? ? 175.98 161.14 23 3 ASN A 27 ? ? 38.84 31.12 24 3 MET A 32 ? ? -142.55 -46.72 25 3 GLU A 52 ? ? -46.62 107.08 26 3 PRO A 53 ? ? -74.99 -162.36 27 3 CYS A 61 ? ? 76.25 -62.92 28 3 PRO A 65 ? ? -74.97 -162.34 29 3 ARG A 72 ? ? -63.63 88.79 30 4 ASN A 27 ? ? 37.75 32.34 31 4 MET A 32 ? ? -143.87 -46.18 32 4 PRO A 53 ? ? -74.98 -162.32 33 4 ASP A 54 ? ? 179.99 166.15 34 4 SER A 63 ? ? 69.89 121.33 35 4 PRO A 65 ? ? -74.93 -162.14 36 4 GLU A 66 ? ? -124.20 -149.59 37 4 ARG A 72 ? ? -64.45 90.48 38 5 ALA A 2 ? ? -172.03 139.73 39 5 ASN A 27 ? ? 39.10 30.73 40 5 MET A 32 ? ? -143.77 -45.07 41 5 LYS A 45 ? ? -101.57 -64.34 42 5 GLU A 52 ? ? -41.77 101.95 43 5 PRO A 53 ? ? -75.03 -162.39 44 5 CYS A 61 ? ? 67.48 103.37 45 5 LYS A 62 ? ? 56.49 178.20 46 5 PRO A 65 ? ? -74.96 -162.33 47 5 GLU A 66 ? ? -129.14 -150.65 48 5 ARG A 72 ? ? -63.75 90.04 49 6 ALA A 2 ? ? -49.44 173.29 50 6 MET A 17 ? ? -177.33 148.70 51 6 MET A 32 ? ? -146.64 -46.17 52 6 PRO A 53 ? ? -74.93 -162.38 53 6 ASP A 54 ? ? 178.37 139.94 54 6 LYS A 62 ? ? 68.95 155.35 55 6 SER A 63 ? ? 64.55 126.50 56 6 CYS A 64 ? ? -172.02 147.49 57 6 PRO A 65 ? ? -74.98 -162.23 58 6 ALA A 69 ? ? 179.15 156.25 59 6 ARG A 72 ? ? -63.83 91.18 60 7 SER A 3 ? ? 170.70 162.38 61 7 ASN A 27 ? ? 37.12 34.51 62 7 MET A 32 ? ? -143.06 -44.58 63 7 LYS A 45 ? ? -100.62 -66.25 64 7 PRO A 53 ? ? -75.06 -162.50 65 7 SER A 60 ? ? 40.94 80.16 66 7 SER A 63 ? ? 179.91 100.20 67 7 PRO A 65 ? ? -74.94 -162.36 68 7 GLU A 66 ? ? -121.07 -149.48 69 7 ARG A 72 ? ? -62.54 89.10 70 8 ALA A 2 ? ? -46.20 170.18 71 8 ASN A 27 ? ? 39.66 29.86 72 8 MET A 32 ? ? -145.33 -44.39 73 8 LYS A 45 ? ? -100.95 -69.16 74 8 GLU A 52 ? ? -39.61 110.45 75 8 PRO A 53 ? ? -75.07 -162.23 76 8 CYS A 56 ? ? 74.98 152.62 77 8 CYS A 61 ? ? -175.86 -62.08 78 8 PRO A 65 ? ? -75.00 -162.19 79 8 GLU A 66 ? ? -128.67 -150.24 80 8 ALA A 69 ? ? 61.21 91.49 81 8 ARG A 72 ? ? -68.22 83.51 82 9 ALA A 2 ? ? -56.84 -167.05 83 9 ASN A 27 ? ? 38.84 32.23 84 9 MET A 32 ? ? -142.77 -47.97 85 9 GLU A 52 ? ? -46.34 151.41 86 9 PRO A 53 ? ? -74.95 -162.41 87 9 CYS A 56 ? ? -145.05 -55.21 88 9 SER A 58 ? ? -152.73 -59.75 89 9 CYS A 61 ? ? -171.87 124.84 90 9 LYS A 62 ? ? 63.45 165.80 91 9 PRO A 65 ? ? -75.04 -162.23 92 9 ALA A 69 ? ? 67.35 142.53 93 9 ARG A 72 ? ? -63.30 89.69 94 10 SER A 3 ? ? 172.36 162.33 95 10 ASN A 27 ? ? 