data_1XPV # _entry.id 1XPV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1XPV pdb_00001xpv 10.2210/pdb1xpv/pdb RCSB RCSB030625 ? ? WWPDB D_1000030625 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-12-14 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-01-31 5 'Structure model' 1 4 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation_author 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond 6 5 'Structure model' database_2 7 5 'Structure model' pdbx_nmr_software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation_author.name' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' 4 5 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1XPV _pdbx_database_status.recvd_initial_deposition_date 2004-10-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id XcR50 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Shao, Y.' 1 'Acton, T.B.' 2 'Liu, G.' 3 'Ma, L.' 4 'Shen, Y.' 5 'Xiao, R.' 6 'Montelione, G.T.' 7 'Szyperski, T.' 8 'Northeast Structural Genomics Consortium (NESG)' 9 # _citation.id primary _citation.title 'Solution Structure of Northeast Structural Genomics Target Protein XcR50 from X. Campestris' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shao, Y.' 1 ? primary 'Acton, T.B.' 2 ? primary 'Liu, G.' 3 ? primary 'Ma, L.' 4 ? primary 'Shen, Y.' 5 ? primary 'Xiao, R.' 6 ? primary 'Montelione, G.T.' 7 ? primary 'Szyperski, T.' 8 ? primary 'Northeast Structural Genomics Consortium (NESG)' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'hypothetical protein XCC2852' _entity.formula_weight 8712.821 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MALTLYQRDDCHLCDQAVEALAQARAGAFFSVFIDDDAALESAYGLRVPVLRDPMGRELDWPFDAPRLRAWLDAAPHA _entity_poly.pdbx_seq_one_letter_code_can MALTLYQRDDCHLCDQAVEALAQARAGAFFSVFIDDDAALESAYGLRVPVLRDPMGRELDWPFDAPRLRAWLDAAPHA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier XcR50 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 LEU n 1 4 THR n 1 5 LEU n 1 6 TYR n 1 7 GLN n 1 8 ARG n 1 9 ASP n 1 10 ASP n 1 11 CYS n 1 12 HIS n 1 13 LEU n 1 14 CYS n 1 15 ASP n 1 16 GLN n 1 17 ALA n 1 18 VAL n 1 19 GLU n 1 20 ALA n 1 21 LEU n 1 22 ALA n 1 23 GLN n 1 24 ALA n 1 25 ARG n 1 26 ALA n 1 27 GLY n 1 28 ALA n 1 29 PHE n 1 30 PHE n 1 31 SER n 1 32 VAL n 1 33 PHE n 1 34 ILE n 1 35 ASP n 1 36 ASP n 1 37 ASP n 1 38 ALA n 1 39 ALA n 1 40 LEU n 1 41 GLU n 1 42 SER n 1 43 ALA n 1 44 TYR n 1 45 GLY n 1 46 LEU n 1 47 ARG n 1 48 VAL n 1 49 PRO n 1 50 VAL n 1 51 LEU n 1 52 ARG n 1 53 ASP n 1 54 PRO n 1 55 MET n 1 56 GLY n 1 57 ARG n 1 58 GLU n 1 59 LEU n 1 60 ASP n 1 61 TRP n 1 62 PRO n 1 63 PHE n 1 64 ASP n 1 65 ALA n 1 66 PRO n 1 67 ARG n 1 68 LEU n 1 69 ARG n 1 70 ALA n 1 71 TRP n 1 72 LEU n 1 73 ASP n 1 74 ALA n 1 75 ALA n 1 76 PRO n 1 77 HIS n 1 78 