data_1XRQ # _entry.id 1XRQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1XRQ pdb_00001xrq 10.2210/pdb1xrq/pdb RCSB RCSB030689 ? ? WWPDB D_1000030689 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1MTZ 'Crystal Structure Of The Tricorn Interacting Factor F1' unspecified PDB 1MU0 'Crystal Structure Of The Tricorn Interacting Factor F1 Complex With Pck' unspecified PDB 1MT3 'Crystal Structure Of The Tricorn Interacting Factor Selenomethionine-F1' unspecified PDB 1XQV 'The same protein G37A mutant' unspecified PDB 1XQW 'The same protein S105A mutant complex with PHE-LEU' unspecified PDB 1XQX 'The same protein S105A mutant complex with PCK' unspecified PDB 1XQY 'The same protein S105A mutant complex with PRO-LEU-GLY-GLY' unspecified PDB 1XRL 'The same protein Y205F mutant complex with inhibitor PCK' unspecified PDB 1XRM 'The same protein E213Q mutant soaked with peptide Ala-Phe' unspecified PDB 1XRN 'The same protein E213Q mutant soaked with peptide Phe-Ala' unspecified PDB 1XRO 'The same protein E213Q mutant soaked with peptide Phe-Leu' unspecified PDB 1XRP 'The same protein E213Q mutant soaked with peptide Pro-Leu-Gly-Gly' unspecified PDB 1XRR 'The same protein E245Q mutant soaked with peptide Pro-Pro' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1XRQ _pdbx_database_status.recvd_initial_deposition_date 2004-10-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Goettig, P.' 1 'Brandstetter, H.' 2 'Groll, M.' 3 'Goehring, W.' 4 'Konarev, P.V.' 5 'Svergun, D.I.' 6 'Huber, R.' 7 'Kim, J.-S.' 8 # _citation.id primary _citation.title 'X-ray snapshots of peptide processing in mutants of tricorn-interacting factor F1 from Thermoplasma acidophilum' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 280 _citation.page_first 33387 _citation.page_last 33396 _citation.year 2005 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15994304 _citation.pdbx_database_id_DOI 10.1074/jbc.M505030200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Goettig, P.' 1 ? primary 'Brandstetter, H.' 2 ? primary 'Groll, M.' 3 ? primary 'Goehring, W.' 4 ? primary 'Konarev, P.V.' 5 ? primary 'Svergun, D.I.' 6 ? primary 'Huber, R.' 7 ? primary 'Kim, J.-S.' 8 ? # _cell.entry_id 1XRQ _cell.length_a 57.560 _cell.length_b 61.910 _cell.length_c 80.030 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1XRQ _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Proline iminopeptidase' 33529.105 1 3.4.11.5 E245Q ? ? 2 non-polymer syn LEUCINE 131.173 1 ? ? ? ? 3 water nat water 18.015 30 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PIP, Prolyl aminopeptidase, PAP, Tricorn protease interacting factor F1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDQECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTID YGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYG SSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITV GEYDQVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL ; _entity_poly.pdbx_seq_one_letter_code_can ;MDQECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTID YGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYG SSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITV GEYDQVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 GLN n 1 4 GLU n 1 5 CYS n 1 6 ILE n 1 7 GLU n 1 8 ASN n 1 9 TYR n 1 10 ALA n 1 11 LYS n 1 12 VAL n 1 13 ASN n 1 14 GLY n 1 15 ILE n 1 16 TYR n 1 17 ILE n 1 18 TYR n 1 19 TYR n 1 20 LYS n 1 21 LEU n 1 22 CYS n 1 23 LYS n 1 24 ALA n 1 25 PRO n 1 26 GLU n 1 27 GLU n 1 28 LYS n 1 29 ALA n 1 30 LYS n 1 31 LEU n 1 32 MET n 1 33 THR n 1 34 MET n 1 35 HIS n 1 36 GLY n 1 37 GLY n 1 38 PRO n 1 39 GLY n 1 40 MET n 1 41 SER n 1 42 HIS n 1 43 ASP n 1 44 TYR n 1 45 LEU n 1 46 LEU n 1 47 SER n 1 48 LEU n 1 49 ARG n 1 50 ASP n 1 51 MET n 1 52 THR n 1 53 LYS n 1 54 GLU n 1 55 GLY n 1 56 ILE n 1 57 THR n 1 58 VAL n 1 59 LEU n 1 60 PHE n 1 61 TYR n 1 62 ASP n 1 63 GLN n 1 64 PHE n 1 65 GLY n 1 66 CYS n 1 67 GLY n 1 68 ARG n 1 69 SER n 1 70 GLU n 1 71 GLU n 1 72 PRO n 1 73 ASP n 1 74 GLN n 1 75 SER n 1 76 LYS n 1 77 PHE n 1 78 THR n 1 79 ILE n 1 80 ASP n 1 81 TYR n 1 82 GLY n 1 83 VAL n 1 84 GLU n 1 85 GLU n 1 86 ALA n 1 87 GLU n 1 88 ALA n 1 89 LEU n 1 90 ARG n 1 91 SER n 1 92 LYS n 1 93 LEU n 1 94 PHE n 1 95 GLY n 1 96 ASN n 1 97 GLU n 1 98 LYS n 1 99 VAL n 1 100 PHE n 1 101 LEU n 1 102 MET n 1 103 GLY n 1 104 SER n 1 105 SER n 1 106 TYR n 1 107 GLY n 1 108 GLY n 1 109 ALA n 1 110 LEU n 1 111 ALA n 1 112 LEU n 1 113 ALA n 1 114 TYR n 1 115 ALA n 1 116 VAL n 1 117 LYS n 1 118 TYR n 1 119 GLN n 1 120 ASP n 1 121 HIS n 1 122 LEU n 1 123 LYS n 1 124 GLY n 1 125 LEU n 1 126 ILE n 1 127 VAL n 1 128 SER n 1 129 GLY n 1 130 GLY n 1 131 LEU n 1 132 SER n 1 133 SER n 1 134 VAL n 1 135 PRO n 1 136 LEU n 1 137 THR n 1 138 VAL n 1 139 LYS n 1 140 GLU n 1 141 MET n 1 142 ASN n 1 143 ARG n 1 144 LEU n 1 145 ILE n 1 146 ASP n 1 147 GLU n 1 148 LEU n 1 149 PRO n 1 150 ALA n 1 151 LYS n 1 152 TYR n 1 153 ARG n 1 154 ASP n 1 155 ALA n 1 156 ILE n 1 157 LYS n 1 158 LYS n 1 159 TYR n 1 160 GLY n 1 161 SER n 1 162 SER n 1 163 GLY n 1 164 SER n 1 165 TYR n 1 166 GLU n 1 167 ASN n 1 168 PRO n 1 169 GLU n 1 170 TYR n 1 171 GLN n 1 172 GLU n 1 173 ALA n 1 174 VAL n 1 175 ASN n 1 176 TYR n 1 177 PHE n 1 178 TYR n 1 179 HIS n 1 180 GLN n 1 181 HIS n 1 182 LEU n 1 183 LEU n 1 184 ARG n 1 185 SER n 1 186 GLU n 1 187 ASP n 1 188 TRP n 1 189 PRO n 1 190 PRO n 1 191 GLU n 1 192 VAL n 1 193 LEU n 1 194 LYS n 1 195 SER n 1 196 LEU n 1 197 GLU n 1 198 TYR n 1 199 ALA n 1 200 GLU n 1 201 ARG n 1 202 ARG n 1 203 ASN n 1 204 VAL n 1 205 TYR n 1 206 ARG n 1 207 ILE n 1 208 MET n 1 209 ASN n 1 210 GLY n 1 211 PRO n 1 212 ASN n 1 213 GLU n 1 214 PHE n 1 215 THR n 1 216 ILE n 1 217 THR n 1 218 GLY n 1 219 THR n 1 220 ILE n 1 221 LYS n 1 222 ASP n 1 223 TRP n 1 224 ASP n 1 225 ILE n 1 226 THR n 1 227 ASP n 1 228 LYS n 1 229 ILE n 1 230 SER n 1 231 ALA n 1 232 ILE n 1 233 LYS n 1 234 ILE n 1 235 PRO n 1 236 THR n 1 237 LEU n 1 238 ILE n 1 239 THR n 1 240 VAL n 1 241 GLY n 1 242 GLU n 1 243 TYR n 1 244 ASP n 1 245 GLN n 1 246 VAL n 1 247 THR n 1 248 PRO n 1 249 ASN n 1 250 VAL n 1 251 ALA n 1 252 ARG n 1 253 VAL n 1 254 ILE n 1 255 HIS n 1 256 GLU n 1 257 LYS n 1 258 ILE n 1 259 ALA n 1 260 GLY n 1 261 SER n 1 262 GLU n 1 263 LEU n 1 264 HIS n 1 265 VAL n 1 266 PHE n 1 267 ARG n 1 268 ASP n 1 269 CYS