39.71 30.40 96 10 MET A 32 ? ? -148.98 -44.25 97 10 GLU A 52 ? ? -39.53 116.60 98 10 PRO A 53 ? ? -74.90 -162.39 99 10 CYS A 56 ? ? 178.22 159.94 100 10 PRO A 65 ? ? -74.98 -162.46 101 10 GLU A 66 ? ? -127.49 -149.89 102 10 LYS A 68 ? ? 52.90 175.25 103 10 ARG A 72 ? ? -66.10 90.36 104 11 ASN A 27 ? ? 36.91 34.16 105 11 MET A 32 ? ? -144.04 -49.15 106 11 LYS A 45 ? ? -102.94 -64.09 107 11 GLU A 52 ? ? -38.60 99.07 108 11 PRO A 53 ? ? -74.97 -162.44 109 11 CYS A 56 ? ? 61.39 159.41 110 11 LEU A 57 ? ? -92.10 -62.75 111 11 SER A 58 ? ? 70.87 -62.51 112 11 LYS A 62 ? ? 76.44 139.05 113 11 CYS A 64 ? ? -176.22 116.08 114 11 PRO A 65 ? ? -74.99 -162.12 115 11 CYS A 70 ? ? -49.35 159.09 116 11 ARG A 72 ? ? -65.54 90.50 117 12 SER A 3 ? ? 178.43 165.05 118 12 ASN A 27 ? ? 39.16 30.71 119 12 MET A 32 ? ? -146.86 -44.96 120 12 GLU A 52 ? ? -38.51 101.18 121 12 PRO A 53 ? ? -74.96 -162.45 122 12 SER A 58 ? ? 62.34 121.57 123 12 LYS A 62 ? ? -170.70 -62.55 124 12 SER A 63 ? ? -158.82 -58.58 125 12 PRO A 65 ? ? -75.00 -162.21 126 12 GLU A 66 ? ? -119.50 -149.52 127 12 LYS A 68 ? ? 63.96 149.35 128 12 ARG A 72 ? ? -60.58 87.51 129 13 ASN A 27 ? ? 39.29 31.06 130 13 MET A 32 ? ? -146.60 -44.45 131 13 GLU A 52 ? ? -39.04 115.70 132 13 PRO A 53 ? ? -74.99 -162.46 133 13 SER A 58 ? ? -160.22 -56.40 134 13 LYS A 62 ? ? 70.14 -70.30 135 13 CYS A 64 ? ? -171.10 100.00 136 13 PRO A 65 ? ? -75.03 -162.21 137 13 ALA A 69 ? ? -172.68 103.60 138 13 ARG A 72 ? ? -63.48 86.92 139 14 ALA A 2 ? ? -56.13 -169.65 140 14 SER A 3 ? ? 161.76 165.51 141 14 ASN A 27 ? ? 37.69 33.20 142 14 MET A 32 ? ? -143.80 -49.23 143 14 GLU A 52 ? ? -44.74 103.25 144 14 PRO A 53 ? ? -75.02 -162.40 145 14 ASP A 54 ? ? 60.34 153.09 146 14 CYS A 56 ? ? 64.70 164.17 147 14 CYS A 61 ? ? 176.10 71.33 148 14 LYS A 62 ? ? 64.49 167.46 149 14 CYS A 64 ? ? 171.45 -56.31 150 14 PRO A 65 ? ? -74.98 -162.47 151 14 GLU A 66 ? ? -134.04 -156.38 152 14 ARG A 72 ? ? -62.93 90.69 153 15 ASN A 27 ? ? 37.91 32.43 154 15 MET A 32 ? ? -146.09 -47.61 155 15 LYS A 45 ? ? -99.86 -63.06 156 15 PRO A 53 ? ? -74.96 -162.50 157 15 LYS A 62 ? ? 61.51 111.47 158 15 SER A 63 ? ? 177.76 -56.73 159 15 PRO A 65 ? ? -74.97 -162.39 160 15 GLU A 66 ? ? -123.56 -149.61 161 15 ALA A 69 ? ? -174.98 138.08 162 16 ASN A 27 ? ? 39.11 30.48 163 16 MET A 32 ? ? -145.31 -46.32 164 16 PRO A 53 ? ? -74.98 -162.44 165 16 CYS A 56 ? ? 