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Xanthomonas _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Xanthomonas campestris' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 339 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 TRP 71 71 71 TRP TRP A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 ALA 78 78 78 ALA ALA A . n # _cell.entry_id 1XPV _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1XPV _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1XPV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1XPV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1XPV _struct.title 'Solution Structure of Northeast Structural Genomics Target Protein XcR50 from X. Campestris' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1XPV _struct_keywords.pdbx_keywords 'Structural genomics, unknown function' _struct_keywords.text ;ALPHA+BETA, GFT NMR, Structural Genomics, NESGC, XcR50, protein structure initiative, PSI, Northeast Structural Genomics Consortium, unknown function ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8P6W3_XANCP _struct_ref.pdbx_db_accession Q8P6W3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MALTLYQRDDCHLCDQAVEALAQARAGAFFSVFIDDDAALESAYGLRVPVLRDPMGRELDWPFDAPRLRAWLDAAPHA _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1XPV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 78 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8P6W3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 78 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 78 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 12 ? ARG A 25 ? HIS A 12 ARG A 25 1 ? 14 HELX_P HELX_P2 2 ASP A 37 ? TYR A 44 ? ASP A 37 TYR A 44 1 ? 8 HELX_P HELX_P3 3 GLY A 45 ? VAL A 48 ? GLY A 45 VAL A 48 5 ? 4 HELX_P HELX_P4 4 ASP A 64 ? ALA A 74 ? ASP A 64 ALA A 74 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 30 ? PHE A 33 ? PHE A 30 PHE A 33 A 2 THR A 4 ? GLN A 7 ? THR A 4 GLN A 7 A 3 LEU A 51 ? ARG A 52 ? LEU A 51 ARG A 52 A 4 GLU A 58 ? LEU A 59 ? GLU A 58 LEU A 59 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 32 ? O VAL A 32 N GLN A 7 ? N GLN A 7 A 2 3 N THR A 4 ? N THR A 4 O ARG A 52 ? O ARG A 52 A 3 4 N LEU A 51 ? N LEU A 51 O LEU A 59 ? O LEU A 59 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A GLU 19 ? ? H A GLN 23 ? ? 1.55 2 4 H A ASP 53 ? ? O A ARG 57 ? ? 1.60 3 7 O A ALA 38 ? ? H A SER 42 ? ? 1.60 4 8 O A ALA 38 ? ? H A SER 42 ? ? 1.59 5 9 O A LEU 40 ? ? H A TYR 44 ? ? 1.59 6 11 O A LEU 40 ? ? H A TYR 44 ? ? 1.58 7 12 O A HIS 12 ? ? H A GLN 16 ? ? 1.52 8 12 O A LEU 40 ? ? H A TYR 44 ? ? 1.55 9 13 O A THR 4 ? ? H A ARG 52 ? ? 1.57 10 19 O A LEU 72 ? ? H A ALA 75 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? -90.67 -135.16 2 1 ASP A 9 ? ? -43.46 158.65 3 1 ASP A 10 ? ? 