n 1 270 SER n 1 271 HIS n 1 272 LEU n 1 273 THR n 1 274 MET n 1 275 TRP n 1 276 GLU n 1 277 ASP n 1 278 ARG n 1 279 GLU n 1 280 GLY n 1 281 TYR n 1 282 ASN n 1 283 LYS n 1 284 LEU n 1 285 LEU n 1 286 SER n 1 287 ASP n 1 288 PHE n 1 289 ILE n 1 290 LEU n 1 291 LYS n 1 292 HIS n 1 293 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermoplasma _entity_src_gen.pdbx_gene_src_gene TA0830 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermoplasma acidophilum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2303 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PRSET6C _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PIP_THEAC _struct_ref.pdbx_db_accession P96084 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDQECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTID YGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYG SSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITV GEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1XRQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 293 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P96084 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 293 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 293 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1XRQ _struct_ref_seq_dif.mon_id GLN _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 245 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P96084 _struct_ref_seq_dif.db_mon_id GLU _struct_ref_seq_dif.pdbx_seq_db_seq_num 245 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 245 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1XRQ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.18 _exptl_crystal.density_percent_sol 43.11 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pdbx_details 'PEG 6000, Bis-Tris, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2003-05-27 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU300' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 1XRQ _reflns.observed_criterion_sigma_I 1.0 _reflns.observed_criterion_sigma_F 1.0 _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 2.78 _reflns.number_obs 6902 _reflns.number_all 6902 _reflns.percent_possible_obs 99.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 13.1 _reflns.B_iso_Wilson_estimate 37.1 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.78 _reflns_shell.d_res_low 2.97 _reflns_shell.percent_possible_all 59.4 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1XRQ _refine.ls_number_reflns_obs 6889 _refine.ls_number_reflns_all 6902 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 1056834.87 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.98 _refine.ls_d_res_high 2.80 _refine.ls_percent_reflns_obs 93.0 _refine.ls_R_factor_obs 0.204 _refine.ls_R_factor_all 0.25 _refine.ls_R_factor_R_work 0.204 _refine.ls_R_factor_R_free 0.293 _refine.ls_R_factor_R_free_error 0.015 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.6 _refine.ls_number_reflns_R_free 384 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 43.5 _refine.aniso_B[1][1] 0.91 _refine.aniso_B[2][2] 9.48 _refine.aniso_B[3][3] -10.39 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.329475 _refine.solvent_model_param_bsol 33.6353 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1XRQ _refine_analyze.Luzzati_coordinate_error_obs 0.34 _refine_analyze.Luzzati_sigma_a_obs 0.46 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.47 _refine_analyze.Luzzati_sigma_a_free 0.51 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2328 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 2367 _refine_hist.d_res_high 2.80 _refine_hist.d_res_low 19.98 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.1 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 22.2 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.63 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.80 _refine_ls_shell.d_res_low 2.97 _refine_ls_shell.number_reflns_R_work 680 _refine_ls_shell.R_factor_R_work 0.32 _refine_ls_shell.percent_reflns_obs 59.4 _refine_ls_shell.R_factor_R_free 0.431 _refine_ls_shell.R_factor_R_free_error 0.068 _refine_ls_shell.percent_reflns_R_free 5.6 _refine_ls_shell.number_reflns_R_free 40 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1XRQ _struct.title 'Crystal structure of active site F1-mutant E245Q soaked with peptide Phe-Leu' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1XRQ _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'ALPHA-BETA HYDROLASE, CAGED ACTIVE SITE, SUBSTRATE RECOGNITION, HYDROGEN BONDED NETWORK, PEPTIDE CLEAVAGE, hydrolase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 41 ? GLU A 54 ? SER A 41 GLU A 54 5 ? 14 HELX_P HELX_P2 2 ASP A 73 ? PHE A 77 ? ASP A 73 PHE A 77 5 ? 5 HELX_P HELX_P3 3 THR A 78 ? GLY A 95 ? THR A 78 GLY A 95 1 ? 18 HELX_P HELX_P4 4 SER A 105 ? GLN A 119 ? SER A 105 GLN A 119 1 ? 15 HELX_P HELX_P5 5 SER A 133 ? LEU A 148 ? SER A 133 LEU A 148 1 ? 16 HELX_P HELX_P6 6 PRO A 149 ? SER A 162 ? PRO A 149 SER A 162 1 ? 14 HELX_P HELX_P7 7 ASN A 167 ? LEU A 182 ? ASN A 167 LEU A 182 1 ? 16 HELX_P HELX_P8 8 PRO A 189 ? GLU A 200 ? PRO A 189 GLU A 200 1 ? 12 HELX_P HELX_P9 9 ASN A 203 ? ASN A 209 ? ASN A 203 ASN A 209 1 ? 7 HELX_P HELX_P10 10 GLY A 218 ? TRP A 223 ? GLY A 218 TRP A 223 5 ? 6 HELX_P HELX_P11 11 ILE A 225 ? SER A 230 ? ILE A 225 SER A 230 1 ? 6 HELX_P HELX_P12 12 THR A 247 ? ILE A 258 ? THR A 247 ILE A 258 1 ? 12 HELX_P HELX_P13 13 LEU A 272 ? ASP A 277 ? LEU A 272 ASP A 277 1 ? 6 HELX_P HELX_P14 14 ASP A 277 ? HIS A 292 ? ASP A 277 HIS A 292 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 5 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 22 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 5 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 22 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.027 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 37 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 37 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 38 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 38 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.21 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel A 6 7 ? parallel A 7 8 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 6 ? VAL A 12 ? ILE A 6 VAL A 12 A 2 ILE A 15 ? CYS A 22 ? ILE