63.23 124.60 166 16 SER A 60 ? ? 53.35 81.58 167 16 PRO A 65 ? ? -75.00 -162.20 168 16 GLU A 66 ? ? 42.77 92.99 169 16 ALA A 69 ? ? -46.75 165.79 170 16 ARG A 72 ? ? -61.85 89.62 171 17 ALA A 2 ? ? -170.13 -172.28 172 17 ASN A 27 ? ? 37.94 31.64 173 17 MET A 32 ? ? -144.16 -44.45 174 17 PRO A 53 ? ? -75.10 -162.19 175 17 SER A 60 ? ? 68.44 162.97 176 17 CYS A 61 ? ? 67.63 -77.29 177 17 LYS A 62 ? ? 81.04 169.88 178 17 SER A 63 ? ? 66.73 123.42 179 17 PRO A 65 ? ? -75.05 -162.27 180 17 LYS A 68 ? ? -58.98 172.41 181 17 ARG A 72 ? ? -65.88 88.92 182 18 ASN A 27 ? ? 37.92 33.65 183 18 MET A 32 ? ? -145.86 -44.74 184 18 GLU A 52 ? ? -38.28 98.85 185 18 PRO A 53 ? ? -74.97 -162.39 186 18 ASP A 54 ? ? 64.92 163.80 187 18 CYS A 61 ? ? 67.93 164.55 188 18 LYS A 62 ? ? -42.84 157.40 189 18 SER A 63 ? ? 64.76 121.66 190 18 PRO A 65 ? ? -74.98 -162.15 191 18 ALA A 69 ? ? 63.21 123.50 192 18 ARG A 72 ? ? -66.59 90.32 193 19 ASN A 27 ? ? 38.18 31.86 194 19 MET A 32 ? ? -145.26 -49.06 195 19 GLU A 52 ? ? -39.62 146.04 196 19 PRO A 53 ? ? -74.97 -162.39 197 19 LEU A 57 ? ? -90.52 -62.95 198 19 SER A 58 ? ? 54.62 87.72 199 19 CYS A 61 ? ? -91.71 -62.01 200 19 SER A 63 ? ? 66.02 96.90 201 19 CYS A 64 ? ? 178.89 96.53 202 19 PRO A 65 ? ? -74.98 -162.20 203 19 GLU A 66 ? ? -124.37 -149.32 204 19 ALA A 69 ? ? -176.45 129.37 205 19 ARG A 72 ? ? -64.08 90.03 206 20 MET A 32 ? ? -144.25 -49.29 207 20 GLU A 52 ? ? -42.33 108.14 208 20 PRO A 53 ? ? -75.02 -162.32 209 20 SER A 60 ? ? 64.26 139.98 210 20 LYS A 62 ? ? -169.85 -63.69 211 20 PRO A 65 ? ? -75.01 -162.29 212 20 GLU A 66 ? ? -126.27 -150.88 213 20 ALA A 69 ? ? -178.06 139.54 214 20 ARG A 72 ? ? -68.05 90.09 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_nmr_ensemble.entry_id 1XN7 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1XN7 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.13 mM, NMR Buffer 6.5, 5% D2O, 0.02% NaN3, 10mM DTT, 5mM CaCl2, 100mM NaCl, 20mM MES, pH 6.5' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 'GFT (4,3)D HNNCabCa' 2 1 1 'GFT (4,3)D CabCa(CO)NHN' 3 1 1 'GFT (5,2)D HACACONHN' 4 1 1 'Simultaneous Heteronuclear resolved [1H,1H]-NOESY' 5 1 1 'GFT (4,3)D HCCH' # _pdbx_nmr_details.entry_id 1XN7 _pdbx_nmr_details.text 'This structure was determined using GFT techniques.' # _pdbx_nmr_refine.entry_id 1XN7 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal PROSA 6.0 processing 'Guentert, P.' 1 XEASY 1.3.1.3 'data analysis' 'Bartels, C.' 2 DYANA 1.5 'structure solution' 'Guentert, P.' 3 AutoAssign 1.13.2 'data analysis' 'Zimmerman, D.E.' 4 AutoStructure 2.0.0 'data analysis' 'Huang, Y.J.' 5 CYANA 1.0.5 'data analysis' 'Guentert, P.' 6 DYANA 1.5 refinement 'Guentert, P.' 