62.83 143.48 4 1 HIS A 12 ? ? -174.65 -64.30 5 1 ASP A 36 ? ? 168.96 -32.64 6 1 TYR A 44 ? ? -100.60 -71.92 7 1 ARG A 47 ? ? -90.50 37.33 8 2 LEU A 3 ? ? -64.45 -177.68 9 2 ASP A 9 ? ? 59.48 94.16 10 2 ASP A 10 ? ? 63.47 111.15 11 2 ASP A 36 ? ? 82.26 -52.57 12 2 TYR A 44 ? ? -107.90 -70.27 13 2 ARG A 47 ? ? -90.40 37.57 14 2 ARG A 57 ? ? 80.59 -172.34 15 2 ALA A 75 ? ? 39.97 64.43 16 2 HIS A 77 ? ? -127.74 -66.92 17 3 ALA A 2 ? ? -69.96 -157.55 18 3 ASP A 9 ? ? 48.90 80.08 19 3 HIS A 12 ? ? -172.58 -54.82 20 3 ASP A 35 ? ? -59.57 172.80 21 3 ASP A 37 ? ? -163.15 94.69 22 3 ARG A 47 ? ? -90.44 36.60 23 4 ALA A 2 ? ? -102.37 -166.38 24 4 HIS A 12 ? ? -167.73 -66.95 25 4 ASP A 36 ? ? 81.95 -53.02 26 4 TYR A 44 ? ? -110.67 -71.15 27 4 ARG A 47 ? ? -90.11 37.07 28 4 ALA A 75 ? ? -39.73 138.07 29 4 HIS A 77 ? ? 38.46 89.64 30 5 ALA A 2 ? ? -102.58 -169.75 31 5 ASP A 9 ? ? 73.07 147.18 32 5 CYS A 11 ? ? -131.63 -66.49 33 5 HIS A 12 ? ? -169.15 -59.14 34 5 ASP A 36 ? ? 81.84 -53.04 35 5 ASP A 37 ? ? -68.19 94.30 36 5 TYR A 44 ? ? -115.08 -73.34 37 5 ARG A 47 ? ? -89.76 36.42 38 6 ASP A 9 ? ? 78.06 -56.46 39 6 HIS A 12 ? ? -150.80 -78.22 40 6 ASP A 36 ? ? -177.46 -40.47 41 6 TYR A 44 ? ? -106.69 -70.70 42 6 ARG A 47 ? ? -90.63 37.43 43 6 ALA A 75 ? ? 39.67 86.45 44 7 ASP A 9 ? ? 64.03 90.20 45 7 HIS A 12 ? ? -167.23 -60.60 46 7 ASP A 37 ? ? 172.45 94.36 47 7 ARG A 47 ? ? -93.07 38.86 48 7 ALA A 75 ? ? 56.13 166.56 49 7 HIS A 77 ? ? -153.50 -70.69 50 8 ASP A 9 ? ? 64.19 101.25 51 8 ASP A 36 ? ? 169.05 -33.50 52 8 TYR A 44 ? ? -106.37 -74.52 53 8 ARG A 47 ? ? -92.38 38.30 54 9 ASP A 9 ? ? 66.55 173.02 55 9 ASP A 37 ? ? -167.32 97.61 56 9 TYR A 44 ? ? -109.94 -71.49 57 9 ARG A 47 ? ? -90.57 35.55 58 9 HIS A 77 ? ? 88.25 -43.82 59 10 GLN A 7 ? ? -174.67 142.93 60 10 ASP A 9 ? ? 64.31 129.77 61 10 ASP A 36 ? ? 81.63 -53.47 62 10 ASP A 37 ? ? -69.80 98.84 63 10 TYR A 44 ? ? -108.13 -71.14 64 10 ARG A 47 ? ? -91.92 36.70 65 10 HIS A 77 ? ? -109.86 -64.27 66 11 ASP A 10 ? ? 43.78 86.94 67 11 ASP A 36 ? ? 83.15 -50.99 68 11 TYR A 44 ? ? -108.43 -64.59 69 11 ARG A 47 ? ? -90.08 36.07 70 11 PRO A 76 ? ? -75.05 -168.61 71 12 ALA A 2 ? ? -117.89 -146.65 72 12 HIS A 12 ? ? 73.16 -66.41 73 12 ASP A 35 ? ? -46.82 162.90 74 12 ASP A 37 ? ? -172.75 98.27 75 12 ARG A 47 ? ? -90.98 34.03 76 12 HIS A 77 ? ? 178.08 148.67 77 13 ASP A 9 ? ? 61.31 121.41 78 13 ASP A 10 ? ? -40.35 109.28 79 13 ASP A 35 ? ? -49.93 165.41 80 13 ASP A 37 ? ? -173.59 99.67 81 13 ARG A 47 ? ? -92.03 32.78 82 13 ALA A 75 ? ? 39.90 64.42 83 13 HIS A 77 ? ? -142.61 -72.01 84 14 ASP A 9 ? ? 62.06 125.89 85 14 ASP A 36 ? ? 82.05 -53.28 86 14 TYR A 44 ? ? -104.95 -71.44 87 14 ARG A 47 ? ? -90.30 36.93 88 15 ASP A 9 ? ? -66.54 84.07 89 15 ASP A 10 ? ? 166.78 175.81 90 15 HIS A 12 ? ? -166.51 -75.20 91 15 ASP A 36 ? ? 