A 15 CYS A 22 A 3 ILE A 56 ? TYR A 61 ? ILE A 56 TYR A 61 A 4 ALA A 29 ? MET A 34 ? ALA A 29 MET A 34 A 5 VAL A 99 ? SER A 104 ? VAL A 99 SER A 104 A 6 LEU A 122 ? SER A 128 ? LEU A 122 SER A 128 A 7 THR A 236 ? GLY A 241 ? THR A 236 GLY A 241 A 8 GLU A 262 ? PHE A 266 ? GLU A 262 PHE A 266 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ALA A 10 ? N ALA A 10 O ILE A 17 ? O ILE A 17 A 2 3 N LYS A 20 ? N LYS A 20 O PHE A 60 ? O PHE A 60 A 3 4 O THR A 57 ? O THR A 57 N LEU A 31 ? N LEU A 31 A 4 5 N MET A 32 ? N MET A 32 O PHE A 100 ? O PHE A 100 A 5 6 N LEU A 101 ? N LEU A 101 O ILE A 126 ? O ILE A 126 A 6 7 N LEU A 125 ? N LEU A 125 O LEU A 237 ? O LEU A 237 A 7 8 N VAL A 240 ? N VAL A 240 O PHE A 266 ? O PHE A 266 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id LEU _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 9 _struct_site.details 'BINDING SITE FOR RESIDUE LEU A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 GLY A 36 ? GLY A 36 . ? 1_555 ? 2 AC1 9 GLY A 37 ? GLY A 37 . ? 1_555 ? 3 AC1 9 MET A 40 ? MET A 40 . ? 1_555 ? 4 AC1 9 SER A 105 ? SER A 105 . ? 1_555 ? 5 AC1 9 MET A 141 ? MET A 141 . ? 1_555 ? 6 AC1 9 TYR A 205 ? TYR A 205 . ? 1_555 ? 7 AC1 9 GLU A 213 ? GLU A 213 . ? 1_555 ? 8 AC1 9 GLN A 245 ? GLN A 245 . ? 1_555 ? 9 AC1 9 HIS A 271 ? HIS A 271 . ? 1_555 ? # _database_PDB_matrix.entry_id 1XRQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1XRQ _atom_sites.fract_transf_matrix[1][1] 0.017373 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016152 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012495 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 MET 102 102 102 MET MET A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 ASP 120 120 120 ASP ASP A . n A 1 121 HIS 121 121 121 HIS HIS A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 MET 141 141 141 MET MET A . n A 1 142 ASN 142 142 142 ASN ASN A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 TYR 159 159 159 TYR TYR A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 SER 161 161 161 SER SER A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 ASN 167 167 167 ASN ASN A . n A 1 168 PRO 168 168 168 PRO PRO A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 TYR 170 170 170 TYR TYR A . n A 1 171 GLN 171 171 171 GLN GLN A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 TYR 176 176 176 TYR TYR A . n A 1 177 PHE 177 177 177 PHE PHE A . n A 1 178 TYR 178 178 178 TYR TYR A . n A 1 179 HIS 179 179 179 HIS HIS A . n A 1 180 GLN 180 180 180 GLN GLN A . n A 1 181 HIS 181 181 181 HIS HIS A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 ARG 184 184 184 ARG ARG A . n A 1 185 SER 185 185 185 SER SER A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 TRP 188 188 188 TRP TRP A . n A 1 189 PRO 189 189 189 PRO PRO A . n A 1 190 PRO 190 190 190 PRO PRO A . n A 1 191 GLU 191 191 191 GLU GLU A . n A 1 192 VAL 192 192 192 VAL VAL A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 LYS 194 194 194 LYS LYS A . n A 1 195 SER 195 195 195 SER SER A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 GLU 197 197 197 GLU GLU A . n A 1 198 TYR 198 198 198 TYR TYR