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 MET N N N N 206 MET CA C N S 207 MET C C N N 208 MET O O N N 209 MET CB C N N 210 MET CG C N N 211 MET SD S N N 212 MET CE C N N 213 MET OXT O N N 214 MET H H N N 215 MET H2 H N N 216 MET HA H N N 217 MET HB2 H N N 218 MET HB3 H N N 219 MET HG2 H N N 220 MET HG3 H N N 221 MET HE1 H N N 222 MET HE2 H N N 223 MET HE3 H N N 224 MET HXT H N N 225 PRO N N N N 226 PRO CA C N S 227 PRO C C N N 228 PRO O O N N 229 PRO CB C N N 230 PRO CG C N N 231 PRO CD C N N 232 PRO OXT O N N 233 PRO H H N N 234 PRO HA H N N 235 PRO HB2 H N N 236 PRO HB3 H N N 237 PRO HG2 H N N 238 PRO HG3 H N N 239 PRO HD2 H N N 240 PRO HD3 H N N 241 PRO HXT H N N 242 SER N N N N 243 SER CA C N S 244 SER C C N N 245 SER O O N N 246 SER CB C N N 247 SER OG O N N 248 SER OXT O N N 249 SER H H N N 250 SER H2 H N N 251 SER HA H N N 252 SER HB2 H N N 253 SER HB3 H N N 254 SER HG H N N 255 SER HXT H N N 256 THR N N N N 257 THR CA C N S 258 THR C C N N 259 THR O O N N 260 THR CB C N R 261 THR OG1 O N N 262 THR CG2 C N N 263 THR OXT O N N 264 THR H H N N 265 THR H2 H N N 266 THR HA H N N 267 THR HB H N N 268 THR HG1 H N N 269 THR HG21 H N N 270 THR HG22 H N N 271 THR HG23 H N N 272 THR HXT H N N 273 TRP N N N N 274 TRP CA C N S 275 TRP C C N N 276 TRP O O N N 277 TRP CB C N N 278 TRP CG C Y N 279 TRP CD1 C Y N 280 TRP CD2 C Y N 281 TRP NE1 N Y N 282 TRP CE2 C Y N 283 TRP CE3 C Y N 284 TRP CZ2 C Y N 285 TRP CZ3 C Y N 286 TRP CH2 C Y N 287 TRP OXT O N N 288 TRP H H N N 289 TRP H2 H N N 290 TRP HA H N N 291 TRP HB2 H N N 292 TRP HB3 H N N 293 TRP HD1 H N N 294 TRP HE1 H N N 295 TRP HE3 H N N 296 TRP HZ2 H N N 297 TRP HZ3 H N N 298 TRP HH2 H N N 299 TRP HXT H N N 300 VAL N N N N 301 VAL CA C N S 302 VAL C C N N 303 VAL O O N N 304 VAL CB C N N 305 VAL CG1 C N N 306 VAL CG2 C N N 307 VAL OXT O N N 308 VAL H H N N 309 VAL H2 H N N 310 VAL HA H N N 311 VAL HB H N N 312 VAL HG11 H N N 313 VAL HG12 H N N 314 VAL HG13 H N N 315 VAL HG21 H N N 316 VAL HG22 H N N 317 VAL HG23 H N N 318 VAL HXT H N N 319 