166.96 -35.14 92 15 TYR A 44 ? ? -103.44 -70.63 93 15 ARG A 47 ? ? -90.01 35.43 94 15 ASP A 64 ? ? -123.22 -169.99 95 15 ALA A 75 ? ? 50.09 -178.59 96 16 ASP A 9 ? ? 54.04 171.66 97 16 ASP A 36 ? ? 80.42 -53.99 98 16 ASP A 37 ? ? -68.78 84.52 99 16 TYR A 44 ? ? -108.42 -67.88 100 16 ARG A 47 ? ? -90.07 35.18 101 16 ARG A 57 ? ? 74.48 -168.12 102 16 ALA A 75 ? ? -42.65 150.06 103 16 HIS A 77 ? ? -92.22 -63.45 104 17 ALA A 2 ? ? -107.24 -162.06 105 17 LEU A 3 ? ? -58.52 178.66 106 17 ASP A 9 ? ? 78.40 -161.93 107 17 CYS A 11 ? ? -134.15 -144.42 108 17 ASP A 35 ? ? -85.66 49.31 109 17 ASP A 36 ? ? -167.96 32.34 110 17 ASP A 37 ? ? 178.68 96.17 111 17 TYR A 44 ? ? -112.65 -72.68 112 17 ARG A 47 ? ? -92.36 39.50 113 17 ALA A 75 ? ? 39.76 64.31 114 17 HIS A 77 ? ? -137.99 -56.89 115 18 ALA A 2 ? ? -122.69 -163.65 116 18 GLN A 7 ? ? -170.13 141.81 117 18 ASP A 9 ? ? 42.83 91.17 118 18 HIS A 12 ? ? -179.57 -76.02 119 18 ASP A 36 ? ? 81.58 -53.26 120 18 TYR A 44 ? ? -110.54 -72.84 121 18 ARG A 47 ? ? -93.82 39.33 122 19 ASP A 10 ? ? -66.23 -170.78 123 19 HIS A 12 ? ? -178.60 -57.44 124 19 ASP A 36 ? ? 82.14 -53.02 125 19 ASP A 37 ? ? -67.55 99.02 126 19 ARG A 47 ? ? -89.62 35.87 127 19 HIS A 77 ? ? 38.47 89.94 128 20 ASP A 9 ? ? -60.75 88.34 129 20 ASP A 10 ? ? 62.24 149.04 130 20 ASP A 36 ? ? 81.93 -53.04 131 20 ASP A 37 ? ? -68.44 91.07 132 20 TYR A 44 ? ? -108.05 -69.53 133 20 ARG A 47 ? ? -90.18 36.99 134 20 MET A 55 ? ? -141.59 -43.16 135 20 ARG A 57 ? ? 77.83 -166.00 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_nmr_ensemble.entry_id 1XPV _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1XPV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.77 mM protein, 0.02% NaN3, 10mM DTT, 5mM CaCl2, 100mM NaCl, 20mM MES, 5% D2O, 95% H2O' _pdbx_nmr_sample_details.solvent_system '5% D2O, 95% H2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 'GFT (4,3)D HNNCABCA' 2 1 1 'GFT (4,3)D CABCA(CO)NHN' 3 1 1 'GFT (4,3)D HABCAB(CO)NHN' 4 1 1 'GFT (4,3)D HCCH' 5 1 1 'Simultaneous Heteronuclear-resolved [1H, 1H]-NOESY' # _pdbx_nmr_details.entry_id 1XPV _pdbx_nmr_details.text 'The structure was determined using GFT NMR spectroscopy.' # _pdbx_nmr_refine.entry_id 1XPV _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal AutoAssign 1.13 'data analysis' Zimmerman 1 NMRPipe 2.3 processing Delaglio 2 XEASY 1.3.1.3 'data analysis' Bartels 3 DYANA 1.5 'structure solution' Guenter 4 AutoStructure 2.0.0 'data analysis' Huang 5 CYANA 1.1 'data analysis' Guenter 6 DYANA 1.5 refinement Guenter 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 ILE N N N N 141 ILE CA C N S 142 ILE C C N N 143 ILE O O N N 144 ILE CB C N S 145 ILE CG1 C N N 146 ILE CG2 C N N 147 ILE CD1 C N N 148 ILE OXT O N N 149 ILE H H N N 150 ILE H2 