A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 GLU 200 200 200 GLU GLU A . n A 1 201 ARG 201 201 201 ARG ARG A . n A 1 202 ARG 202 202 202 ARG ARG A . n A 1 203 ASN 203 203 203 ASN ASN A . n A 1 204 VAL 204 204 204 VAL VAL A . n A 1 205 TYR 205 205 205 TYR TYR A . n A 1 206 ARG 206 206 206 ARG ARG A . n A 1 207 ILE 207 207 207 ILE ILE A . n A 1 208 MET 208 208 208 MET MET A . n A 1 209 ASN 209 209 209 ASN ASN A . n A 1 210 GLY 210 210 210 GLY GLY A . n A 1 211 PRO 211 211 211 PRO PRO A . n A 1 212 ASN 212 212 212 ASN ASN A . n A 1 213 GLU 213 213 213 GLU GLU A . n A 1 214 PHE 214 214 214 PHE PHE A . n A 1 215 THR 215 215 215 THR THR A . n A 1 216 ILE 216 216 216 ILE ILE A . n A 1 217 THR 217 217 217 THR THR A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 THR 219 219 219 THR THR A . n A 1 220 ILE 220 220 220 ILE ILE A . n A 1 221 LYS 221 221 221 LYS LYS A . n A 1 222 ASP 222 222 222 ASP ASP A . n A 1 223 TRP 223 223 223 TRP TRP A . n A 1 224 ASP 224 224 224 ASP ASP A . n A 1 225 ILE 225 225 225 ILE ILE A . n A 1 226 THR 226 226 226 THR THR A . n A 1 227 ASP 227 227 227 ASP ASP A . n A 1 228 LYS 228 228 228 LYS LYS A . n A 1 229 ILE 229 229 229 ILE ILE A . n A 1 230 SER 230 230 230 SER SER A . n A 1 231 ALA 231 231 231 ALA ALA A . n A 1 232 ILE 232 232 232 ILE ILE A . n A 1 233 LYS 233 233 233 LYS LYS A . n A 1 234 ILE 234 234 234 ILE ILE A . n A 1 235 PRO 235 235 235 PRO PRO A . n A 1 236 THR 236 236 236 THR THR A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 ILE 238 238 238 ILE ILE A . n A 1 239 THR 239 239 239 THR THR A . n A 1 240 VAL 240 240 240 VAL VAL A . n A 1 241 GLY 241 241 241 GLY GLY A . n A 1 242 GLU 242 242 242 GLU GLU A . n A 1 243 TYR 243 243 243 TYR TYR A . n A 1 244 ASP 244 244 244 ASP ASP A . n A 1 245 GLN 245 245 245 GLN GLN A . n A 1 246 VAL 246 246 246 VAL VAL A . n A 1 247 THR 247 247 247 THR THR A . n A 1 248 PRO 248 248 248 PRO PRO A . n A 1 249 ASN 249 249 249 ASN ASN A . n A 1 250 VAL 250 250 250 VAL VAL A . n A 1 251 ALA 251 251 251 ALA ALA A . n A 1 252 ARG 252 252 252 ARG ARG A . n A 1 253 VAL 253 253 253 VAL VAL A . n A 1 254 ILE 254 254 254 ILE ILE A . n A 1 255 HIS 255 255 255 HIS HIS A . n A 1 256 GLU 256 256 256 GLU GLU A . n A 1 257 LYS 257 257 257 LYS LYS A . n A 1 258 ILE 258 258 258 ILE ILE A . n A 1 259 ALA 259 259 259 ALA ALA A . n A 1 260 GLY 260 260 260 GLY GLY A . n A 1 261 SER 261 261 261 SER SER A . n A 1 262 GLU 262 262 262 GLU GLU A . n A 1 263 LEU 263 263 263 LEU LEU A . n A 1 264 HIS 264 264 264 HIS HIS A . n A 1 265 VAL 265 265 265 VAL VAL A . n A 1 266 PHE 266 266 266 PHE PHE A . n A 1 267 ARG 267 267 267 ARG ARG A . n A 1 268 ASP 268 268 268 ASP ASP A . n A 1 269 CYS 269 269 269 CYS CYS A . n A 1 270 SER 270 270 270 SER SER A . n A 1 271 HIS 271 271 271 HIS HIS A . n A 1 272 LEU 272 272 272 LEU LEU A . n A 1 273 THR 273 273 273 THR THR A . n A 1 274 MET 274 274 274 MET MET A . n A 1 275 TRP 275 275 275 TRP TRP A . n A 1 276 GLU 276 276 276 GLU GLU A . n A 1 277 ASP 277 277 277 ASP ASP A . n A 1 278 ARG 278 278 278 ARG ARG A . n A 1 279 GLU 279 279 279 GLU GLU A . n A 1 280 GLY 280 280 280 GLY GLY A . n A 1 281 TYR 281 281 281 TYR TYR A . n A 1 282 