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PRO N CA sing N N 214 PRO N CD sing N N 215 PRO N H sing N N 216 PRO CA C sing N N 217 PRO CA CB sing N N 218 PRO CA HA sing N N 219 PRO C O doub N N 220 PRO C OXT sing N N 221 PRO CB CG sing N N 222 PRO CB HB2 sing N N 223 PRO CB HB3 sing N N 224 PRO CG CD sing N N 225 PRO CG HG2 sing N N 226 PRO CG HG3 sing N N 227 PRO CD HD2 sing N N 228 PRO CD HD3 sing N N 229 PRO OXT HXT sing N N 230 SER N CA sing N N 231 SER N H sing N N 232 SER N H2 sing N N 233 SER CA C sing N N 234 SER CA CB sing N N 235 SER CA HA sing N N 236 SER C O doub N N 237 SER C OXT sing N N 238 SER CB OG sing N N 239 SER CB HB2 sing N N 240 SER CB HB3 sing N N 241 SER OG HG sing N N 242 SER OXT HXT sing N N 243 THR N CA sing N N 244 THR N H sing N N 245 THR N H2 sing N N 246 THR CA C sing N N 247 THR CA CB sing N N 248 THR CA HA sing N N 249 THR C O doub N N 250 THR C OXT sing N N 251 THR CB OG1 sing N N 252 THR CB CG2 sing N N 253 THR CB HB sing N N 254 THR OG1 HG1 sing N N 255 THR CG2 HG21 sing N N 256 THR CG2 HG22 sing N N 257 THR CG2 HG23 sing N N 258 THR OXT HXT sing N N 259 TRP N CA sing N N 260 TRP N H sing N N 261 TRP N H2 sing N N 262 TRP CA C sing N N 263 TRP CA CB sing N N 264 TRP CA HA sing N N 265 TRP C O doub N N 266 TRP C OXT sing N N 267 TRP CB CG sing N N 268 TRP CB HB2 sing N N 269 TRP CB HB3 sing N N 270 TRP CG CD1 doub Y N 271 TRP CG CD2 sing Y N 272 TRP CD1 NE1 sing Y N 273 TRP CD1 HD1 sing N N 274 TRP CD2 CE2 doub Y N 275 TRP CD2 CE3 sing Y N 276 TRP NE1 CE2 sing Y N 277 TRP NE1 HE1 sing N N 278 TRP CE2 CZ2 sing Y N 279 TRP CE3 CZ3 doub Y N 280 TRP CE3 HE3 sing N N 281 TRP CZ2 CH2 doub Y N 282 TRP CZ2 HZ2 sing N N 283 TRP CZ3 CH2 sing Y N 284 TRP CZ3 HZ3 sing N N 285 TRP CH2 HH2 sing N N 286 TRP OXT HXT sing N N 287 VAL N CA sing N N 288 VAL N H sing N N 289 VAL N H2 sing N N 290 VAL CA C sing N N 291 VAL CA CB sing N N 292 VAL CA HA sing N N 293 VAL C O doub N N 294 VAL C OXT sing N N 295 VAL CB CG1 sing N N 296 VAL CB CG2 sing N N 297 VAL CB HB sing N N 298 VAL CG1 HG11 sing N N 299 VAL CG1 HG12 sing N N 300 VAL CG1 HG13 sing N N 301 VAL CG2 HG21 sing N N 302 VAL CG2 HG22 sing N N 303 VAL CG2 HG23 sing N N 304 VAL OXT HXT sing N N 305 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 600 2 ? Varian INOVA 750 # _atom_sites.entry_id 1XN7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_