H N N 151 ILE HA H N N 152 ILE HB H N N 153 ILE HG12 H N N 154 ILE HG13 H N N 155 ILE HG21 H N N 156 ILE HG22 H N N 157 ILE HG23 H N N 158 ILE HD11 H N N 159 ILE HD12 H N N 160 ILE HD13 H N N 161 ILE HXT H N N 162 LEU N N N N 163 LEU CA C N S 164 LEU C C N N 165 LEU O O N N 166 LEU CB C N N 167 LEU CG C N N 168 LEU CD1 C N N 169 LEU CD2 C N N 170 LEU OXT O N N 171 LEU H H N N 172 LEU H2 H N N 173 LEU HA H N N 174 LEU HB2 H N N 175 LEU HB3 H N N 176 LEU HG H N N 177 LEU HD11 H N N 178 LEU HD12 H N N 179 LEU HD13 H N N 180 LEU HD21 H N N 181 LEU HD22 H N N 182 LEU HD23 H N N 183 LEU HXT H N N 184 MET N N N N 185 MET CA C N S 186 MET C C N N 187 MET O O N N 188 MET CB C N N 189 MET CG C N N 190 MET SD S N N 191 MET CE C N N 192 MET OXT O N N 193 MET H H N N 194 MET H2 H N N 195 MET HA H N N 196 MET HB2 H N N 197 MET HB3 H N N 198 MET HG2 H N N 199 MET HG3 H N N 200 MET HE1 H N N 201 MET HE2 H N N 202 MET HE3 H N N 203 MET HXT H N N 204 PHE N N N N 205 PHE CA C N S 206 PHE C C N N 207 PHE O O N N 208 PHE CB C N N 209 PHE CG C Y N 210 PHE CD1 C Y N 211 PHE CD2 C Y N 212 PHE CE1 C Y N 213 PHE CE2 C Y N 214 PHE CZ C Y N 215 PHE OXT O N N 216 PHE H H N N 217 PHE H2 H N N 218 PHE HA H N N 219 PHE HB2 H N N 220 PHE HB3 H N N 221 PHE HD1 H N N 222 PHE HD2 H N N 223 PHE HE1 H N N 224 PHE HE2 H N N 225 PHE HZ H N N 226 PHE HXT H N N 227 PRO N N N N 228 PRO CA C N S 229 PRO C C N N 230 PRO O O N N 231 PRO CB C N N 232 PRO CG C N N 233 PRO CD C N N 234 PRO OXT O N N 235 PRO H H N N 236 PRO HA H N N 237 PRO HB2 H N N 238 PRO HB3 H N N 239 PRO HG2 H N N 240 PRO HG3 H N N 241 PRO HD2 H N N 242 PRO HD3 H N N 243 PRO HXT H N N 244 SER N N N N 245 SER CA C N S 246 SER C C N N 247 SER O O N N 248 SER CB C N N 249 SER OG O N N 250 SER OXT O N N 251 SER H H N N 252 SER H2 H N N 253 SER HA H N N 254 SER HB2 H N N 255 SER HB3 H N N 256 SER HG H N N 257 SER HXT H N N 258 THR N N N N 259 THR CA C N S 260 THR C C N N 261 THR O O N N 262 THR CB C N R 263 THR OG1 O N N 264 THR CG2 C N N 265 THR OXT O N N 266 THR H H N N 267 THR H2 H N N 268 THR HA H N N 269 THR HB H N N 270 THR HG1 H N N 271 THR HG21 H N N 272 THR HG22 H N N 273 THR HG23 H N N 274 THR HXT H N N 275 TRP N N N N 276 TRP CA C N S 277 TRP C C N N 278 TRP O O N N 279 TRP CB C N N 280 TRP CG C Y N 281 TRP CD1 C Y N 282 TRP CD2 C Y N 283 TRP NE1 N Y N 284 TRP CE2 C Y N 285 TRP CE3 C Y N 286 TRP CZ2 C Y N 287 TRP CZ3 C Y N 288 TRP CH2 C Y N 289 TRP OXT O N N 290 TRP H H N N 291 TRP H2 H N N 292 TRP HA H N N 293 TRP HB2 H N N 294 TRP HB3 H N N 295 TRP HD1 H N N 296 TRP HE1 H N N 297 TRP HE3 H N N 298 TRP HZ2 H N N 299 TRP HZ3 H N N 300 TRP HH2 H N N 301 TRP HXT H N N 302 TYR N N N N 303 TYR CA C N S 304 TYR C C N N 305 TYR O O N N 306 TYR CB C N N 307 TYR CG C Y N 308 TYR CD1 C Y N 309 TYR CD2 C Y