ASN 282 282 282 ASN ASN A . n A 1 283 LYS 283 283 283 LYS LYS A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 LEU 285 285 285 LEU LEU A . n A 1 286 SER 286 286 286 SER SER A . n A 1 287 ASP 287 287 287 ASP ASP A . n A 1 288 PHE 288 288 288 PHE PHE A . n A 1 289 ILE 289 289 289 ILE ILE A . n A 1 290 LEU 290 290 290 LEU LEU A . n A 1 291 LYS 291 291 291 LYS LYS A . n A 1 292 HIS 292 292 292 HIS HIS A . n A 1 293 LEU 293 293 293 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 LEU 1 301 301 LEU LEU A . C 3 HOH 1 302 1 HOH WAT A . C 3 HOH 2 303 2 HOH WAT A . C 3 HOH 3 304 3 HOH WAT A . C 3 HOH 4 305 4 HOH WAT A . C 3 HOH 5 306 5 HOH WAT A . C 3 HOH 6 307 6 HOH WAT A . C 3 HOH 7 308 7 HOH WAT A . C 3 HOH 8 309 8 HOH WAT A . C 3 HOH 9 310 9 HOH WAT A . C 3 HOH 10 311 10 HOH WAT A . C 3 HOH 11 312 11 HOH WAT A . C 3 HOH 12 313 12 HOH WAT A . C 3 HOH 13 314 13 HOH WAT A . C 3 HOH 14 315 14 HOH WAT A . C 3 HOH 15 316 15 HOH WAT A . C 3 HOH 16 317 16 HOH WAT A . C 3 HOH 17 318 17 HOH WAT A . C 3 HOH 18 319 18 HOH WAT A . C 3 HOH 19 320 19 HOH WAT A . C 3 HOH 20 321 20 HOH WAT A . C 3 HOH 21 322 21 HOH WAT A . C 3 HOH 22 323 22 HOH WAT A . C 3 HOH 23 324 23 HOH WAT A . C 3 HOH 24 325 24 HOH WAT A . C 3 HOH 25 326 25 HOH WAT A . C 3 HOH 26 327 26 HOH WAT A . C 3 HOH 27 328 27 HOH WAT A . C 3 HOH 28 329 28 HOH WAT A . C 3 HOH 29 330 29 HOH WAT A . C 3 HOH 30 331 30 HOH WAT A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-07-12 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' struct_ref_seq_dif 3 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 MOSFLM 'data reduction' . ? 2 CCP4 'data scaling' '(TRUNCATE)' ? 3 CNS phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 25 ? ? -36.43 -72.26 2 1 GLU A 26 ? ? -113.80 66.57 3 1 MET A 40 ? ? -110.51 -128.83 4 1 GLN A 74 ? ? -49.22 -13.78 5 1 SER A 105 ? ? 58.48 -121.07 6 1 HIS A 121 ? ? -69.74 5.02 7 1 LYS A 158 ? ? -69.00 -77.23 8 1 SER A 164 ? ? -103.70 74.05 9 1 LEU A 183 ? ? -153.87 82.97 10 1 ARG A 184 ? ? -45.44 151.71 11 1 SER A 185 ? ? 0.62 62.55 12 1 ASP A 187 ? ? -110.99 52.78 13 1 TRP A 188 ? ? 6.39 119.33 14 1 PRO A 211 ? ? -47.85 -76.85 15 1 GLU A 213 ? ? -58.52 -73.50 16 1 THR A 215 ? ? -106.66 69.75 17 1 ASP A 224 ? ? -168.67 113.82 18 1 LYS A 228 ? ? -141.13 -24.43 19 1 THR A 247 ? ? -27.96 147.96 20 1 SER A 270 ? ? -108.41 -134.34 21 1 ASP A 277 ? ? -152.92 57.82 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 4 ? CG ? A GLU 4 CG 2 1 Y 1 A GLU 4 ? CD ? A GLU 4 CD 3 1 Y 1 A GLU 4 ? OE1 ? A GLU 4 OE1 4 1 Y 1 A GLU 4 ? OE2 ? A GLU 4 OE2 5 1 Y 0 A LYS 53 ? CE ? A LYS 53 CE 6 1 Y 0 A LYS 53 ? NZ ? A LYS 53 NZ 7 1 Y 0 A LYS 92 ? CD ? A LYS 92 CD 8 1 Y 0 A LYS 92 ? CE ? A LYS 92 CE 9 1 Y 0 A LYS 92 ? NZ ? A LYS 92 NZ 10 1 Y 0 A LYS 98 ? CD ? A LYS 98 CD 11 1 Y 0 A LYS 98 ? CE ? A LYS 98 CE 12 1 Y 0 A LYS 98 ? NZ ? A LYS 98 NZ 13 1 Y 0 A LYS 157 ? CG ? A LYS 157 CG 14 1 Y 0 A LYS 157 ? CD ? A LYS 157 CD 15 1 Y 0 A LYS 157 ? CE ? A LYS 157 CE 16 1 Y 0 A LYS 157 ? NZ ? A LYS 157 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A GLN 3 ? A GLN 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 LEUCINE LEU 3 water HOH #