N 310 TYR CE1 C Y N 311 TYR CE2 C Y N 312 TYR CZ C Y N 313 TYR OH O N N 314 TYR OXT O N N 315 TYR H H N N 316 TYR H2 H N N 317 TYR HA H N N 318 TYR HB2 H N N 319 TYR HB3 H N N 320 TYR HD1 H N N 321 TYR HD2 H N N 322 TYR HE1 H N N 323 TYR HE2 H N N 324 TYR HH H N N 325 TYR HXT H N N 326 VAL N N N N 327 VAL CA C N S 328 VAL C C N N 329 VAL O O N N 330 VAL CB C N N 331 VAL CG1 C N N 332 VAL CG2 C N N 333 VAL OXT O N N 334 VAL H H N N 335 VAL H2 H N N 336 VAL HA H N N 337 VAL HB H N N 338 VAL HG11 H N N 339 VAL HG12 H N N 340 VAL HG13 H N N 341 VAL HG21 H N N 342 VAL HG22 H N N 343 VAL HG23 H N N 344 VAL HXT H N N 345 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 ILE N CA sing N N 134 ILE N H sing N N 135 ILE N H2 sing N N 136 ILE CA C sing N N 137 ILE CA CB sing N N 138 ILE CA HA sing N N 139 ILE C O doub N N 140 ILE C OXT sing N N 141 ILE CB CG1 sing N N 142 ILE CB CG2 sing N N 143 ILE CB HB sing N N 144 ILE CG1 CD1 sing N N 145 ILE CG1 HG12 sing N N 146 ILE CG1 HG13 sing N N 147 ILE CG2 HG21 sing N N 148 ILE CG2 HG22 sing N N 149 ILE CG2 HG23 sing N N 150 ILE CD1 HD11 sing N N 151 ILE CD1 HD12 sing N N 152 ILE CD1 HD13 sing N N 153 ILE OXT HXT sing N N 154 LEU N CA sing N N 155 LEU N H sing N N 156 LEU N H2 sing N N 157 LEU CA C sing N N 158 LEU CA CB sing N N 159 LEU CA HA sing N N 160 LEU C O doub N N 161 LEU C OXT sing N N 162 LEU CB CG sing N N 163 LEU CB HB2 sing N N 164 LEU CB HB3 sing N N 165 LEU CG CD1 sing N N 166 LEU CG CD2 sing N N 167 LEU CG HG sing N N 168 LEU CD1 HD11 sing N N 169 LEU CD1 HD12 sing N N 170 LEU CD1 HD13 sing N N 171 LEU CD2 HD21 sing N N 172 LEU CD2 HD22 sing N N 173 LEU CD2 HD23 sing N N 174 LEU OXT HXT sing N N 175 MET N CA sing N N 176 MET N H sing N N 177 MET N H2 sing N N 178 MET CA C sing N N 179 MET CA CB sing N N 180 MET CA HA sing N N 181 MET C O doub N N 182 MET C OXT sing N N 183 MET CB CG sing N N 184 MET CB HB2 sing N N 185 MET CB HB3 sing N N 186 MET CG SD sing N N 187 MET CG HG2 sing N N 188 MET CG HG3 sing N N 189 MET SD CE sing N N 190 MET CE HE1 sing N N 191 MET CE HE2 sing N N 192 MET CE HE3 sing N N 193 MET OXT HXT sing N N 194 PHE N CA sing N N 195 PHE N H sing N N 196 PHE N H2 sing N N 197 PHE CA C sing N N 198 PHE CA CB sing N N 199 PHE CA HA sing N N 200 PHE C O doub N N 201 PHE C OXT sing N N 202 PHE CB CG sing N N 203 PHE CB HB2 sing N N 204 PHE CB HB3 sing N N 205 PHE CG CD1 doub Y N 206 PHE CG CD2 sing Y N 207 PHE CD1 CE1 sing Y N 208 PHE CD1 HD1 sing N N 209 PHE CD2 CE2 doub Y N 210 PHE CD2 HD2 sing N N 211 PHE CE1 CZ doub Y N 212 PHE CE1 HE1 sing N N 213 PHE CE2 CZ sing Y N 214 PHE CE2 HE2 sing N N 215 PHE CZ HZ sing N N 216 PHE OXT HXT sing N N 217 PRO N CA sing N N 218 PRO N CD sing N N 219 PRO N H sing N N 220 PRO CA C sing N N 221 PRO CA CB sing N N 222 PRO CA HA sing N N 223 PRO C O doub N N 224 PRO C OXT sing N N 225 PRO CB CG sing N N 226 PRO CB HB2 sing N N 227 PRO CB HB3 sing N N 228 PRO CG CD sing N N 229 PRO CG HG2 sing N N 230 PRO CG HG3 sing N N 231 PRO CD HD2 sing N N 232 PRO CD HD3 sing N N 233 PRO OXT HXT sing N N 234 SER N CA sing N N 235 SER N H sing N N 236 SER N H2 sing N N 237 SER CA C sing N N 238 SER CA CB sing N N 239 SER CA HA sing N N 240 SER C O doub N N 241 SER C OXT sing N N 242 SER CB OG sing N N 243 SER CB HB2 sing N N 244 SER CB HB3 sing N N 245 SER OG HG sing N N 246 SER OXT HXT sing N N 247 THR N CA sing N N 248 THR N H sing N N 249 THR N H2 sing N N 250 THR CA C sing N N 251 THR CA CB sing N N 252 THR CA HA sing N N 253 THR C O doub N N 254 THR C OXT sing N N 255 THR CB OG1 sing N N 256 THR CB CG2 sing N N 257 THR CB HB sing N N 258 THR OG1 HG1 sing N N 259 THR CG2 HG21 sing N N 260 THR CG2 HG22 sing N N 261 THR CG2 HG23 sing N N 262 THR OXT HXT sing N N 263 TRP N CA sing N N 264 TRP N H sing N N 265 TRP N H2 sing N N 266 TRP CA C sing N N 267 TRP CA CB sing N N 268 TRP CA HA sing N N 269 TRP C O doub N N 270 TRP C OXT sing N N 271 TRP CB CG sing N N 272 TRP CB HB2 sing N N 273 TRP CB HB3 sing N N 274 TRP CG CD1 doub Y N 275 TRP CG CD2 sing Y N 276 TRP CD1 NE1 sing Y N 277 TRP CD1 HD1 sing N N 278 TRP CD2 CE2 doub Y N 279 TRP CD2 CE3 sing Y N 280 TRP NE1 CE2 sing Y N 281 TRP NE1 HE1 sing N N 282 TRP CE2 CZ2 sing Y N 283 TRP CE3 CZ3 doub Y N 284 TRP CE3 HE3 sing N N 285 TRP CZ2 CH2 doub Y N 286 TRP CZ2 HZ2 sing N N 287 TRP CZ3 CH2 sing Y N 288 TRP CZ3 HZ3 sing N N 289 TRP CH2 HH2 sing N N 290 TRP OXT HXT sing N N 291 TYR N CA sing N N 292 TYR N H sing N N 293 TYR N H2 sing N N 294 TYR CA C sing N N 295 TYR CA CB sing N N 296 TYR CA HA sing N N 297 TYR C O doub N N 298 TYR C OXT sing N N 299 TYR CB CG sing N N 300 TYR CB HB2 sing N N 301 TYR CB HB3 sing N N 302 TYR CG CD1 doub Y N 303 TYR CG CD2 sing Y N 304 TYR CD1 CE1 sing Y N 305 TYR CD1 HD1 sing N N 306 TYR CD2 CE2 doub Y N 307 TYR CD2 HD2 sing N N 308 TYR CE1 CZ doub Y N 309 TYR CE1 HE1 sing N N 310 TYR CE2 CZ sing Y N 311 TYR CE2 HE2 sing N N 312 TYR CZ OH sing N N 313 TYR OH HH sing N N 314 TYR OXT HXT sing N N 315 VAL N CA sing N N 316 VAL N H sing N N 317 VAL N H2 sing N N 318 VAL CA C sing N N 319 VAL CA CB sing N N 320 VAL CA HA sing N N 321 VAL C O doub N N 322 VAL C OXT sing N N 323 VAL CB CG1 sing N N 324 VAL CB CG2 sing N N 325 VAL CB HB sing N N 326 VAL CG1 HG11 sing N N 327 VAL CG1 HG12 sing N N 328 VAL CG1 HG13 sing N N 329 VAL CG2 HG21 sing N N 330 VAL CG2 HG22 sing N N 331 VAL CG2 HG23 sing N N 332 VAL OXT HXT sing N N 333 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 600 2 ? Varian INOVA 750 # _atom_sites.entry_id 1XPV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_